Psyllid ID: psy4272


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MLPRAGVSPPGVSSEDSKTSPQNRKISPSKGVPSLLPMKDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNVSHEEIRTHKKHEQPRKESSYKETENTQFNSETNDLSKLEEPNKTSSILLAHLQQVQKDLGLGASDSLSSEKDIPSNLDLSQIPKPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPDMVVEYVKESSEARSASQKTNHQSAPADTSAPNTHMKSFEEFIREHYERSAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHLPVPSVPPLLAGALPPGQVEKLNDLYENERNMLIQELIRKKLGLLIQNNQNGGHAEDAPTDLSRKLKSDMEEDEAVKEETEEEEDSA
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHccccccHccccccccccccEEEEccccccccccEEEEccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccHHHHHHcccccccccccccccccccccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHEEccccccccccccccHHHHHHccHHHHHHHHHcccHHcccc
mlpragvsppgvssedsktspqnrkispskgvpsllpmkdirtsdpdwprptasFAATIADVATKTLPVIQELlsqrdgkpvgkatlpsplkakLSDYENKMKNVRESIRQKRLAQgltclqcgrsycrpynlkrhiqyecgkapqfpclycsyrarhkhdlkkhvtfkHAAYLDHFQAVQEELEVTtkelspgpkaenRHRFREFLNEHRnlernvsheeirthkkheqprkessyketentqfnsetndlskleepnktSSILLAHLQQVQKDlglgasdslssekdipsnldlsqipkpppssshtysnqIHKNLLQCntgrfrqvysshQIVELEKefrltnylpsdrrKVLSKELGLTERQIKIWFQNRRmklkrthpDMVVEYVKESSEArsasqktnhqsapadtsapnthMKSFEEFIREHyersavpfpasqpgehplatgelhgspleMQTLMEENASKLLLEKLREQTLEKHlrenhlpvpsvppllagalppgqvekLNDLYENERNMLIQELIRKKLGLLIQnnqngghaedaptDLSRKLKSDMEEDEAVKEETEEEEDSA
mlpragvsppgvssedsktspqnrkispskgvpsllpmkDIRTSDPDWPRPTASFAATIADVATKTLPVIQEllsqrdgkpvgkatlpsplkaklsdyENKMKNVRESIRQKrlaqgltclqcgrSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTtkelspgpkaenrhRFREFLnehrnlernvsheeirthkkheqprkessyketentqfnsetndlskleEPNKTSSILLAHLQQVQKDLGLGASDSLSSEKDIPSNLDLSQIPKPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHqivelekefrltnylpsdrrkvlskelglterqikiwfqnrrmklkrthPDMVVEYVKESSearsasqktnhqsapadtsapntHMKSFEEFIREHYERSAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHLPVPSVPPLLAGALPPGQVEKLNDLYENERNMLIQELIRKKLGLLIQNNqngghaedaptdLSRKlksdmeedeavkeeteeeedsa
MLPRAGVSPPGVSSEDSKTSPQNRKISPSKGVPSLLPMKDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNVSHEEIRTHKKHEQPRKESSYKETENTQFNSETNDLSKLEEPNKTSSILLAHLQQVQKdlglgasdslssEKDIPSNLDLSQIPKPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPDMVVEYVKESSEARSASQKTNHQSAPADTSAPNTHMKSFEEFIREHYERSAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHlpvpsvppllagalppgQVEKLNDLYENERNMLIQELIRKKLGLLIQNNQNGGHAEDAPTDLSRKLKSDMeedeavkeeteeeeDSA
*****************************************************SFAATIADVATKTLPVIQEL***************************************RLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEE**********************************************************************************************************************************IHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTH**MVV***********************************************************************************************************************VEKLNDLYENERNMLIQELIRKKLGLLIQ****************************************
*********************************SLLPMKDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLS***********LPS**K****************IRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRAR**************************************************************************************************************************************************************************QVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRR*****************************************************************************************************************************************LYENERNMLIQELIRKKLGLLIQN***************************************
****************************SKGVPSLLPMKDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNV****************************************PNKTSSILLAHLQQVQKDLGLGASDSLSSEKDIPSNLDLSQIP***********NQIHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPDMVVEYV*************************NTHMKSFEEFIREHYERSAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHLPVPSVPPLLAGALPPGQVEKLNDLYENERNMLIQELIRKKLGLLIQNNQNGGHAEDAPTDLSRK**********************
***********************************L**KDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNVSHE**********PR**S***ETE***************************************************************SSS*****Q**********GRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRT***************************************************SAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHLPVPSVPPLLAGALPPGQVEKLNDLYENERNMLIQELIRKKLGLLIQNNQ*************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRAGVSPPGVSSEDSKTSPQNRKISPSKGVPSLLPMKDIRTSDPDWPRPTASFAATIADVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKxxxxxxxxxxxxxxxxxxxxxQGLTCLQCGRSYCRPYNLKRHIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNVSHEEIRTHKKHEQPRKESSYKETENTQFNSETNDLSKLEEPNKTSSILLAHLQQVQKDLGLGASDSLSSEKDIPSNLDLSQIPKPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPDMVVEYVKESSEARSASQKTNHQSAPADTSAPNTHMKSFEEFIREHYERSAVPFPASQPGEHPLATGELHGSPLEMQTLMEENASKLLLEKLREQTLEKHLRENHLPVPSVPPLLAGALPPGQVEKLNDLYENERNMLIQELIRKKLGLLIQNNQNGGHAEDAPTDLxxxxxxxxxxxxxxxxxxxxxEDSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query575 2.2.26 [Sep-21-2011]
P09080307 Homeobox protein HB1 (Fra N/A N/A 0.175 0.328 0.456 1e-13
Q9PWD5269 Homeobox protein Hox-A9 O N/A N/A 0.191 0.408 0.411 1e-13
P13545308 Homeobox protein HB1 OS=S yes N/A 0.175 0.327 0.456 2e-13
Q1KKZ3249 Homeobox protein Hox-A9b N/A N/A 0.128 0.297 0.506 3e-13
P51783162 Homeobox protein Hox-A9 ( yes N/A 0.139 0.493 0.464 5e-13
P09631271 Homeobox protein Hox-A9 O yes N/A 0.139 0.295 0.464 6e-13
O42506283 Homeobox protein Hox-A9a N/A N/A 0.132 0.268 0.5 6e-13
P31269272 Homeobox protein Hox-A9 O yes N/A 0.139 0.294 0.464 7e-13
Q9PWL6250 Homeobox protein Hox-A9a no N/A 0.132 0.304 0.487 9e-13
Q1KKT0336 Homeobox protein Hox-D10a N/A N/A 0.121 0.208 0.507 1e-12
>sp|P09080|HMB1_TRIGR Homeobox protein HB1 (Fragment) OS=Tripneustes gratilla PE=2 SV=3 Back     alignment and function desciption
 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 59/103 (57%), Gaps = 2/103 (1%)

Query: 280 ASDSLSSEKDIPSNLDLSQIPKPPPSSS-HTYSNQIHKNL-LQCNTGRFRQVYSSHQIVE 337
            +  L S    P+N   SQ+  P  S+S + +      N+ L+    R RQ Y+ +Q +E
Sbjct: 144 GTGCLVSAAAEPNNNHCSQVMSPCKSTSGYPWMPVAGPNVGLEVGRKRCRQTYTRYQTLE 203

Query: 338 LEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKR 380
           LEKEF    YL   RR  LS  LGLTERQIKIWFQNRRMK K+
Sbjct: 204 LEKEFHFNRYLTRRRRIELSHLLGLTERQIKIWFQNRRMKYKK 246





Tripneustes gratilla (taxid: 7673)
>sp|Q9PWD5|HXA9_MORSA Homeobox protein Hox-A9 OS=Morone saxatilis GN=hoxa9 PE=3 SV=1 Back     alignment and function description
>sp|P13545|HMB1_STRPU Homeobox protein HB1 OS=Strongylocentrotus purpuratus PE=2 SV=2 Back     alignment and function description
>sp|Q1KKZ3|HXA9B_TAKRU Homeobox protein Hox-A9b OS=Takifugu rubripes GN=hoxa9b PE=3 SV=1 Back     alignment and function description
>sp|P51783|HXA9_CAVPO Homeobox protein Hox-A9 (Fragment) OS=Cavia porcellus GN=HOXA9 PE=2 SV=1 Back     alignment and function description
>sp|P09631|HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus GN=Hoxa9 PE=1 SV=2 Back     alignment and function description
>sp|O42506|HXA9A_TAKRU Homeobox protein Hox-A9a OS=Takifugu rubripes GN=hoxa9a PE=3 SV=1 Back     alignment and function description
>sp|P31269|HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens GN=HOXA9 PE=1 SV=4 Back     alignment and function description
>sp|Q9PWL6|HXA9A_DANRE Homeobox protein Hox-A9a OS=Danio rerio GN=hoxa9a PE=2 SV=2 Back     alignment and function description
>sp|Q1KKT0|HXDAA_TAKRU Homeobox protein Hox-D10a OS=Takifugu rubripes GN=hoxd10a PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
157278072267 HOXA9A [Oryzias latipes] gi|6252950|dbj| 0.172 0.370 0.427 5e-13
312384143481 hypothetical protein AND_02492 [Anophele 0.213 0.255 0.427 9e-13
301128888241 HoxB4 [Scyliorhinus canicula] 0.220 0.526 0.362 1e-12
221119570250 PREDICTED: homeobox protein Hox-B5-like 0.213 0.492 0.380 1e-12
410911106279 PREDICTED: homeobox protein Hox-A9a-like 0.132 0.272 0.513 2e-12
385654455257 Hox-A9a [Anguilla japonica] 0.121 0.272 0.540 2e-12
213511602263 homeobox protein Hox-A9b [Salmo salar] g 0.128 0.281 0.533 2e-12
165873657238 proboscipedia hox protein [Capitella tel 0.175 0.424 0.424 2e-12
332692469257 Homeobox A9a [Anguilla anguilla] 0.121 0.272 0.540 3e-12
255742444243 homeobox protein HoxB4 [Callorhinchus mi 0.168 0.399 0.408 3e-12
>gi|157278072|ref|NP_001098136.1| HOXA9A [Oryzias latipes] gi|6252950|dbj|BAA86255.1| HOXA9A [Oryzias latipes] Back     alignment and taxonomy information
 Score = 82.4 bits (202), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 64/103 (62%), Gaps = 4/103 (3%)

Query: 282 DSLSSEKDIPSNLDLSQIPKPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHQIVELEKE 341
           D LS++ D+ +++      KP    ++  SN +H +     T + R  Y+ HQI+ELEKE
Sbjct: 163 DELSAQADVSADVSAEGEEKPGLDPNNPVSNWLHASA----TRKKRCPYTKHQILELEKE 218

Query: 342 FRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPD 384
           F    YL  DRR  +++ L LTERQ+KIWFQNRRMK+K+ + D
Sbjct: 219 FLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKFNKD 261




Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|312384143|gb|EFR28942.1| hypothetical protein AND_02492 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|301128888|emb|CBL59351.1| HoxB4 [Scyliorhinus canicula] Back     alignment and taxonomy information
>gi|221119570|ref|XP_002163407.1| PREDICTED: homeobox protein Hox-B5-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|410911106|ref|XP_003969031.1| PREDICTED: homeobox protein Hox-A9a-like isoform 2 [Takifugu rubripes] Back     alignment and taxonomy information
>gi|385654455|gb|AFI61959.1| Hox-A9a [Anguilla japonica] Back     alignment and taxonomy information
>gi|213511602|ref|NP_001133044.1| homeobox protein Hox-A9b [Salmo salar] gi|157816077|gb|ABV82057.1| homeobox protein HoxA9b [Salmo salar] gi|158702256|gb|ABW77459.1| homeobox protein HoxA9b [Salmo salar] Back     alignment and taxonomy information
>gi|165873657|gb|ABY67953.1| proboscipedia hox protein [Capitella teleta] Back     alignment and taxonomy information
>gi|332692469|gb|AEE90151.1| Homeobox A9a [Anguilla anguilla] Back     alignment and taxonomy information
>gi|255742444|gb|ACU32558.1| homeobox protein HoxB4 [Callorhinchus milii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
UNIPROTKB|D6RAR5112 D6RAR5 "Uncharacterized protei 0.139 0.714 0.464 9.4e-14
UNIPROTKB|P51783162 HOXA9 "Homeobox protein Hox-A9 0.139 0.493 0.464 9.4e-14
ZFIN|ZDB-GENE-000823-1250 hoxa9a "homeo box A9a" [Danio 0.132 0.304 0.487 1.2e-13
ZFIN|ZDB-GENE-990415-108246 hoxb8a "homeo box B8a" [Danio 0.151 0.353 0.478 3.3e-13
ZFIN|ZDB-GENE-980526-291247 hoxb8b "homeo box B8b" [Danio 0.156 0.364 0.458 4.2e-13
UNIPROTKB|F1RZG0257 HOXD4 "Uncharacterized protein 0.196 0.439 0.373 4.8e-13
UNIPROTKB|P09016255 HOXD4 "Homeobox protein Hox-D4 0.217 0.490 0.367 6.2e-13
UNIPROTKB|E2R520272 HOXA9 "Uncharacterized protein 0.139 0.294 0.476 6.2e-13
UNIPROTKB|F1SHT5272 LOC100737711 "Uncharacterized 0.139 0.294 0.476 6.2e-13
UNIPROTKB|F1NE14169 LOC100858551 "Uncharacterized 0.139 0.473 0.452 8.8e-13
UNIPROTKB|D6RAR5 D6RAR5 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 187 (70.9 bits), Expect = 9.4e-14, P = 9.4e-14
 Identities = 39/84 (46%), Positives = 54/84 (64%)

Query:   301 KPPPSSSHTYSNQIHKNLLQCNTGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKEL 360
             KPP   ++  +N +H      +T + R  Y+ HQ +ELEKEF    YL  DRR  +++ L
Sbjct:    28 KPPIDPNNPAANWLHAR----STRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLL 83

Query:   361 GLTERQIKIWFQNRRMKLKRTHPD 384
              LTERQ+KIWFQNRRMK+K+ + D
Sbjct:    84 NLTERQVKIWFQNRRMKMKKINKD 107




GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|P51783 HOXA9 "Homeobox protein Hox-A9" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000823-1 hoxa9a "homeo box A9a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-108 hoxb8a "homeo box B8a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-291 hoxb8b "homeo box B8b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZG0 HOXD4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P09016 HOXD4 "Homeobox protein Hox-D4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R520 HOXA9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHT5 LOC100737711 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE14 LOC100858551 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-21
smart0038957 smart00389, HOX, Homeodomain 4e-18
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 6e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 86.8 bits (216), Expect = 3e-21
 Identities = 30/56 (53%), Positives = 40/56 (71%)

Query: 325 RFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKR 380
           R R  ++  Q+ ELEKEF    Y  ++ R+ L+K+LGLTERQ+K+WFQNRR K KR
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 575
KOG2462|consensus279 99.89
KOG2462|consensus279 99.82
KOG0484|consensus125 99.82
KOG2251|consensus228 99.79
KOG3623|consensus 1007 99.71
KOG3576|consensus267 99.7
KOG0850|consensus245 99.7
KOG0494|consensus332 99.7
KOG0489|consensus261 99.68
KOG0488|consensus309 99.67
KOG0843|consensus197 99.66
KOG0485|consensus268 99.61
KOG0487|consensus308 99.61
KOG0842|consensus307 99.6
KOG0486|consensus351 99.58
KOG0492|consensus246 99.57
KOG0848|consensus317 99.57
KOG0493|consensus342 99.56
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.56
KOG4577|consensus383 99.53
KOG0844|consensus408 99.51
KOG1074|consensus 958 99.5
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.5
KOG3623|consensus1007 99.48
KOG0491|consensus194 99.47
KOG1074|consensus958 99.45
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.38
KOG0483|consensus198 99.37
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.36
COG5576156 Homeodomain-containing transcription factor [Trans 99.36
KOG0847|consensus288 99.31
KOG3802|consensus398 99.3
KOG3576|consensus267 99.22
KOG3608|consensus467 99.21
KOG0490|consensus235 99.2
KOG3608|consensus467 99.11
KOG0849|consensus354 99.07
KOG1146|consensus 1406 98.93
PHA00733128 hypothetical protein 98.86
PHA0276855 hypothetical protein; Provisional 98.84
KOG1168|consensus385 98.78
PLN03086567 PRLI-interacting factor K; Provisional 98.72
KOG0775|consensus304 98.64
PHA00733128 hypothetical protein 98.58
PHA0276855 hypothetical protein; Provisional 98.46
PLN03086567 PRLI-interacting factor K; Provisional 98.42
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.36
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.33
KOG3993|consensus500 98.28
KOG0774|consensus334 98.17
KOG3993|consensus500 98.15
PHA0061644 hypothetical protein 98.08
KOG0490|consensus235 98.06
KOG1146|consensus 1406 98.04
PHA0073279 hypothetical protein 97.98
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.97
KOG2252|consensus558 97.94
PHA0073279 hypothetical protein 97.64
PHA0061644 hypothetical protein 97.51
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.42
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.35
COG5189423 SFP1 Putative transcriptional repressor regulating 97.18
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.85
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.71
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.53
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.52
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.43
PRK04860160 hypothetical protein; Provisional 96.31
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.94
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.9
smart0035526 ZnF_C2H2 zinc finger. 95.73
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.48
COG5189423 SFP1 Putative transcriptional repressor regulating 95.34
PRK04860160 hypothetical protein; Provisional 95.33
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.23
smart0035526 ZnF_C2H2 zinc finger. 95.14
COG5048467 FOG: Zn-finger [General function prediction only] 94.9
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.83
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.85
KOG0773|consensus342 93.41
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.11
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.61
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.59
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.29
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.84
KOG2482|consensus423 90.39
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 89.87
COG5048467 FOG: Zn-finger [General function prediction only] 89.84
KOG2231|consensus669 89.16
KOG2893|consensus341 88.9
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 87.48
KOG2231|consensus669 87.12
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 86.59
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 82.27
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.64
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.25
>KOG2462|consensus Back     alignment and domain information
Probab=99.89  E-value=2.2e-23  Score=201.91  Aligned_cols=133  Identities=17%  Similarity=0.243  Sum_probs=122.9

Q ss_pred             hccccccCchHHHhhhccCCCCCCCCC---CCCCCCCCCcchhhcchhHHHHHhhhcCCCCcccccccCccccChhhHHH
Q psy4272          59 IADVATKTLPVIQELLSQRDGKPVGKA---TLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKR  135 (575)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~p~~C~~C~~~f~~~~~~L~~H~r~H~~~kp~~C~~Cgk~F~~~~~L~~  135 (575)
                      ..-+|..|.+.+.+.+.+.+|+..|-.   ...+.|.+|+|.|... ..|+.|+|+|+  -+++|.+|||.|.+..-|+.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSm-pALkMHirTH~--l~c~C~iCGKaFSRPWLLQG  205 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSM-PALKMHIRTHT--LPCECGICGKAFSRPWLLQG  205 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeeh-HHHhhHhhccC--CCcccccccccccchHHhhc
Confidence            345788999999999988888877755   5668999999999998 69999999998  68999999999999999999


Q ss_pred             HhhhhhCCCCCcccccccccccChhhHHHHHHhhccCcccchhhhhhhhhcccccCCCCCCCcchhhhhhccChhhhHhh
Q psy4272         136 HIQYECGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLER  215 (575)
Q Consensus       136 H~r~H~gekp~~~C~~Cgk~F~~~~~L~~H~r~~H~~~~~~~~~~~~~~~~~t~e~sp~p~~~C~~C~k~F~~~~~l~~H  215 (575)
                      |+|+|||||| |.|.+|+|.|..+++|+.||++ |.+.++|                     +|..|+|+|...+.|.+|
T Consensus       206 HiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQT-HS~~K~~---------------------qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  206 HIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQT-HSDVKKH---------------------QCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             ccccccCCCC-ccCCcccchhcchHHHHHHHHh-hcCCccc---------------------cCcchhhHHHHHHHHHHh
Confidence            9999999999 9999999999999999999999 8888888                     999999999999999999


Q ss_pred             hh
Q psy4272         216 NV  217 (575)
Q Consensus       216 ~~  217 (575)
                      ..
T Consensus       263 ~E  264 (279)
T KOG2462|consen  263 SE  264 (279)
T ss_pred             hh
Confidence            64



>KOG2462|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 9e-13
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 4e-12
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 2e-11
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-11
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 2e-11
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 3e-11
1hom_A68 Determination Of The Three-Dimensional Structure Of 3e-11
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 6e-11
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 3e-10
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 3e-10
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-09
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-09
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 1e-09
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-09
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-09
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 3e-09
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 4e-09
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 4e-09
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 7e-09
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 8e-09
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 9e-09
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 1e-08
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 2e-08
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 8e-08
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 9e-08
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 2e-07
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 3e-07
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 3e-07
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 3e-07
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 6e-07
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 7e-07
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 7e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-07
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 8e-07
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 2e-06
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 3e-06
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 4e-06
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 6e-06
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 8e-06
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 1e-05
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 3e-05
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 3e-05
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 3e-05
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 4e-05
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-04
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 1e-04
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 4e-04
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 41/55 (74%) Query: 330 YSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTHPD 384 Y+ HQ +ELEKEF YL DRR +++ L LTERQ+KIWFQNRRMK+K+ + D Sbjct: 20 YTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKD 74
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-23
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 6e-23
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 9e-23
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-22
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-22
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-22
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-22
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 7e-22
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 8e-22
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 8e-22
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-21
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-21
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 3e-21
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-21
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-21
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-21
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-20
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-20
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-20
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 3e-20
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 7e-20
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 1e-19
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-19
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 6e-19
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-16
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-15
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 4e-15
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-13
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-13
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-12
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-12
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-11
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-10
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 5e-10
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 9e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 9e-10
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-09
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-09
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-09
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 5e-09
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 6e-09
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 7e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 1e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-04
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
 Score = 92.6 bits (230), Expect = 3e-23
 Identities = 34/58 (58%), Positives = 41/58 (70%)

Query: 325 RFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTH 382
           R RQ Y+ +Q +ELEKEF   +YL   RR  ++  L LTERQIKIWFQNRRMKLK+  
Sbjct: 22  RGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMKLKKEI 79


>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.83
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.83
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.8
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.79
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.78
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.78
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.77
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.76
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.76
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.75
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.75
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.75
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.75
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.75
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.75
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.75
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.74
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.74
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.74
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.74
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.74
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.74
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.74
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.73
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.73
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.73
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.73
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.73
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.73
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.73
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.73
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.73
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.73
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.73
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.72
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.72
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.72
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.72
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.72
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.71
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.71
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.71
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.71
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.71
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.7
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.7
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.7
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.69
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.69
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.69
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.69
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.69
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.69
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.68
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.68
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.67
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.67
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.67
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.67
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.67
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.67
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.66
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.66
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.65
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.65
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.65
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.64
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.64
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.64
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.64
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.64
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.64
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.63
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.63
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.63
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.63
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.63
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.63
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.62
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.62
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.62
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.61
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.61
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.61
2e19_A64 Transcription factor 8; homeobox domain, structura 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.61
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.61
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.61
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.6
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.59
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.58
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.58
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.58
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.57
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.56
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.56
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.54
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.53
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.51
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.49
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.46
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.46
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.46
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.46
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.44
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.43
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.43
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.42
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.41
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.41
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.41
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.41
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.4
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.37
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.36
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.34
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.31
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.3
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.3
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.3
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.29
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.27
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.26
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.24
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.23
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.18
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.18
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.17
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.17
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.12
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.1
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.06
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.02
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.01
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.0
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.99
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.99
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.98
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.97
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.95
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.94
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.92
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.9
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.89
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.89
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.81
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.81
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.76
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.74
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.74
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.73
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.71
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.71
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.71
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.69
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.69
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.67
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.67
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.66
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.65
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.62
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.62
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.6
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.58
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.58
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.57
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.57
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.57
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.55
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.55
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.55
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.55
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.54
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.54
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.54
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.54
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.53
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.53
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.53
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.53
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.52
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.52
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.52
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.52
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.52
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.52
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.52
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.52
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.51
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.51
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.49
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.49
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.49
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.49
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.49
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.49
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.49
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.48
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.48
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.47
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.46
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.45
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.41
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.41
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.4
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.38
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.36
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.35
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.33
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.32
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.28
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.26
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.25
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.25
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.22
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.22
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.22
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.19
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.19
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.15
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.1
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.09
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.08
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.08
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.07
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.03
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.03
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.02
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.02
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.01
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.98
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.2
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.95
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.18
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.93
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.91
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.91
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.9
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.89
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.89
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.87
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.76
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.9
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.71
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.67
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.63
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.61
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.59
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.57
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.56
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.54
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.53
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.53
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.52
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.5
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.46
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.56
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.43
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.43
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.55
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.42
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.52
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.24
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.87
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.85
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.37
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.25
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.66
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 92.42
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.27
2e72_A49 POGO transposable element with ZNF domain; zinc fi 90.92
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 90.59
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.42
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 86.43
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 81.75
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.83  E-value=2.5e-22  Score=191.15  Aligned_cols=152  Identities=16%  Similarity=0.203  Sum_probs=121.4

Q ss_pred             cccccCchHHHhhhccCCCCCCCCCCCCCCCCCCcchhhcchhHHHHHhhhcCCCCcccccccCccccChhhHHHHhhhh
Q psy4272          61 DVATKTLPVIQELLSQRDGKPVGKATLPSPLKAKLSDYENKMKNVRESIRQKRLAQGLTCLQCGRSYCRPYNLKRHIQYE  140 (575)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~C~~C~~~f~~~~~~L~~H~r~H~~~kp~~C~~Cgk~F~~~~~L~~H~r~H  140 (575)
                      -.|..|...+.....+..|...+.+..+|.|.+|++.|... ..|..|+++|.++++|.|.+|++.|.....|..|+++|
T Consensus        22 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~-~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  100 (190)
T 2i13_A           22 YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDK-KDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTH  100 (190)
T ss_dssp             ---------CCSSHHHHHGGGCC---CCEECTTTCCEESSH-HHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHH
T ss_pred             CcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCH-HHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhc
Confidence            45778888887777777777778888899999999999887 68999999999999999999999999999999999999


Q ss_pred             hCCCCCcccccccccccChhhHHHHHHhhccCcccchhhhhhhhhcccccCCCCCCCcchhhhhhccChhhhHhhhhhhh
Q psy4272         141 CGKAPQFPCLYCSYRARHKHDLKKHVTFKHAAYLDHFQAVQEELEVTTKELSPGPKAENRHRFREFLNEHRNLERNVSHE  220 (575)
Q Consensus       141 ~gekp~~~C~~Cgk~F~~~~~L~~H~r~~H~~~~~~~~~~~~~~~~~t~e~sp~p~~~C~~C~k~F~~~~~l~~H~~th~  220 (575)
                      .++++ |.|.+|++.|.....|..|+++ |.++++|                     .|..|++.|.....|..|+.+|.
T Consensus       101 ~~~~~-~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~---------------------~C~~C~~~f~~~~~L~~H~~~H~  157 (190)
T 2i13_A          101 TGEKP-YACPECGKSFSQLAHLRAHQRT-HTGEKPY---------------------KCPECGKSFSREDNLHTHQRTHT  157 (190)
T ss_dssp             HTCCC-EECTTTCCEESSHHHHHHHHHH-HHCCCCE---------------------ECTTTCCEESCHHHHHHHHHHHH
T ss_pred             CCCCC-CcCCCCCCccCCHHHHHHHHHH-hCCCCCe---------------------ECCCCCcccCCHHHHHHHHHhcC
Confidence            99999 9999999999999999999998 6677777                     88888888888888888888888


Q ss_pred             hhhccccCCCCCCCCC
Q psy4272         221 EIRTHKKHEQPRKESS  236 (575)
Q Consensus       221 ~~~~~~~~~~~~~~ss  236 (575)
                      +.+++.+..+...+..
T Consensus       158 ~~~~~~C~~C~~~f~~  173 (190)
T 2i13_A          158 GEKPYKCPECGKSFSR  173 (190)
T ss_dssp             CCCCEECTTTCCEESS
T ss_pred             CCCCeECCCCCCccCC
Confidence            8888888777555443



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 575
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-20
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-19
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 6e-19
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 3e-18
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-18
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 7e-18
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-17
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 8e-17
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-16
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-16
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-15
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 6e-15
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 3e-14
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 9e-14
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-13
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-13
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-13
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 6e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-11
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 7e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 3e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-05
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
 Score = 82.5 bits (204), Expect = 2e-20
 Identities = 32/56 (57%), Positives = 39/56 (69%)

Query: 327 RQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKRTH 382
           RQ Y+ +Q +ELEKEF    YL   RR  ++  L LTERQIKIWFQNRRMK K+ +
Sbjct: 1   RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN 56


>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.8
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.8
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.79
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.79
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.79
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.78
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.78
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.77
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.77
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.77
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.76
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.76
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.76
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.76
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.75
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.73
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.73
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.7
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.7
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.7
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.69
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.68
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.63
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.62
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.59
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.58
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.57
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.51
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.48
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.45
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.38
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.18
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.03
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.02
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.95
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.93
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.92
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.88
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.87
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.87
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.86
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.77
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.74
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.65
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.62
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.59
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.57
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.52
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.34
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.32
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.26
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.25
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.22
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.13
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.09
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.97
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.86
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.83
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.79
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.59
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.26
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.99
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.92
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.85
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.85
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.8
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.77
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.67
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.65
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.64
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.49
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.42
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.41
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.39
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.37
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.33
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.29
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.29
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.28
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.96
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.91
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.63
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.53
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.99
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 94.97
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.94
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.9
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.75
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.64
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.5
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.4
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.28
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.22
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.67
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.6
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.11
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.96
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.64
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.17
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.21
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.11
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 90.91
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 90.84
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.58
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.05
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 88.5
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.98
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 86.26
d1hlva166 DNA-binding domain of centromere binding protein B 85.94
d1y0jb136 U-shaped transcription factor, different fingers { 84.92
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.66
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.2
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 81.43
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 81.2
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 81.06
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=4.1e-21  Score=143.92  Aligned_cols=58  Identities=43%  Similarity=0.731  Sum_probs=56.0

Q ss_pred             CCCCcccCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChhhhhhcccchhhhhhh
Q psy4272         323 TGRFRQVYSSHQIVELEKEFRLTNYLPSDRRKVLSKELGLTERQIKIWFQNRRMKLKR  380 (575)
Q Consensus       323 ~rr~Rt~~t~~ql~~L~~~F~~~~~p~~~~r~~la~~l~l~~~~V~vWFqNrRak~kk  380 (575)
                      +||.||.||..|+.+||..|..++||+..+|++||..|||++.+|+|||||||+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            3778999999999999999999999999999999999999999999999999999986



>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure