Psyllid ID: psy429

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
ccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEccccccccccHHEHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHEEEccccccEEccccccccccEEccccccccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEcccEEEEEccc
cccccHHHHHHHHHHcccccEEEEEEHHHHHHHHHcccccEEEEEEccccEEEEEEEccEEcHHHcEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHcccEEEEEcccEEEEEEcccccccEEEEccEEEEccccccccccccccEEcHHHHHccccEEEEccEEccEEccHHHHHHHHHHHHHccccccHHHccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHcc
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGrttgivldsgdgvshtvpiyegyalpHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehgivtnwddmeKIWHHTFYNelrvapeehpvllteaplnpkanrEKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLteaplnpkanREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
****TFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ**SYVGD*AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE***********MTQIMFETFNTPAMYVAIQAVNCCTIK**
***TTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ*****MGQ*DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKF*
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
****TFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGTTFQGVVRIMFETFNTPAMYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTIKFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
P53506 376 Actin, cytoplasmic type 8 N/A N/A 0.572 0.369 0.971 4e-78
O93400 375 Actin, cytoplasmic 1 OS=X N/A N/A 0.551 0.357 0.992 6e-78
Q8JJB8 375 Actin, cytoplasmic 2 OS=T N/A N/A 0.551 0.357 0.992 6e-78
Q6P378 375 Actin, cytoplasmic 2 OS=X yes N/A 0.551 0.357 0.992 6e-78
Q7ZVI7 375 Actin, cytoplasmic 1 OS=D yes N/A 0.551 0.357 0.992 6e-78
P53478 376 Actin, cytoplasmic type 5 yes N/A 0.572 0.369 0.971 6e-78
O42161 375 Actin, cytoplasmic 1 OS=S N/A N/A 0.551 0.357 0.992 6e-78
P48975 375 Actin, cytoplasmic 1 OS=C yes N/A 0.551 0.357 0.992 6e-78
P68143 375 Actin, cytoplasmic 1 OS=O N/A N/A 0.551 0.357 0.992 7e-78
P83750 375 Actin, cytoplasmic 1 OS=C N/A N/A 0.551 0.357 0.992 7e-78
>sp|P53506|ACT8_XENLA Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 Back     alignment and function desciption
 Score =  291 bits (744), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 137/141 (97%), Positives = 138/141 (97%), Gaps = 2/141 (1%)

Query: 95  AEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 154
           AE EI  AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 2   AEEEI--AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 59

Query: 155 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 214
           QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct: 60  QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119

Query: 215 MTQIMFETFNTPAMYVAIQAV 235
           MTQIMFETFNTPAMYVAIQAV
Sbjct: 120 MTQIMFETFNTPAMYVAIQAV 140
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Xenopus laevis (taxid: 8355)
>sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 Back     alignment and function description
>sp|Q8JJB8|ACTG_TRISC Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 Back     alignment and function description
>sp|Q6P378|ACTG_XENTR Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVI7|ACTB1_DANRE Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 Back     alignment and function description
>sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=2 SV=1 Back     alignment and function description
>sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 Back     alignment and function description
>sp|P48975|ACTB_CRIGR Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 Back     alignment and function description
>sp|P68143|ACTB_OREMO Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 Back     alignment and function description
>sp|P83750|ACTB_CYPCA Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
260790258 428 hypothetical protein BRAFLDRAFT_90895 [B 0.790 0.448 0.785 7e-89
33346939237 ubiquitin/actin fusion protein 1 [Lothar 0.814 0.835 0.720 2e-77
444727734 430 Actin, cytoplasmic 2 [Tupaia chinensis] 0.625 0.353 0.908 3e-77
358055924 2775 hypothetical protein E5Q_04952 [Mixia os 0.592 0.051 0.917 5e-77
301792411 633 PREDICTED: actin, cytoplasmic 2-like [Ai 0.604 0.232 0.939 5e-77
33346943238 ubiquitin/actin fusion protein 3 [Lothar 0.823 0.840 0.710 8e-77
33346945 442 ubiquitin/actin fusion protein [Gymnochl 0.810 0.445 0.705 1e-76
148222128 376 actin, cytoplasmic type 8 [Xenopus laevi 0.572 0.369 0.971 2e-76
13699190 376 cytoplasmic actin [Lethenteron camtschat 0.572 0.369 0.978 2e-76
194385944 351 unnamed protein product [Homo sapiens] 0.452 0.313 0.992 2e-76
>gi|260790258|ref|XP_002590160.1| hypothetical protein BRAFLDRAFT_90895 [Branchiostoma floridae] gi|229275349|gb|EEN46171.1| hypothetical protein BRAFLDRAFT_90895 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  332 bits (852), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 168/214 (78%), Positives = 182/214 (85%), Gaps = 22/214 (10%)

Query: 22  MYVAIQAAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLM 81
           MYVAIQA VLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLM
Sbjct: 1   MYVAIQA-VLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLM 59

Query: 82  KILTERGYSFTTTAEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 141
           KILTERGY+F TTA +  + + L +D+ +G+             +F         QGVMV
Sbjct: 60  KILTERGYTFVTTATQMFLASRLDLDS-NGLY------------IFV--------QGVMV 98

Query: 142 GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 201
           GMGQKDSYVGDEAQSKRGILTLKYPIEHG+VTNWDDMEKIWHHTFYNELRVAPEEHP+LL
Sbjct: 99  GMGQKDSYVGDEAQSKRGILTLKYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPILL 158

Query: 202 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 235
           TEAPLNPKANREKMTQIMFETFN+PAMYV IQAV
Sbjct: 159 TEAPLNPKANREKMTQIMFETFNSPAMYVNIQAV 192

Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota
>gi|33346939|gb|AAP34631.1| ubiquitin/actin fusion protein 1 [Lotharella globosa] gi|33346941|gb|AAP34632.1| ubiquitin/actin fusion protein 2 [Lotharella globosa] Back     alignment and taxonomy information
>gi|444727734|gb|ELW68212.1| Actin, cytoplasmic 2 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|358055924|dbj|GAA98269.1| hypothetical protein E5Q_04952 [Mixia osmundae IAM 14324] Back     alignment and taxonomy information
>gi|301792411|ref|XP_002931172.1| PREDICTED: actin, cytoplasmic 2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|33346943|gb|AAP34633.1| ubiquitin/actin fusion protein 3 [Lotharella globosa] Back     alignment and taxonomy information
>gi|33346945|gb|AAP34634.1| ubiquitin/actin fusion protein [Gymnochlora stellata] Back     alignment and taxonomy information
>gi|148222128|ref|NP_001089852.1| actin, cytoplasmic type 8 [Xenopus laevis] gi|80477601|gb|AAI08544.1| MGC131002 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|13699190|dbj|BAB41207.1| cytoplasmic actin [Lethenteron camtschaticum] Back     alignment and taxonomy information
>gi|194385944|dbj|BAG65347.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
UNIPROTKB|P53478 376 P53478 "Actin, cytoplasmic typ 0.572 0.369 0.971 7.7e-71
UNIPROTKB|F1N835209 LOC776816 "Uncharacterized pro 0.555 0.645 0.992 1.3e-70
UNIPROTKB|G1K2Y7 374 LOC776816 "Uncharacterized pro 0.555 0.360 0.992 1.3e-70
UNIPROTKB|P60706 375 ACTB "Actin, cytoplasmic 1" [G 0.555 0.36 0.992 1.3e-70
UNIPROTKB|Q5ZMQ2 375 ACTG1 "Actin, cytoplasmic 2" [ 0.567 0.368 0.971 1.3e-70
UNIPROTKB|F1MRD0 375 ACTB "Actin, cytoplasmic 1, N- 0.555 0.36 0.992 1.3e-70
UNIPROTKB|P60712 375 ACTB "Actin, cytoplasmic 1" [B 0.555 0.36 0.992 1.3e-70
UNIPROTKB|P63258 375 ACTG1 "Actin, cytoplasmic 2" [ 0.567 0.368 0.971 1.3e-70
UNIPROTKB|J9NXE2 373 ACTB "Actin, cytoplasmic 1" [C 0.555 0.361 0.992 1.3e-70
UNIPROTKB|O18840 375 ACTB "Actin, cytoplasmic 1" [C 0.555 0.36 0.992 1.3e-70
UNIPROTKB|P53478 P53478 "Actin, cytoplasmic type 5" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 717 (257.5 bits), Expect = 7.7e-71, P = 7.7e-71
 Identities = 137/141 (97%), Positives = 138/141 (97%)

Query:    95 AEREIVLAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 154
             A+ EI  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct:     2 ADEEI--AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 59

Query:   155 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 214
             QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
Sbjct:    60 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119

Query:   215 MTQIMFETFNTPAMYVAIQAV 235
             MTQIMFETFNTPAMYVAIQAV
Sbjct:   120 MTQIMFETFNTPAMYVAIQAV 140
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005856 "cytoskeleton" evidence=IEA
UNIPROTKB|F1N835 LOC776816 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K2Y7 LOC776816 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P60706 ACTB "Actin, cytoplasmic 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMQ2 ACTG1 "Actin, cytoplasmic 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRD0 ACTB "Actin, cytoplasmic 1, N-terminally processed" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P60712 ACTB "Actin, cytoplasmic 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P63258 ACTG1 "Actin, cytoplasmic 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXE2 ACTB "Actin, cytoplasmic 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O18840 ACTB "Actin, cytoplasmic 1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2BDB0ACTG_XENLANo assigned EC number0.98510.55140.3573N/AN/A
Q6NVA9ACTB_XENTRNo assigned EC number0.99250.55140.3573yesN/A
O93400ACTB_XENLANo assigned EC number0.99250.55140.3573N/AN/A
P41341ACTY_LIMPONo assigned EC number0.99250.55140.3563N/AN/A
Q7ZVF9ACTB2_DANRENo assigned EC number0.99250.55140.3573yesN/A
Q5R1X3ACTB_PANTRNo assigned EC number0.99250.55140.3573yesN/A
Q8JJB8ACTG_TRISCNo assigned EC number0.99250.55140.3573N/AN/A
Q5R6G0ACTB_PONABNo assigned EC number0.99250.55140.3573yesN/A
P18603ACT4_ARTSXNo assigned EC number0.99250.55140.3563N/AN/A
P53485ACTB2_TAKRUNo assigned EC number0.99250.55140.3573N/AN/A
P30162ACT1_ONCVONo assigned EC number0.99250.55140.3563N/AN/A
P30163ACT2_ONCVONo assigned EC number0.99250.55140.3563N/AN/A
P41340ACT3_LIMPONo assigned EC number0.99250.55140.3563N/AN/A
O42161ACTB_SALSANo assigned EC number0.99250.55140.3573N/AN/A
P63257ACTG_TRIVUNo assigned EC number0.98510.55140.3573N/AN/A
P53506ACT8_XENLANo assigned EC number0.97160.57200.3696N/AN/A
P63258ACTG_BOVINNo assigned EC number0.98510.55140.3573yesN/A
P63259ACTG_RATNo assigned EC number0.98510.55140.3573yesN/A
P02572ACT2_DROMENo assigned EC number0.99250.55140.3563yesN/A
P83751ACTB_CTEIDNo assigned EC number0.99250.55140.3573N/AN/A
P83750ACTB_CYPCANo assigned EC number0.99250.55140.3573N/AN/A
P60709ACTB_HUMANNo assigned EC number0.99250.55140.3573yesN/A
P60708ACTB_HORSENo assigned EC number0.99250.55140.3573yesN/A
P60707ACTB_TRIVUNo assigned EC number0.99250.55140.3573N/AN/A
P60706ACTB_CHICKNo assigned EC number0.99250.55140.3573yesN/A
P48975ACTB_CRIGRNo assigned EC number0.99250.55140.3573yesN/A
Q5ZMQ2ACTG_CHICKNo assigned EC number0.98510.55140.3573yesN/A
Q5JAK2ACTG_RANLENo assigned EC number0.98510.55140.3573N/AN/A
Q6P378ACTG_XENTRNo assigned EC number0.99250.55140.3573yesN/A
Q4L0Y2ACTB_SPECINo assigned EC number0.99250.55140.3573N/AN/A
P63261ACTG_HUMANNo assigned EC number0.98510.55140.3573yesN/A
Q91ZK5ACTB_SIGHINo assigned EC number0.99250.55140.3573N/AN/A
P53478ACT5_CHICKNo assigned EC number0.97160.57200.3696yesN/A
Q711N9ACTB_MESAUNo assigned EC number0.99250.55140.3573N/AN/A
Q7ZVI7ACTB1_DANRENo assigned EC number0.99250.55140.3573yesN/A
P10983ACT1_CAEELNo assigned EC number0.99250.55140.3563yesN/A
P60710ACTB_MOUSENo assigned EC number0.99250.55140.3573yesN/A
P60711ACTB_RATNo assigned EC number0.99250.55140.3573yesN/A
P60712ACTB_BOVINNo assigned EC number0.99250.55140.3573yesN/A
P60713ACTB_SHEEPNo assigned EC number0.99250.55140.3573N/AN/A
Q4R561ACTB_MACFANo assigned EC number0.99250.55140.3573N/AN/A
O18840ACTB_CANFANo assigned EC number0.99250.55140.3573yesN/A
Q6QAQ1ACTB_PIGNo assigned EC number0.99250.55140.3573yesN/A
P10986ACT4_CAEELNo assigned EC number0.99250.55140.3563yesN/A
P63260ACTG_MOUSENo assigned EC number0.98510.55140.3573yesN/A
P10984ACT2_CAEELNo assigned EC number0.99250.55140.3563yesN/A
Q71FK5ACTB_CAVPONo assigned EC number0.99250.55140.3573yesN/A
Q76N69ACTB_CHLAENo assigned EC number0.99250.55140.3573N/AN/A
P68143ACTB_OREMONo assigned EC number0.99250.55140.3573N/AN/A
P68142ACTB1_TAKRUNo assigned EC number0.99250.55140.3573N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
PTZ00281 376 PTZ00281, PTZ00281, actin; Provisional 2e-98
PTZ00004 378 PTZ00004, PTZ00004, actin-2; Provisional 7e-88
smart00268 373 smart00268, ACTIN, Actin 9e-80
pfam00022 367 pfam00022, Actin, Actin 3e-78
COG5277 444 COG5277, COG5277, Actin and related proteins [Cyto 2e-61
PTZ00452 375 PTZ00452, PTZ00452, actin; Provisional 3e-58
PTZ00466 380 PTZ00466, PTZ00466, actin-like protein; Provisiona 3e-57
PTZ00281376 PTZ00281, PTZ00281, actin; Provisional 8e-55
PTZ00004378 PTZ00004, PTZ00004, actin-2; Provisional 7e-50
PTZ00280 414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 4e-47
smart00268373 smart00268, ACTIN, Actin 3e-46
pfam00022367 pfam00022, Actin, Actin 1e-43
PTZ00466380 PTZ00466, PTZ00466, actin-like protein; Provisiona 3e-34
PTZ00452375 PTZ00452, PTZ00452, actin; Provisional 8e-30
COG5277444 COG5277, COG5277, Actin and related proteins [Cyto 2e-28
PTZ00280414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 6e-25
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 2e-08
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 3e-04
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information 
 Score =  291 bits (745), Expect = 2e-98
 Identities = 131/135 (97%), Positives = 133/135 (98%)

Query: 101 LAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 160
           + ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDSYVGDEAQSKRGI
Sbjct: 6   VQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGI 65

Query: 161 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 220
           LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF
Sbjct: 66  LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 125

Query: 221 ETFNTPAMYVAIQAV 235
           ETFNTPAMYVAIQAV
Sbjct: 126 ETFNTPAMYVAIQAV 140

Length = 376
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
PTZ00452 375 actin; Provisional 100.0
KOG0676|consensus 372 100.0
KOG0677|consensus 389 100.0
PTZ00466 380 actin-like protein; Provisional 100.0
PTZ00281 376 actin; Provisional 100.0
KOG0679|consensus 426 100.0
PTZ00004 378 actin-2; Provisional 99.97
PTZ00280 414 Actin-related protein 3; Provisional 99.97
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.95
COG5277 444 Actin and related proteins [Cytoskeleton] 99.95
PF00022 393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.95
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 99.94
KOG0681|consensus 645 99.92
KOG0678|consensus 415 99.91
PTZ00452375 actin; Provisional 99.89
PTZ00281376 actin; Provisional 99.88
KOG0676|consensus372 99.88
PTZ00466380 actin-like protein; Provisional 99.88
KOG0677|consensus389 99.87
KOG0680|consensus 400 99.87
PTZ00004378 actin-2; Provisional 99.87
KOG0679|consensus426 99.86
PTZ00280414 Actin-related protein 3; Provisional 99.84
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.82
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.79
COG5277444 Actin and related proteins [Cytoskeleton] 99.78
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.77
PRK13930 335 rod shape-determining protein MreB; Provisional 99.67
PRK13927 334 rod shape-determining protein MreB; Provisional 99.66
KOG0678|consensus415 99.6
KOG0680|consensus400 99.56
KOG0681|consensus 645 99.47
PRK13929 335 rod-share determining protein MreBH; Provisional 99.4
TIGR00904 333 mreB cell shape determining protein, MreB/Mrl fami 99.39
KOG0797|consensus 618 99.29
PRK13930335 rod shape-determining protein MreB; Provisional 99.08
PRK13928 336 rod shape-determining protein Mbl; Provisional 99.05
PRK13927334 rod shape-determining protein MreB; Provisional 98.91
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 98.89
PRK13929335 rod-share determining protein MreBH; Provisional 98.85
PRK13928336 rod shape-determining protein Mbl; Provisional 98.72
PF06723 326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 98.67
KOG0797|consensus 618 98.44
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 97.91
COG1077 342 MreB Actin-like ATPase involved in cell morphogene 97.47
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 97.17
PRK15080267 ethanolamine utilization protein EutJ; Provisional 96.94
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 96.75
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 96.65
PRK09472420 ftsA cell division protein FtsA; Reviewed 96.41
CHL00094 621 dnaK heat shock protein 70 95.83
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 95.62
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 95.54
PRK13917344 plasmid segregation protein ParM; Provisional 95.51
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 95.47
PRK13410 668 molecular chaperone DnaK; Provisional 95.41
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 95.4
PRK05183 616 hscA chaperone protein HscA; Provisional 95.4
TIGR02529 239 EutJ ethanolamine utilization protein EutJ family 95.24
PLN03184 673 chloroplast Hsp70; Provisional 95.2
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 95.16
PTZ00400 663 DnaK-type molecular chaperone; Provisional 95.1
PRK01433 595 hscA chaperone protein HscA; Provisional 95.0
PTZ00009 653 heat shock 70 kDa protein; Provisional 94.75
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 94.53
PRK11678450 putative chaperone; Provisional 94.46
PRK13411 653 molecular chaperone DnaK; Provisional 94.35
COG4820277 EutJ Ethanolamine utilization protein, possible ch 93.83
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 93.83
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 92.99
COG1077342 MreB Actin-like ATPase involved in cell morphogene 92.99
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 92.93
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 91.82
PRK15080 267 ethanolamine utilization protein EutJ; Provisional 91.04
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 90.56
PLN03184 673 chloroplast Hsp70; Provisional 86.88
PF01968290 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr 86.61
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 86.2
CHL00094 621 dnaK heat shock protein 70 85.92
PRK10719 475 eutA reactivating factor for ethanolamine ammonia 84.99
PF02541285 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I 84.23
PTZ00400 663 DnaK-type molecular chaperone; Provisional 83.8
PRK13410 668 molecular chaperone DnaK; Provisional 83.41
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 82.36
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 81.08
>PTZ00452 actin; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3e-34  Score=256.62  Aligned_cols=140  Identities=56%  Similarity=1.018  Sum_probs=127.8

Q ss_pred             hheeeeccCCCccccCcCCCCCCCcccCcceeccCCCcccccCCCccccccchhhhccccccccCCCCCCcccCHHHHHH
Q psy429          101 LAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK  180 (243)
Q Consensus       101 ~~~vViD~Gs~~~K~G~ag~~~P~~i~ps~vg~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~p~~~G~i~d~d~~e~  180 (243)
                      ..+||||+||+++|+||||++.|++++||++|+++......+..+++.++|+++...+..+++++|+++|+|.|||.+|.
T Consensus         5 ~~~vViD~Gs~~~k~G~age~~P~~i~ps~vg~~~~~~~~~~~~~~~~~iG~~~~~~~~~~~l~~Pi~~G~I~dwd~~e~   84 (375)
T PTZ00452          5 YPAVVIDNGSGYCKIGIAGDDAPTSCFPAIVGRSKQNDGIFSTFNKEYYVGEEAQAKRGVLAIKEPIQNGIINSWDDIEI   84 (375)
T ss_pred             CCEEEEECCCCeEEEeeCCCCCcCEEecceeEEECCccccccccccceEEChhhhccccCcEEcccCcCCEEcCHHHHHH
Confidence            35899999999999999999999999999999987643222223456789999988888899999999999999999999


Q ss_pred             HHHHHhhccccCCCCCCceEeecCCCCChhHHHHHHHHhhhcCCCCeEEeeehhhhcccc
Q psy429          181 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTI  240 (243)
Q Consensus       181 l~~~~~~~~L~~~~~~~pvlltep~~~~~~~re~~~eilFE~~~vpav~~~~~~~ls~y~  240 (243)
                      +|+|+|++.|+++|+++|+++|||+++++..|++++|+|||+|++|+++++++++||+|-
T Consensus        85 iw~~~f~~~l~v~p~~~pvlitE~~~~~~~~Re~l~eilFE~~~vp~~~~~~~~~lslya  144 (375)
T PTZ00452         85 IWHHAFYNELCMSPEDQPVFMTDAPMNSKFNRERMTQIMFETFNTPCLYISNEAVLSLYT  144 (375)
T ss_pred             HHHHHHHhhcCCCcccCceeeecCCCCCHHHHHHHHHHHhhccCCceEEEechHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999984

>KOG0676|consensus Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2oan_A 375 Structure Of Oxidized Beta-Actin Length = 375 5e-79
3byh_A 374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 5e-79
3u4l_A 375 Cryocooled Bovine Profilin:actin Crystal Structure 5e-79
2hf3_A 374 Crystal Structure Of Monomeric Actin In The Adp Bou 5e-79
3eks_A 375 Crystal Structure Of Monomeric Actin Bound To Cytoc 5e-79
1d4x_A 375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 5e-79
3b63_L 365 Actin Filament Model In The Extended Form Of Acroms 7e-79
2btf_A 375 The Structure Of Crystalline Profilin-Beta-Actin Le 5e-78
4efh_A 375 Acanthamoeba Actin Complex With Spir Domain D Lengt 2e-77
1nlv_A 375 Crystal Structure Of Dictyostelium Discoideum Actin 2e-77
3chw_A 375 Complex Of Dictyostelium Discoideum Actin With Prof 2e-76
1yag_A 375 Structure Of The Yeast Actin-human Gelsolin Segment 2e-76
1yvn_A 375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 2e-76
3b63_A 365 Actin Filament Model In The Extended Form Of Acroms 3e-76
1c0g_A 375 Crystal Structure Of 1:1 Complex Between Gelsolin S 3e-76
1dej_A 375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 3e-76
3b63_C 365 Actin Filament Model In The Extended Form Of Acroms 3e-76
3a5l_C 375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 1e-75
3ci5_A 375 Complex Of Phosphorylated Dictyostelium Discoideum 2e-75
3a5m_C 375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 3e-75
3b63_E 365 Actin Filament Model In The Extended Form Of Acroms 4e-75
3m6g_A 371 Crystal Structure Of Actin In Complex With Lobophor 5e-75
2w49_D 372 Isometrically Contracting Insect Asynchronous Fligh 5e-75
1kxp_A 375 Crystal Structure Of Human Vitamin D-binding Protei 5e-75
4b1v_A 376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 5e-75
1ijj_A 377 The X-Ray Crystal Structure Of The Complex Between 6e-75
1t44_A 370 Structural Basis Of Actin Sequestration By Thymosin 6e-75
3w3d_A 374 Crystal Structure Of Smooth Muscle G Actin Dnase I 7e-75
1atn_A 373 Atomic Structure Of The Actin:dnase I Complex Lengt 5e-74
2gwj_A 371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 5e-74
3g37_O 376 Cryo-Em Structure Of Actin Filament In The Presence 6e-74
1qz5_A 375 Structure Of Rabbit Actin In Complex With Kabiramid 6e-74
1eqy_A 377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 6e-74
1lcu_A 371 Polylysine Induces An Antiparallel Actin Dimer That 4e-73
3b63_F 357 Actin Filament Model In The Extended Form Of Acroms 7e-73
3b63_D 357 Actin Filament Model In The Extended Form Of Acroms 8e-73
3b63_B 364 Actin Filament Model In The Extended Form Of Acroms 9e-73
1c0f_A 368 Crystal Structure Of Dictyostelium Caatp-Actin In C 4e-70
3mn5_A 359 Structures Of Actin-Bound Wh2 Domains Of Spire And 3e-61
2p9k_B 394 Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta 1e-31
1k8k_B 394 Crystal Structure Of Arp23 COMPLEX Length = 394 3e-31
3dwl_A 427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 2e-26
1k8k_A 418 Crystal Structure Of Arp23 COMPLEX Length = 418 1e-25
3qb0_A 498 Crystal Structure Of Actin-Related Protein Arp4 Fro 8e-12
4i6m_A 477 Structure Of Arp7-arp9-snf2(hsa)-rtt102 Subcomplex 7e-09
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure 
Iteration: 1

 Score =  290 bits (742), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 135/135 (100%)
Query: 101 LAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 160
           +AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI
Sbjct: 5   IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 64
Query: 161 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 220
           LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF
Sbjct: 65  LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 124
Query: 221 ETFNTPAMYVAIQAV 235
           ETFNTPAMYVAIQAV
Sbjct: 125 ETFNTPAMYVAIQAV 139
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 Back     alignment and structure
>pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|3QB0|A Chain A, Crystal Structure Of Actin-Related Protein Arp4 From S. Cerevisiae Complexed With Atp Length = 498 Back     alignment and structure
>pdb|4I6M|A Chain A, Structure Of Arp7-arp9-snf2(hsa)-rtt102 Subcomplex Of Swi/snf Chromatin Remodeler Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 3e-95
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 2e-58
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 2e-92
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 2e-57
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 5e-89
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 2e-58
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 3e-86
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 5e-46
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 9e-80
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 6e-43
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
 Score =  282 bits (724), Expect = 3e-95
 Identities = 127/134 (94%), Positives = 129/134 (96%)

Query: 102 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 161
            ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL
Sbjct: 6   TALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 65

Query: 162 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 221
           TLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFE
Sbjct: 66  TLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFE 125

Query: 222 TFNTPAMYVAIQAV 235
           TFN PAMYVAIQAV
Sbjct: 126 TFNVPAMYVAIQAV 139
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 100.0
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 99.97
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 99.96
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.95
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 99.95
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.94
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 99.88
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 99.88
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 99.85
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.82
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 99.82
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.77
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.76
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.68
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 99.45
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 98.75
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 98.38
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 98.12
3h1q_A 272 Ethanolamine utilization protein EUTJ; ethanolamin 98.04
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 97.96
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 97.84
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 97.8
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 97.71
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 97.54
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 97.31
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 97.29
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 97.29
3js6_A355 Uncharacterized PARM protein; partition, segregati 97.08
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 96.98
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 96.97
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 96.75
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 96.72
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 96.65
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 96.51
2fsj_A 346 Hypothetical protein TA0583; actin homologs, archa 96.45
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 96.32
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 96.07
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 94.51
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 91.41
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 89.44
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 89.03
3cet_A334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 87.71
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 86.49
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 84.47
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 83.14
3cer_A343 Possible exopolyphosphatase-like protein; NESG, BL 81.53
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.3e-34  Score=261.65  Aligned_cols=141  Identities=40%  Similarity=0.787  Sum_probs=124.0

Q ss_pred             hheeeeccCCCccccCcCCCCCCCcccCcceeccCCCc----------------------ccccCCCccccccchhhhcc
Q psy429          101 LAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG----------------------VMVGMGQKDSYVGDEAQSKR  158 (243)
Q Consensus       101 ~~~vViD~Gs~~~K~G~ag~~~P~~i~ps~vg~~~~~~----------------------~~~~~~~~~~~~g~~~~~~~  158 (243)
                      ..+||||+||+++||||||++.|+++|||+||+++...                      ...+.++++.++|+++...+
T Consensus         5 ~~~iViDnGs~~~KaG~ag~~~P~~v~Ps~vg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~ea~~~~   84 (427)
T 3dwl_A            5 NVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGNDALKKA   84 (427)
T ss_dssp             CSCEEECCCSSBC-CEETTSSSCSCCCBCCEECC------------------------------CCSSCCEETHHHHHTH
T ss_pred             CCeEEEECCCCeEEEEECCCCCCCCcCCceEEeecccccccccccccccccccccccccccccCcccCCeEEchHHhhCc
Confidence            36899999999999999999999999999999988541                      11233455789999998777


Q ss_pred             c-cccccCCCCCCcccCHHHHHHHHHHHhhccccCCCCCCceEeecCCCCChhHHHHHHHHhhhcCCCCeEEeeehhhhc
Q psy429          159 G-ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNC  237 (243)
Q Consensus       159 ~-~~~l~~p~~~G~i~d~d~~e~l~~~~~~~~L~~~~~~~pvlltep~~~~~~~re~~~eilFE~~~vpav~~~~~~~ls  237 (243)
                      . .+++++|+++|+|.|||.+|++|+|+|++.|++++++||+|+|||+++++..|++++|+|||+|++|++|++.+++||
T Consensus        85 ~~~l~~~~Pi~~GvI~dwd~~e~iw~~~~~~~L~v~~~~~pvlltep~~~~~~~re~~~ei~FE~~~~p~v~l~~~~vla  164 (427)
T 3dwl_A           85 SAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVLA  164 (427)
T ss_dssp             HHHCCCCCSEETTEECCHHHHHHHHHHHHHTTSCCCGGGCEEEEEECTTCCHHHHHHHHHHHTTTTCCSEEEEEEHHHHH
T ss_pred             ccCcEEecCcccCeeccHHHHHHHHHHHHhHhhCCCCcCCcEEEEcCCCCCHHHHHHHHHHHHHhccCceeeecchHHHH
Confidence            5 789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccc
Q psy429          238 CTIK  241 (243)
Q Consensus       238 ~y~~  241 (243)
                      +|-.
T Consensus       165 ~~a~  168 (427)
T 3dwl_A          165 LAAS  168 (427)
T ss_dssp             HHGG
T ss_pred             HHhc
Confidence            9853
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 6e-74
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 5e-09
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 4e-66
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 1e-11
d2fxua2225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 9e-30
d1k8ka2258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 2e-29
d1k8kb1190 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 1e-26
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  219 bits (558), Expect = 6e-74
 Identities = 127/133 (95%), Positives = 129/133 (96%)

Query: 103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 162
           ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT
Sbjct: 1   ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 60

Query: 163 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 222
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 61  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 120

Query: 223 FNTPAMYVAIQAV 235
           FN PAMYVAIQAV
Sbjct: 121 FNVPAMYVAIQAV 133
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 100.0
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.37
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 99.35
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 97.18
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 96.68
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 94.39
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 93.93
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 93.62
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 91.31
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 88.77
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 85.83
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 85.53
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=7e-40  Score=251.86  Aligned_cols=138  Identities=92%  Similarity=1.403  Sum_probs=125.7

Q ss_pred             eeeeccCCCccccCcCCCCCCCcccCcceeccCCCcccccCCCccccccchhhhccccccccCCCCCCcccCHHHHHHHH
Q psy429          103 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIW  182 (243)
Q Consensus       103 ~vViD~Gs~~~K~G~ag~~~P~~i~ps~vg~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~p~~~G~i~d~d~~e~l~  182 (243)
                      +||||+||+++|+||||++.|++++||++|+++.+....+..+.+.++|+++...+..+.+++|+++|.+.|||.++++|
T Consensus         1 avViD~Gs~~~k~G~age~~P~~~~ps~~g~~~~~~~~~~~~~~~~~igd~~~~~~~~~~~~~p~~~g~v~dwd~~e~~~   80 (140)
T d2fxua1           1 ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIW   80 (140)
T ss_dssp             CEEEEECSSEEEEEETTCSSCSEEEECCEEEECTTTC-------CCEEHHHHHHHTTSEEEECSEETTEECCHHHHHHHH
T ss_pred             CEEEECCCCeEEEeeCCCCCcceEeccceeeecccccccCccccceeeChhHhhccccccccCcCcCCcccCHHHHHHHH
Confidence            69999999999999999999999999999999887666566667788999998888888899999999999999999999


Q ss_pred             HHHhhccccCCCCCCceEeecCCCCChhHHHHHHHHhhhcCCCCeEEeeehhhhcccc
Q psy429          183 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVNCCTI  240 (243)
Q Consensus       183 ~~~~~~~L~~~~~~~pvlltep~~~~~~~re~~~eilFE~~~vpav~~~~~~~ls~y~  240 (243)
                      +|+|.+.|+++++++|+++|||+++++..|++++|+|||+|+||+++++++++||+|-
T Consensus        81 ~~~~~~~l~~~~~~~pvlltE~~~~~~~~r~~~~EilFE~~~vp~~~~~~~~~ls~ys  138 (140)
T d2fxua1          81 HHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYA  138 (140)
T ss_dssp             HHHHHTTSCCCGGGSCEEEEECTTCCHHHHHHHHHHHHHTTCCSEEEEEEHHHHHHHH
T ss_pred             HHhhhhhcccCCCCCcceeeccCCCCHHHHHHHHHHhhccCCCCEEEEEhhHHhHhhc
Confidence            9999999999999999999999999999999999999999999999999999999984
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure