Psyllid ID: psy4339


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MRQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYALCSQ
ccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccHHHHHHHHHHHHHcc
cccHccHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
MRQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEyssgrftesRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVlgkddyevglsVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSasysgleydyrGLIHVYECLENFEKMTEFTNKLSEWKILRetnelnepechidyakpseplgETMAKYYALCSQ
mrqkkillknlslCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETnelnepechidyakpseplgETMAKYYALCSQ
MRQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYALCSQ
*****ILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYA**********AKYYAL***
*****ILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRE*****EPECHIDYAKPSEPLGETMAKYYALCS*
MRQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYALCSQ
***KKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYALCSQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYALCSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q9DAX9585 Amyloid protein-binding p yes N/A 0.778 0.403 0.546 1e-67
Q92624585 Amyloid protein-binding p yes N/A 0.778 0.403 0.546 1e-67
A5HK05585 Amyloid protein-binding p yes N/A 0.778 0.403 0.546 2e-67
P46824508 Kinesin light chain OS=Dr no N/A 0.323 0.192 0.373 4e-07
P46825571 Kinesin light chain OS=Do N/A N/A 0.303 0.161 0.387 1e-06
Q5PQM2 619 Kinesin light chain 4 OS= no N/A 0.303 0.148 0.387 3e-06
Q9NSK0 619 Kinesin light chain 4 OS= no N/A 0.303 0.148 0.397 3e-06
Q2HJJ0 616 Kinesin light chain 4 OS= no N/A 0.303 0.149 0.397 3e-06
Q9DBS5 619 Kinesin light chain 4 OS= no N/A 0.303 0.148 0.387 5e-06
A0JM231311 Nephrocystin-3 OS=Xenopus no N/A 0.379 0.087 0.296 6e-06
>sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 178/256 (69%), Gaps = 20/256 (7%)

Query: 16  QLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPEN 75
           Q AL ++Q +FG +N+ VA A ++LAY+ YV++YSSG+F  +  HAE+AI    ++LPE+
Sbjct: 312 QAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKFDNALFHAERAIGIITHILPED 371

Query: 76  HLLLTSAHRVKALILEEIALDS-NELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKH 134
           HLLL S+ RVKALILEEIA+D  N+    +  +EA  LH ++L L+ K FGE NVQTAKH
Sbjct: 372 HLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKH 431

Query: 135 YGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKA 194
           YGN+GRLYQSM+KF EAE M +KAI IKE++LG++DYEV LSVGHLASLYNY M +Y  A
Sbjct: 432 YGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENA 491

Query: 195 EKLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEK 254
           EKLY RSI I    KLF   YS                 GLEYDYRGLI +Y  + N+EK
Sbjct: 492 EKLYLRSIAIGK--KLFGEGYS-----------------GLEYDYRGLIKLYNSIGNYEK 532

Query: 255 MTEFTNKLSEWKILRE 270
           + E+ N LS W  LR+
Sbjct: 533 VFEYHNVLSNWNRLRD 548




May play a role in intracellular protein transport. May be involved in the translocation of APP along microtubules toward the cell surface.
Mus musculus (taxid: 10090)
>sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 Back     alignment and function description
>sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 Back     alignment and function description
>sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 Back     alignment and function description
>sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 Back     alignment and function description
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 Back     alignment and function description
>sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 Back     alignment and function description
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
307191798 581 Amyloid protein-binding protein 2 [Harpe 0.867 0.452 0.540 2e-74
332021351 583 Amyloid protein-binding protein 2 [Acrom 0.867 0.451 0.533 3e-73
322803214 575 hypothetical protein SINV_04037 [Solenop 0.904 0.476 0.520 6e-72
307177160 581 Amyloid protein-binding protein 2 [Campo 0.867 0.452 0.529 2e-71
189240307 525 PREDICTED: similar to amyloid beta precu 0.854 0.493 0.506 3e-69
195340329 602 GM12501 [Drosophila sechellia] gi|194130 0.861 0.433 0.498 4e-69
270012373 569 hypothetical protein TcasGA2_TC006517 [T 0.854 0.455 0.506 4e-69
405968124 574 Amyloid protein-binding protein 2 [Crass 0.798 0.421 0.549 6e-69
18857963 686 protein interacting with APP tail-1, iso 0.861 0.380 0.498 9e-69
442615319 685 protein interacting with APP tail-1, iso 0.861 0.381 0.5 1e-68
>gi|307191798|gb|EFN75236.1| Amyloid protein-binding protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 198/285 (69%), Gaps = 22/285 (7%)

Query: 18  ALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHL 77
           AL +++ +FG  NL VA+A ++LAYALYV EYSSG+F E+  HA  AI   + LLP NHL
Sbjct: 317 ALDIRKAIFGKTNLHVALAHEDLAYALYVYEYSSGKFDEASDHAGLAIDIIEKLLPANHL 376

Query: 78  LLTSAHRVKALILEEIALD--SNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHY 135
           +L SA RVKALILEEIA+D  S  L       ++E LH +AL L+   FGE NVQTAKHY
Sbjct: 377 MLASAKRVKALILEEIAIDNASTPLSEQSLLLKSECLHLSALQLAKTAFGEKNVQTAKHY 436

Query: 136 GNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAE 195
           GN+GRLYQSM+KF EAE M LKAI+IKE++LG +DYEVGLS+GHLASLYN+HM  Y  AE
Sbjct: 437 GNLGRLYQSMRKFQEAEAMHLKAISIKEELLGPEDYEVGLSIGHLASLYNFHMNRYRDAE 496

Query: 196 KLYFRSIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKM 255
           KLY+RSI I  +LKLF  SYS                 GLEYDYRGL+HVY  L++FEK+
Sbjct: 497 KLYYRSIAI--SLKLFGKSYS-----------------GLEYDYRGLLHVYSKLDDFEKI 537

Query: 256 TEFTNKLSEWKILRETNELNEPECHIDYAKPSEPLGETMAKYYAL 300
            E+T+ L+ WK LR+ + L+E +  ID  K  +P+   +  ++++
Sbjct: 538 LEYTDTLTHWKELRDKHALSE-DPPIDLQKRPQPISAILTLFFSM 581




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332021351|gb|EGI61725.1| Amyloid protein-binding protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322803214|gb|EFZ23235.1| hypothetical protein SINV_04037 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307177160|gb|EFN66393.1| Amyloid protein-binding protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|189240307|ref|XP_973950.2| PREDICTED: similar to amyloid beta precursor protein (cytoplasmic tail) binding protein 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195340329|ref|XP_002036766.1| GM12501 [Drosophila sechellia] gi|194130882|gb|EDW52925.1| GM12501 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|270012373|gb|EFA08821.1| hypothetical protein TcasGA2_TC006517 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|405968124|gb|EKC33224.1| Amyloid protein-binding protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|18857963|ref|NP_572328.1| protein interacting with APP tail-1, isoform A [Drosophila melanogaster] gi|442615321|ref|NP_001259286.1| protein interacting with APP tail-1, isoform C [Drosophila melanogaster] gi|7290728|gb|AAF46174.1| protein interacting with APP tail-1, isoform A [Drosophila melanogaster] gi|16197839|gb|AAL13563.1| GH10889p [Drosophila melanogaster] gi|220945344|gb|ACL85215.1| Pat1-PA [synthetic construct] gi|220955158|gb|ACL90122.1| Pat1-PA [synthetic construct] gi|440216485|gb|AGB95131.1| protein interacting with APP tail-1, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442615319|ref|NP_001259285.1| protein interacting with APP tail-1, isoform B [Drosophila melanogaster] gi|440216484|gb|AGB95130.1| protein interacting with APP tail-1, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
FB|FBgn0029878686 Pat1 "Protein interacting with 0.679 0.300 0.571 1.4e-74
RGD|1306488585 Appbp2 "amyloid beta precursor 0.775 0.401 0.540 7.1e-61
UNIPROTKB|E1B7N1585 APPBP2 "Uncharacterized protei 0.775 0.401 0.540 1.5e-60
MGI|MGI:1914134585 Appbp2 "amyloid beta precursor 0.775 0.401 0.540 1.5e-60
UNIPROTKB|Q92624585 APPBP2 "Amyloid protein-bindin 0.775 0.401 0.540 1.5e-60
UNIPROTKB|F1S207541 APPBP2 "Uncharacterized protei 0.775 0.434 0.540 1.5e-60
UNIPROTKB|E2RDQ9585 APPBP2 "Uncharacterized protei 0.775 0.401 0.540 1.5e-60
UNIPROTKB|Q5ZLJ2586 APPBP2 "Uncharacterized protei 0.742 0.383 0.560 1.5e-60
UNIPROTKB|H7C4M1159 KLC4 "Kinesin light chain 4" [ 0.303 0.578 0.397 4.7e-09
FB|FBgn0010235508 Klc "Kinesin light chain" [Dro 0.498 0.297 0.294 6.6e-08
FB|FBgn0029878 Pat1 "Protein interacting with APP tail-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 589 (212.4 bits), Expect = 1.4e-74, Sum P(2) = 1.4e-74
 Identities = 120/210 (57%), Positives = 159/210 (75%)

Query:    18 ALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHL 77
             AL +++ +FG+ N  VAIA ++L+YA YV+EYS+G F+ ++ H +KA+   ++L+P NHL
Sbjct:   402 ALAVRRGIFGNMNFHVAIAHEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHL 461

Query:    78 LLTSAHRVKALILEEIALD--SNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHY 135
             +L SA RVKAL+LEEIALD  ++ +       ++E LH  AL+LSL+ FGE NVQTAKHY
Sbjct:   462 MLASAKRVKALLLEEIALDKMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHY 521

Query:   136 GNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAE 195
             GN+GRLYQ+M +F+EAERM  KAI IK ++LG  DYEVGLS+GHLASLYNY M +Y  AE
Sbjct:   522 GNLGRLYQTMNRFEEAERMHKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAE 581

Query:   196 KLYFRSIEINDNLKLFSASYSGLEYHYRDL 225
             +LY RSI+I+  L+LF  SYSGLEY Y  L
Sbjct:   582 QLYMRSIDIS--LRLFGNSYSGLEYDYLGL 609


GO:0005871 "kinesin complex" evidence=ISS;IPI
GO:0007018 "microtubule-based movement" evidence=ISS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0060632 "regulation of microtubule-based movement" evidence=IMP
GO:0045451 "pole plasm oskar mRNA localization" evidence=IMP
RGD|1306488 Appbp2 "amyloid beta precursor protein (cytoplasmic tail) binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7N1 APPBP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1914134 Appbp2 "amyloid beta precursor protein (cytoplasmic tail) binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q92624 APPBP2 "Amyloid protein-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S207 APPBP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDQ9 APPBP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLJ2 APPBP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H7C4M1 KLC4 "Kinesin light chain 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0010235 Klc "Kinesin light chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DAX9APBP2_MOUSENo assigned EC number0.54680.77880.4034yesN/A
Q92624APBP2_HUMANNo assigned EC number0.54680.77880.4034yesN/A
A5HK05APBP2_RATNo assigned EC number0.54680.77880.4034yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 1e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-05
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
 Score = 41.4 bits (98), Expect = 1e-05
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 131 TAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKD 169
           TA    N+ R  ++  +++EAE +  +A+AI+ +VLG D
Sbjct: 1   TAASLNNLARALRAQGRYEEAEELLEEALAIRRRVLGPD 39


Length = 42

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
KOG1840|consensus508 99.97
KOG1840|consensus508 99.95
KOG4626|consensus 966 99.92
KOG4626|consensus 966 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.77
KOG1126|consensus638 99.77
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.73
KOG1126|consensus638 99.72
KOG1130|consensus 639 99.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.7
KOG1155|consensus559 99.7
PRK11189296 lipoprotein NlpI; Provisional 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
PRK12370553 invasion protein regulator; Provisional 99.69
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.67
PRK11788389 tetratricopeptide repeat protein; Provisional 99.65
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.64
KOG1125|consensus579 99.63
PRK11788389 tetratricopeptide repeat protein; Provisional 99.63
KOG1155|consensus559 99.63
KOG1130|consensus 639 99.61
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.61
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.61
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.61
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.61
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.6
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.6
PRK12370553 invasion protein regulator; Provisional 99.59
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.59
KOG1173|consensus611 99.56
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.55
KOG0547|consensus606 99.54
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.48
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.48
KOG1129|consensus478 99.48
KOG2003|consensus 840 99.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
PRK15359144 type III secretion system chaperone protein SscB; 99.45
PRK15359144 type III secretion system chaperone protein SscB; 99.44
KOG1173|consensus611 99.43
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.42
PRK11189296 lipoprotein NlpI; Provisional 99.41
KOG1941|consensus 518 99.37
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.33
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.33
KOG2002|consensus 1018 99.32
KOG0548|consensus539 99.31
KOG0547|consensus606 99.31
KOG2002|consensus 1018 99.3
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.28
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.27
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.27
PRK10370198 formate-dependent nitrite reductase complex subuni 99.26
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.24
KOG1125|consensus579 99.24
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.24
PRK04841 903 transcriptional regulator MalT; Provisional 99.24
PRK04841 903 transcriptional regulator MalT; Provisional 99.23
KOG2003|consensus840 99.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.22
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.21
PRK10370198 formate-dependent nitrite reductase complex subuni 99.21
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.2
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.2
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.2
KOG0553|consensus304 99.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.17
KOG0553|consensus304 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.16
PLN02789320 farnesyltranstransferase 99.16
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.15
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.14
KOG1941|consensus 518 99.14
KOG1129|consensus478 99.14
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.13
KOG2076|consensus 895 99.13
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.12
KOG1839|consensus1236 99.12
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.09
KOG1839|consensus1236 99.09
KOG0624|consensus504 99.08
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.08
KOG0548|consensus539 99.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.04
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.03
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.03
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.01
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.0
KOG0550|consensus486 99.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.99
PRK14574 822 hmsH outer membrane protein; Provisional 98.99
PLN02789320 farnesyltranstransferase 98.99
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.99
KOG0550|consensus486 98.98
KOG4162|consensus799 98.98
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.97
KOG1174|consensus564 98.96
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.95
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.93
KOG2076|consensus 895 98.91
PLN03218 1060 maturation of RBCL 1; Provisional 98.91
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.9
PF12688120 TPR_5: Tetratrico peptide repeat 98.9
PLN03218 1060 maturation of RBCL 1; Provisional 98.9
KOG0624|consensus 504 98.89
KOG0543|consensus397 98.89
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.89
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.89
PRK14574 822 hmsH outer membrane protein; Provisional 98.88
PRK10803263 tol-pal system protein YbgF; Provisional 98.88
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.87
PF12688120 TPR_5: Tetratrico peptide repeat 98.86
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.86
KOG1585|consensus308 98.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.85
KOG1128|consensus 777 98.85
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.84
KOG2376|consensus 652 98.82
KOG1174|consensus564 98.82
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.81
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.79
KOG2376|consensus 652 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.76
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.73
KOG1156|consensus 700 98.73
KOG4234|consensus271 98.72
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.7
KOG3060|consensus289 98.69
KOG1127|consensus 1238 98.68
KOG0543|consensus397 98.68
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.64
PLN03077857 Protein ECB2; Provisional 98.64
KOG3785|consensus 557 98.63
KOG1585|consensus308 98.63
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.62
KOG1586|consensus288 98.6
KOG4162|consensus799 98.59
KOG3060|consensus289 98.58
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.58
KOG1128|consensus 777 98.57
KOG1156|consensus 700 98.57
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.57
KOG1586|consensus288 98.57
KOG4340|consensus 459 98.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.5
KOG4555|consensus175 98.49
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.49
PLN03077 857 Protein ECB2; Provisional 98.48
KOG0495|consensus 913 98.48
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.47
KOG0495|consensus913 98.45
PRK15331165 chaperone protein SicA; Provisional 98.45
KOG4555|consensus175 98.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.44
KOG1127|consensus 1238 98.43
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.43
PRK15331165 chaperone protein SicA; Provisional 98.41
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.4
KOG3081|consensus299 98.4
PRK11906458 transcriptional regulator; Provisional 98.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.37
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.36
PRK11906458 transcriptional regulator; Provisional 98.36
PF13512142 TPR_18: Tetratricopeptide repeat 98.34
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.33
PF1337173 TPR_9: Tetratricopeptide repeat 98.33
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.33
KOG2300|consensus629 98.3
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.28
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.23
KOG4234|consensus271 98.21
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.16
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 98.14
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.14
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.13
PF13512142 TPR_18: Tetratricopeptide repeat 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.11
KOG3785|consensus 557 98.1
KOG4648|consensus 536 98.1
PF1337173 TPR_9: Tetratricopeptide repeat 98.07
KOG2300|consensus629 98.02
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.0
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.96
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.96
KOG4642|consensus284 97.95
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.94
KOG4340|consensus 459 97.94
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.94
KOG4648|consensus 536 97.92
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.91
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.91
KOG3617|consensus 1416 97.9
KOG1464|consensus 440 97.89
KOG2796|consensus366 97.87
KOG3616|consensus 1636 97.85
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.84
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.84
KOG3617|consensus 1416 97.82
KOG4642|consensus284 97.81
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.8
KOG2796|consensus366 97.79
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.78
KOG1070|consensus1710 97.77
KOG2047|consensus 835 97.77
COG4700251 Uncharacterized protein conserved in bacteria cont 97.76
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.73
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.71
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.7
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.7
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.7
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.68
KOG0551|consensus 390 97.62
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.62
KOG0545|consensus329 97.6
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.6
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.59
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.59
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.57
KOG2047|consensus 835 97.56
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.55
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.53
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.49
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.48
KOG1915|consensus 677 97.41
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.38
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.38
KOG0545|consensus329 97.36
KOG0551|consensus390 97.35
KOG2610|consensus 491 97.34
PF1342844 TPR_14: Tetratricopeptide repeat 97.34
PF1342844 TPR_14: Tetratricopeptide repeat 97.34
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.32
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.3
PF1343134 TPR_17: Tetratricopeptide repeat 97.29
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.29
PF1343134 TPR_17: Tetratricopeptide repeat 97.22
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.21
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.2
KOG1915|consensus 677 97.19
KOG2610|consensus 491 97.16
KOG3081|consensus299 97.14
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.13
KOG1464|consensus440 97.09
KOG3616|consensus 1636 97.02
KOG1070|consensus1710 96.91
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 96.89
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.89
KOG2471|consensus 696 96.83
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.66
KOG1550|consensus552 96.64
KOG2471|consensus 696 96.59
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.57
KOG2053|consensus 932 96.46
KOG2041|consensus 1189 96.44
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.42
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 96.41
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.34
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.3
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 96.29
KOG1463|consensus 411 96.26
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.25
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.24
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.22
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.15
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 96.11
KOG0376|consensus 476 96.1
KOG0376|consensus 476 95.93
COG5159 421 RPN6 26S proteasome regulatory complex component [ 95.87
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.76
KOG4814|consensus 872 95.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.57
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.55
KOG1308|consensus377 95.53
KOG2041|consensus 1189 95.48
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.48
KOG4507|consensus886 95.47
KOG2053|consensus 932 95.44
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.3
KOG0508|consensus 615 95.19
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.11
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.87
COG3898 531 Uncharacterized membrane-bound protein [Function u 94.86
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.85
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.78
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.73
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.7
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.46
KOG2114|consensus 933 94.4
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.34
KOG1550|consensus552 94.27
KOG1308|consensus377 94.23
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.22
KOG3364|consensus149 93.93
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.76
KOG2581|consensus 493 93.65
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.51
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.36
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 93.2
PRK10941269 hypothetical protein; Provisional 93.14
KOG2561|consensus 568 93.06
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 93.05
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.01
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 92.93
COG3898 531 Uncharacterized membrane-bound protein [Function u 92.89
KOG0686|consensus 466 92.85
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.61
KOG0686|consensus 466 92.58
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.37
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 92.35
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.09
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 92.08
KOG0985|consensus 1666 92.04
KOG4507|consensus 886 91.98
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.92
KOG4814|consensus 872 91.55
KOG3364|consensus149 91.42
KOG0508|consensus615 91.12
KOG0687|consensus393 91.12
COG5187412 RPN7 26S proteasome regulatory complex component, 91.09
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 90.84
PRK10941269 hypothetical protein; Provisional 90.48
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 90.13
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 89.95
KOG3783|consensus546 89.87
KOG3783|consensus546 89.74
KOG4014|consensus248 89.73
KOG1538|consensus 1081 89.67
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.0
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.91
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.89
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.86
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.45
KOG3824|consensus 472 88.33
PF1285434 PPR_1: PPR repeat 88.13
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 87.97
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 87.58
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 87.57
PF12309371 KBP_C: KIF-1 binding protein C terminal; InterPro: 87.33
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 86.89
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 86.67
PF12309371 KBP_C: KIF-1 binding protein C terminal; InterPro: 86.38
KOG4563|consensus 400 86.34
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 86.24
KOG3824|consensus 472 86.18
COG3629280 DnrI DNA-binding transcriptional activator of the 86.14
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 86.08
PF05053 618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 85.48
cd0267979 MIT_spastin MIT: domain contained within Microtubu 85.38
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 85.18
COG4976 287 Predicted methyltransferase (contains TPR repeat) 85.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 84.98
KOG4521|consensus 1480 84.75
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.66
COG5159421 RPN6 26S proteasome regulatory complex component [ 84.42
KOG1497|consensus 399 84.15
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 83.99
COG3947361 Response regulator containing CheY-like receiver a 83.88
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 83.82
KOG0687|consensus393 83.31
KOG0985|consensus 1666 82.97
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 82.8
COG3947361 Response regulator containing CheY-like receiver a 82.25
KOG3807|consensus 556 82.02
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.0
cd0267979 MIT_spastin MIT: domain contained within Microtubu 81.95
KOG4563|consensus 400 81.43
KOG1463|consensus411 81.35
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 81.06
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 80.74
KOG0890|consensus 2382 80.63
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 80.55
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 80.27
>KOG1840|consensus Back     alignment and domain information
Probab=99.97  E-value=4.3e-29  Score=214.28  Aligned_cols=259  Identities=23%  Similarity=0.270  Sum_probs=231.6

Q ss_pred             hhhhhhHhHHHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHhhhhhcccHHHHHHHHHHHHHHHHhhCCcchhhhHH
Q psy4339           2 RQKKILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTS   81 (303)
Q Consensus         2 ~~~~~~l~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~y~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~   81 (303)
                      ..-++-++.|+.+++.|+++.++..|.++|..+.....+|..|    ..+++|++|+..|++|+.+.+..+|++||..+.
T Consensus       209 y~~~g~~e~A~~l~k~Al~~l~k~~G~~hl~va~~l~~~a~~y----~~~~k~~eAv~ly~~AL~i~e~~~G~~h~~va~  284 (508)
T KOG1840|consen  209 YAVQGRLEKAEPLCKQALRILEKTSGLKHLVVASMLNILALVY----RSLGKYDEAVNLYEEALTIREEVFGEDHPAVAA  284 (508)
T ss_pred             HHHhccHHHHHHHHHHHHHHHHHccCccCHHHHHHHHHHHHHH----HHhccHHHHHHHHHHHHHHHHHhcCCCCHHHHH
Confidence            3456789999999999999999999999999999999999655    799999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhhHHHHhhhhHHHHHHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHHH
Q psy4339          82 AHRVKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAI  161 (303)
Q Consensus        82 ~~~~la~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~  161 (303)
                      ++.+||          .+|...|+|++|..++++|+++.++..+..++.+...+.+++.++..++++++|+.++++++++
T Consensus       285 ~l~nLa----------~ly~~~GKf~EA~~~~e~Al~I~~~~~~~~~~~v~~~l~~~~~~~~~~~~~Eea~~l~q~al~i  354 (508)
T KOG1840|consen  285 TLNNLA----------VLYYKQGKFAEAEEYCERALEIYEKLLGASHPEVAAQLSELAAILQSMNEYEEAKKLLQKALKI  354 (508)
T ss_pred             HHHHHH----------HHHhccCChHHHHHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHH
Confidence            999999          7779999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCchHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHHhhhh-----hhhhhhhhhhhhhhH--------------
Q psy4339         162 KEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDN-----LKLFSASYSGLEYHY--------------  222 (303)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~la~~~~~~~g~~~~A~~~~~~al~~~~~-----~~~~~~~~~~l~~~~--------------  222 (303)
                      ....+|.+++.++..+.++|.+|. .+|++++|.+++++|+.+...     ++.++..+++++..+              
T Consensus       355 ~~~~~g~~~~~~a~~~~nl~~l~~-~~gk~~ea~~~~k~ai~~~~~~~~~~~~~~~~~l~~la~~~~~~k~~~~a~~l~~  433 (508)
T KOG1840|consen  355 YLDAPGEDNVNLAKIYANLAELYL-KMGKYKEAEELYKKAIQILRELLGKKDYGVGKPLNQLAEAYEELKKYEEAEQLFE  433 (508)
T ss_pred             HHhhccccchHHHHHHHHHHHHHH-HhcchhHHHHHHHHHHHHHHhcccCcChhhhHHHHHHHHHHHHhcccchHHHHHH
Confidence            999999999999999999999996 999999999999999999863     455666666664222              


Q ss_pred             HHH---hhhccccccHHHHHHhHHHHHHhhhcHHHHHHHHHHHHHHHHHHhhhhcCCCC
Q psy4339         223 RDL---KLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKLSEWKILRETNELNEPE  278 (303)
Q Consensus       223 ~a~---~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~  278 (303)
                      ++.   +.+|+++|++...+.+||.+|..+|++++|+++.+.+..|++.   .++..+|
T Consensus       434 ~~~~i~~~~g~~~~~~~~~~~nL~~~Y~~~g~~e~a~~~~~~~~~~~~~---~~~~~~~  489 (508)
T KOG1840|consen  434 EAKDIMKLCGPDHPDVTYTYLNLAALYRAQGNYEAAEELEEKVLNAREQ---RLGTASP  489 (508)
T ss_pred             HHHHHHHHhCCCCCchHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHH---cCCCCCc
Confidence            221   6678999999999999999999999999999999888555544   4454444



>KOG1840|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2581|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>KOG3783|consensus Back     alignment and domain information
>KOG4014|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF12309 KBP_C: KIF-1 binding protein C terminal; InterPro: IPR022083 This family of proteins is found in bacteria and eukaryotes Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF12309 KBP_C: KIF-1 binding protein C terminal; InterPro: IPR022083 This family of proteins is found in bacteria and eukaryotes Back     alignment and domain information
>KOG4563|consensus Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4521|consensus Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG0687|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4563|consensus Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0890|consensus Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 5e-07
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 3e-05
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 2e-04
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 3e-05
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 2e-04
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 45/161 (27%), Positives = 79/161 (49%), Gaps = 11/161 (6%) Query: 44 LYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRVKALILEEIALDSNELISV 103 L + S GR+ + ++A++ + +H + + + AL+ D N+ Sbjct: 33 LVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYR----DQNK---- 84 Query: 104 QFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKE 163 YK+A L +AL + K G+++ A N+ LY K+ EAE + +A+ I+E Sbjct: 85 --YKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIRE 142 Query: 164 KVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEI 204 KVLGKD +V + +LA L + +Y + E Y R++EI Sbjct: 143 KVLGKDHPDVAKQLNNLALLCQ-NQGKYEEVEYYYQRALEI 182
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-22
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-20
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-17
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 3e-08
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-22
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-21
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 9e-19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-17
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 5e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 7e-09
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-08
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-08
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-08
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-04
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-08
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 7e-07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-07
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 2e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 9e-06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 9e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-04
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
 Score = 93.7 bits (234), Expect = 1e-22
 Identities = 51/198 (25%), Positives = 79/198 (39%), Gaps = 24/198 (12%)

Query: 11  LSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKN 70
           + LC Q AL+  +   G ++  VA   + LA           ++ E+      A+   + 
Sbjct: 21  VPLCKQ-ALEDLEKTSGHDHPDVATMLNILALVYR----DQNKYKEAAHLLNDALAIREK 75

Query: 71  LLPENHLLLTSAHRVKALILEEIALDSNELISVQF----YKEAELLHQNALVLSLKHFGE 126
            L ++H                +A   N L  +      YKEAE L + AL +  K  G+
Sbjct: 76  TLGKDHP--------------AVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGK 121

Query: 127 NNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNY 186
            +   AK   N+  L Q+  K +E E    +A+ I    LG DD  V  +  +LAS Y  
Sbjct: 122 FHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCY-L 180

Query: 187 HMLEYHKAEKLYFRSIEI 204
              +Y  AE LY   +  
Sbjct: 181 KQGKYQDAETLYKEILTR 198


>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.96
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.92
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.91
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.91
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.9
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.87
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.86
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.84
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.83
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.83
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.82
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.81
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.81
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.81
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.8
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.8
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.79
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.79
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.79
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.79
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.79
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.79
3u4t_A272 TPR repeat-containing protein; structural genomics 99.78
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.78
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.77
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.77
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.77
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.76
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.76
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.75
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.75
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.75
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.75
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.74
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.74
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.73
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.73
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.72
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.72
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.72
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.71
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.69
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.68
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.67
3u4t_A272 TPR repeat-containing protein; structural genomics 99.67
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.66
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.65
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.65
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.64
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.61
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.6
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.6
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.59
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.59
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.58
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.58
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.57
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.56
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.53
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.53
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.53
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.53
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.52
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.5
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.5
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.47
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.47
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.47
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.46
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.46
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.45
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.43
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.42
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.42
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.42
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.4
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.4
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.39
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.39
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.39
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.38
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.37
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.36
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.35
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.34
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.33
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.32
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.32
3k9i_A117 BH0479 protein; putative protein binding protein, 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.31
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.3
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.29
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.27
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.27
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.23
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.23
3k9i_A117 BH0479 protein; putative protein binding protein, 99.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.19
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.16
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.16
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.15
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.12
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.07
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.05
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.03
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.01
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.99
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.99
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.95
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.94
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.93
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.91
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.87
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.83
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.53
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.48
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.46
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.45
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.44
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.37
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.28
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.25
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.22
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.1
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.07
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.03
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.96
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.93
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.81
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.8
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.41
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.36
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.05
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.62
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.58
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.48
2o8p_A227 14-3-3 domain containing protein; signaling protei 96.37
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.3
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.28
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.19
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 96.1
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.09
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 96.09
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.04
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 96.02
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 96.01
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.91
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.9
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.5
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 95.5
2npm_A260 14-3-3 domain containing protein; cell regulator p 95.43
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.17
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.93
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 94.92
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.88
2o8p_A227 14-3-3 domain containing protein; signaling protei 94.87
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.48
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.43
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.42
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.62
2wpv_A 312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.57
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.48
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 93.03
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.45
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 92.39
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 92.13
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.89
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 90.82
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.2
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.92
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.71
3re2_A472 Predicted protein; menin, multiple endocrine neopl 89.52
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 88.78
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.37
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 88.33
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 88.26
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 88.24
2npm_A260 14-3-3 domain containing protein; cell regulator p 87.12
3u84_A550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 87.03
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.03
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 85.03
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 82.94
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 80.06
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
Probab=99.96  E-value=1.1e-25  Score=183.80  Aligned_cols=242  Identities=21%  Similarity=0.183  Sum_probs=207.8

Q ss_pred             hhHhHHHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHhhhhhcccHHHHHHHHHHHHHHHHhhCCcchhhhHHHHHH
Q psy4339           6 ILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHRV   85 (303)
Q Consensus         6 ~~l~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~y~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~   85 (303)
                      .-.+.|+.+|++|++++++..+.++|..+.++..+|.++    ...|++++|+.++++++++.+...++++|....++.+
T Consensus        15 ~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~l~~~~----~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~   90 (283)
T 3edt_B           15 VPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVY----RDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNN   90 (283)
T ss_dssp             SCSSSHHHHHHHHHHHHHHHHCSSSHHHHHHHHHHHHHH----HHTTCHHHHHHHHHHHHHHHHHHTCTTCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHH----HHcccHHHHHHHHHHHHHHHHHHcCCcchHHHHHHHH
Confidence            446789999999999999999989999999999999877    5999999999999999999998888888999999999


Q ss_pred             HHHHHHHHhhhhHHHHhhhhHHHHHHHHHHHHHHHHHhhCCCcHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHHHHHHh
Q psy4339          86 KALILEEIALDSNELISVQFYKEAELLHQNALVLSLKHFGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKV  165 (303)
Q Consensus        86 la~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~  165 (303)
                      +|          .++...|++++|+.++++++.+.++..++++|....++.++|.++..+|++++|+.++++++++.+..
T Consensus        91 l~----------~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  160 (283)
T 3edt_B           91 LA----------VLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLNNLALLCQNQGKAEEVEYYYRRALEIYATR  160 (283)
T ss_dssp             HH----------HHHHTTTCHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHH
T ss_pred             HH----------HHHHHhccHHHHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Confidence            99          77799999999999999999999988888889999999999999999999999999999999999998


Q ss_pred             cCCCchHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHHhhhhhh------hhhhhhhhhhhhH-------------HH--
Q psy4339         166 LGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFRSIEINDNLK------LFSASYSGLEYHY-------------RD--  224 (303)
Q Consensus       166 ~~~~~~~~~~~~~~la~~~~~~~g~~~~A~~~~~~al~~~~~~~------~~~~~~~~l~~~~-------------~a--  224 (303)
                      .++++|....++.++|.++. .+|++++|+.++++++.+.+..+      .....+..++...             ++  
T Consensus       161 ~~~~~~~~~~~~~~la~~~~-~~g~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (283)
T 3edt_B          161 LGPDDPNVAKTKNNLASCYL-KQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSAPYGEYGS  239 (283)
T ss_dssp             SCTTCHHHHHHHHHHHHHHH-HHTCHHHHHHHHHHHHHHHHHHHSSSCCSSCCCHHHHHHHHHHTTCCCCC---------
T ss_pred             cCCCCHHHHHHHHHHHHHHH-HcCCHHHHHHHHHHHHHHHHHhcCCCcchhHHHHHHHHHHHHhcCCchhHHHHHHHHHH
Confidence            88889999999999999997 99999999999999999876422      1222222222111             11  


Q ss_pred             -HhhhccccccHHHHHHhHHHHHHhhhcHHHHHHHHHHH
Q psy4339         225 -LKLFSASYSGLEYDYRGLIHVYECLENFEKMTEFTNKL  262 (303)
Q Consensus       225 -~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~  262 (303)
                       ....+..+|....++..+|.+|...|++++|..+++.+
T Consensus       240 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a  278 (283)
T 3edt_B          240 WYKACKVDSPTVNTTLRSLGALYRRQGKLEAAHTLEDCA  278 (283)
T ss_dssp             ---CCCCCCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             HHHhcCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence             13334456788889999999999999999999965443



>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.83
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.79
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.77
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.76
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.75
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.71
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.7
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.69
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.5
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.48
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.47
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.47
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.46
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.46
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.45
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.44
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.42
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.38
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.37
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.36
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.29
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.29
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.22
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.17
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.08
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.93
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.76
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.67
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.66
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.48
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.25
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.06
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.03
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.76
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 96.19
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 95.91
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 95.87
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 95.28
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 94.85
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 94.65
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 92.55
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 91.27
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.61
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 82.2
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 80.47
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=1.6e-19  Score=148.61  Aligned_cols=191  Identities=14%  Similarity=0.053  Sum_probs=129.6

Q ss_pred             hhhHhHHHHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHhhhhhcccHHHHHHHHHHHHHHHHhhCCcchhhhHHHHH
Q psy4339           5 KILLKNLSLCSQLALKLKQVLFGSENLQVAIAEDELAYALYVNEYSSGRFTESRRHAEKAIQTFKNLLPENHLLLTSAHR   84 (303)
Q Consensus         5 ~~~l~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~y~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~   84 (303)
                      .+-++.|+..|+++++.        +|..+.++..+|.++    ...|++++|+.+|.+++++        +|.....+.
T Consensus        32 ~g~~~~A~~~~~~al~~--------~P~~~~a~~~lg~~~----~~~~~~~~A~~~~~~al~~--------~p~~~~~~~   91 (323)
T d1fcha_          32 EGDLPNAVLLFEAAVQQ--------DPKHMEAWQYLGTTQ----AENEQELLAISALRRCLEL--------KPDNQTALM   91 (323)
T ss_dssp             TTCHHHHHHHHHHHHHS--------CTTCHHHHHHHHHHH----HHTTCHHHHHHHHHHHHHH--------CTTCHHHHH
T ss_pred             cCCHHHHHHHHHHHHHh--------CCCCHHHHHHHHHHH----HHcCChHHHHHHHHhhhcc--------ccccccccc
Confidence            34566666777766654        566778999999877    5999999999999999987        455567788


Q ss_pred             HHHHHHHHHhhhhHHHHhhhhHHHHHHHHHHHHHHHHHh-----------------------------------------
Q psy4339          85 VKALILEEIALDSNELISVQFYKEAELLHQNALVLSLKH-----------------------------------------  123 (303)
Q Consensus        85 ~la~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~~~~-----------------------------------------  123 (303)
                      .+|          .+|...|++++|++.+++++......                                         
T Consensus        92 ~la----------~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  161 (323)
T d1fcha_          92 ALA----------VSFTNESLQRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLA  161 (323)
T ss_dssp             HHH----------HHHHHTTCHHHHHHHHHHHHHTSTTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHH
T ss_pred             ccc----------ccccccccccccccchhhHHHhccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHH
Confidence            888          55678888888888888776542211                                         


Q ss_pred             ---hCCCcHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHHHHhhcCHHHHHHHHHH
Q psy4339         124 ---FGENNVQTAKHYGNIGRLYQSMQKFDEAERMQLKAIAIKEKVLGKDDYEVGLSVGHLASLYNYHMLEYHKAEKLYFR  200 (303)
Q Consensus       124 ---~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~g~~~~A~~~~~~  200 (303)
                         ..++. ....++..+|.++..+|++++|+.++++++...        |....++..+|.++. .+|++++|+.+|++
T Consensus       162 al~~~p~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~--------p~~~~~~~~lg~~~~-~~g~~~~A~~~~~~  231 (323)
T d1fcha_         162 AVRLDPTS-IDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVR--------PNDYLLWNKLGATLA-NGNQSEEAVAAYRR  231 (323)
T ss_dssp             HHHHSTTS-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHH-HTTCHHHHHHHHHH
T ss_pred             HHHHhhcc-cccccchhhHHHHHHHHHHhhhhcccccccccc--------cccccchhhhhhccc-ccccchhHHHHHHH
Confidence               00000 112344556666666666666666666665432        333445556666664 66666666666666


Q ss_pred             HHHhhhhhhhhhhhhhhhhhhHHHHhhhccccccHHHHHHhHHHHHHhhhcHHHHHH-HHHHH
Q psy4339         201 SIEINDNLKLFSASYSGLEYHYRDLKLFSASYSGLEYDYRGLIHVYECLENFEKMTE-FTNKL  262 (303)
Q Consensus       201 al~~~~~~~~~~~~~~~l~~~~~a~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~-~~~~~  262 (303)
                      ++++.|                           ....++.++|.+|...|++++|++ +.+++
T Consensus       232 al~~~p---------------------------~~~~a~~~lg~~~~~~g~~~~A~~~~~~al  267 (323)
T d1fcha_         232 ALELQP---------------------------GYIRSRYNLGISCINLGAHREAVEHFLEAL  267 (323)
T ss_dssp             HHHHCT---------------------------TCHHHHHHHHHHHHHHTCHHHHHHHHHHHH
T ss_pred             HHHHhh---------------------------ccHHHHHHHHHHHHHCCCHHHHHHHHHHHH
Confidence            665544                           556789999999999999999999 44555



>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure