Psyllid ID: psy4383


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYVSPTPTT
ccccEEEEEEccccHHHHHHccccccEEEEEEEEEEEEccEEEEEEcccccHHHHHccccccEEEcEEccccccccccccccccccccc
ccccEEEEEEccHHHHHHHHccccccEEEEEEEEEEEcccEEEEEEccHHHHHHHHccccccEEEEEEEcccccccccccccccccccc
mhkgyafiqfsnphdarsaclgedgrtvlGQTLGISMHKGYAfiqfsnphdarsaclgedgrtvLGQTLVSYKLQyyngcryvsptptt
MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYklqyyngcryvsptptt
MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYVSPTPTT
****YAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYV******
*HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKL***************
MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYVSPTPTT
**KGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYY************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYVSPTPTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query89 2.2.26 [Sep-21-2011]
Q9UKM9 306 RNA-binding protein Raly no N/A 0.449 0.130 0.6 5e-08
P19600 282 Heterogeneous nuclear rib N/A N/A 0.449 0.141 0.575 8e-08
Q64012 312 RNA-binding protein Raly no N/A 0.449 0.128 0.575 2e-07
Q5RA82 306 Heterogeneous nuclear rib no N/A 0.449 0.130 0.525 5e-07
P07910 306 Heterogeneous nuclear rib no N/A 0.449 0.130 0.525 5e-07
Q9Z204 313 Heterogeneous nuclear rib no N/A 0.449 0.127 0.525 5e-07
O77768 306 Heterogeneous nuclear rib no N/A 0.449 0.130 0.525 5e-07
Q8BTF8 293 RNA-binding Raly-like pro no N/A 0.449 0.136 0.475 3e-05
Q08DJ0 293 RNA-binding Raly-like pro no N/A 0.449 0.136 0.475 3e-05
Q86SE5 291 RNA-binding Raly-like pro no N/A 0.449 0.137 0.475 4e-05
>sp|Q9UKM9|RALY_HUMAN RNA-binding protein Raly OS=Homo sapiens GN=RALY PE=1 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (77%)

Query: 30 GQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69
          G+  G S+HKGYAF+Q+SN   AR+A LGE+GR + GQTL
Sbjct: 46 GRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTL 85




Probable-RNA binding protein. Could be a heterogeneous nuclear ribonucleoprotein (hnRNP). May be involved in pre-mRNA splicing.
Homo sapiens (taxid: 9606)
>sp|P19600|HNRPC_XENLA Heterogeneous nuclear ribonucleoprotein C OS=Xenopus laevis GN=hnrnpc PE=2 SV=1 Back     alignment and function description
>sp|Q64012|RALY_MOUSE RNA-binding protein Raly OS=Mus musculus GN=Raly PE=1 SV=3 Back     alignment and function description
>sp|Q5RA82|HNRPC_PONAB Heterogeneous nuclear ribonucleoprotein C OS=Pongo abelii GN=HNRNPC PE=2 SV=1 Back     alignment and function description
>sp|P07910|HNRPC_HUMAN Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens GN=HNRNPC PE=1 SV=4 Back     alignment and function description
>sp|Q9Z204|HNRPC_MOUSE Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Mus musculus GN=Hnrnpc PE=1 SV=1 Back     alignment and function description
>sp|O77768|HNRPC_RABIT Heterogeneous nuclear ribonucleoprotein C OS=Oryctolagus cuniculus GN=HNRNPC PE=2 SV=1 Back     alignment and function description
>sp|Q8BTF8|RALYL_MOUSE RNA-binding Raly-like protein OS=Mus musculus GN=Ralyl PE=2 SV=1 Back     alignment and function description
>sp|Q08DJ0|RALYL_BOVIN RNA-binding Raly-like protein OS=Bos taurus GN=RALYL PE=2 SV=1 Back     alignment and function description
>sp|Q86SE5|RALYL_HUMAN RNA-binding Raly-like protein OS=Homo sapiens GN=RALYL PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
24202313895 conserved hypothetical protein [Pediculu 0.449 0.421 0.825 6e-12
270004650 424 hypothetical protein TcasGA2_TC004021 [T 0.449 0.094 0.8 1e-11
328782001 394 PREDICTED: hypothetical protein LOC72615 0.449 0.101 0.8 2e-11
383848360 409 PREDICTED: uncharacterized protein LOC10 0.449 0.097 0.8 2e-11
340725200 394 PREDICTED: hypothetical protein LOC10064 0.449 0.101 0.8 2e-11
345485295 423 PREDICTED: hypothetical protein LOC10011 0.449 0.094 0.8 2e-11
380028205 388 PREDICTED: uncharacterized protein LOC10 0.449 0.103 0.8 2e-11
350416967 394 PREDICTED: hypothetical protein LOC10074 0.449 0.101 0.8 3e-11
33202725986 Heterogeneous nuclear ribonucleoprotein 0.449 0.465 0.8 3e-11
195017979 433 GH14884 [Drosophila grimshawi] gi|193898 0.471 0.096 0.714 1e-10
>gi|242023138|ref|XP_002431993.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517344|gb|EEB19255.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 74.7 bits (182), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/40 (82%), Positives = 36/40 (90%)

Query: 30 GQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69
          G+  GISMHKGYAF+QF+NP DARSACLGEDGRTVLGQ L
Sbjct: 45 GRIAGISMHKGYAFVQFTNPFDARSACLGEDGRTVLGQIL 84




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270004650|gb|EFA01098.1| hypothetical protein TcasGA2_TC004021 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328782001|ref|XP_001121913.2| PREDICTED: hypothetical protein LOC726153 [Apis mellifera] Back     alignment and taxonomy information
>gi|383848360|ref|XP_003699819.1| PREDICTED: uncharacterized protein LOC100881697 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340725200|ref|XP_003400961.1| PREDICTED: hypothetical protein LOC100649273 isoform 1 [Bombus terrestris] gi|340725202|ref|XP_003400962.1| PREDICTED: hypothetical protein LOC100649273 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345485295|ref|XP_003425234.1| PREDICTED: hypothetical protein LOC100113835 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380028205|ref|XP_003697798.1| PREDICTED: uncharacterized protein LOC100865280 [Apis florea] Back     alignment and taxonomy information
>gi|350416967|ref|XP_003491192.1| PREDICTED: hypothetical protein LOC100746621 [Bombus impatiens] Back     alignment and taxonomy information
>gi|332027259|gb|EGI67343.1| Heterogeneous nuclear ribonucleoprotein C [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195017979|ref|XP_001984697.1| GH14884 [Drosophila grimshawi] gi|193898179|gb|EDV97045.1| GH14884 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
FB|FBgn0259935 711 CG42458 [Drosophila melanogast 0.471 0.059 0.714 2.2e-11
UNIPROTKB|E1BT73179 RALY "Uncharacterized protein" 0.449 0.223 0.6 5.9e-09
UNIPROTKB|Q5QPM1181 RALY "RNA-binding protein Raly 0.449 0.220 0.6 9.7e-09
UNIPROTKB|Q5QPM289 RALY "RNA-binding protein Raly 0.449 0.449 0.6 9.7e-09
UNIPROTKB|Q5QPL9 237 RALY "RNA-binding protein Raly 0.449 0.168 0.6 1.7e-08
UNIPROTKB|F1P0I8 285 RALY "Uncharacterized protein" 0.449 0.140 0.6 1.9e-08
ZFIN|ZDB-GENE-041010-127 273 raly "RNA binding protein, aut 0.449 0.146 0.575 3.6e-08
UNIPROTKB|Q9UKM9 306 RALY "RNA-binding protein Raly 0.449 0.130 0.6 3.7e-08
UNIPROTKB|E9PTI6 285 Raly "Protein Raly" [Rattus no 0.449 0.140 0.575 6.7e-08
UNIPROTKB|E2R552 293 RALY "Uncharacterized protein" 0.449 0.136 0.575 7.2e-08
FB|FBgn0259935 CG42458 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 167 (63.8 bits), Expect = 2.2e-11, P = 2.2e-11
 Identities = 30/42 (71%), Positives = 36/42 (85%)

Query:    28 VLGQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69
             + G+  GISMHKGYAF+QF+NP DAR+AC GEDG+TVL QTL
Sbjct:    43 IYGRLAGISMHKGYAFVQFTNPFDARNACHGEDGKTVLSQTL 84


GO:0003729 "mRNA binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|E1BT73 RALY "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5QPM1 RALY "RNA-binding protein Raly" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5QPM2 RALY "RNA-binding protein Raly" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5QPL9 RALY "RNA-binding protein Raly" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0I8 RALY "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-127 raly "RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog (mouse))" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKM9 RALY "RNA-binding protein Raly" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTI6 Raly "Protein Raly" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R552 RALY "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 8e-18
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-15
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 2e-12
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 5e-12
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 7e-11
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 9e-11
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 1e-08
cd1260569 cd12605, RRM_RALYL, RNA recognition motif in verte 9e-07
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-05
smart0036073 smart00360, RRM, RNA recognition motif 3e-05
smart0036073 smart00360, RRM, RNA recognition motif 3e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-05
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 2e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 2e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 4e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 8e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 0.001
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 0.001
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 0.001
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.001
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.001
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 0.001
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 0.001
smart0036170 smart00361, RRM_1, RNA recognition motif 0.001
smart0036170 smart00361, RRM_1, RNA recognition motif 0.001
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.002
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 0.002
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 0.002
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.002
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 0.002
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.003
pfam1389356 pfam13893, RRM_5, RNA recognition motif 0.003
pfam1389356 pfam13893, RRM_5, RNA recognition motif 0.003
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.003
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.003
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 0.003
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 0.004
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 0.004
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 0.004
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.004
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.004
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 0.004
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 0.004
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 0.004
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
 Score = 69.9 bits (172), Expect = 8e-18
 Identities = 24/40 (60%), Positives = 30/40 (75%)

Query: 30 GQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69
          G+ LGIS+HKGY F+QF N  DAR+A  GE+GR + GQ L
Sbjct: 26 GKILGISLHKGYGFVQFDNEEDARAAVAGENGREIAGQKL 65


This subfamily corresponds to the RRM in the hnRNP C-related protein family, including hnRNP C proteins, Raly, and Raly-like protein (RALYL). hnRNP C proteins, C1 and C2, are produced by a single coding sequence. They are the major constituents of the heterogeneous nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex in vertebrates. They bind hnRNA tightly, suggesting a central role in the formation of the ubiquitous hnRNP complex; they are involved in the packaging of the hnRNA in the nucleus and in processing of pre-mRNA such as splicing and 3'-end formation. Raly, also termed autoantigen p542, is an RNA-binding protein that may play a critical role in embryonic development. The biological role of RALYL remains unclear. It shows high sequence homology with hnRNP C proteins and Raly. Members of this family are characterized by an N-terminal RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal auxiliary domain. The Raly proteins contain a glycine/serine-rich stretch within the C-terminal regions, which is absent in the hnRNP C proteins. Thus, the Raly proteins represent a newly identified class of evolutionarily conserved autoepitopes. . Length = 68

>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|241049 cd12605, RRM_RALYL, RNA recognition motif in vertebrate RNA-binding Raly-like protein (RALYL) Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 89
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.74
KOG0148|consensus321 99.68
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.67
KOG0131|consensus203 99.64
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.63
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.58
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.58
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.57
KOG0145|consensus 360 99.55
KOG0124|consensus 544 99.55
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.54
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.54
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.52
KOG0117|consensus 506 99.52
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.49
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.47
KOG0110|consensus725 99.46
KOG0123|consensus 369 99.43
KOG0145|consensus360 99.38
KOG0147|consensus549 99.38
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.36
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.36
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.34
KOG0127|consensus 678 99.34
KOG0109|consensus 346 99.24
KOG0123|consensus 369 99.2
KOG0147|consensus 549 99.08
KOG0106|consensus216 99.07
smart0036170 RRM_1 RNA recognition motif. 99.04
KOG0125|consensus 376 99.02
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.01
KOG0144|consensus 510 99.0
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.95
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.93
KOG0127|consensus 678 98.93
KOG0120|consensus500 98.91
KOG4207|consensus 256 98.89
KOG0148|consensus 321 98.86
smart0036170 RRM_1 RNA recognition motif. 98.85
KOG0146|consensus371 98.83
KOG0111|consensus 298 98.77
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.75
KOG0107|consensus195 98.74
KOG0144|consensus510 98.72
PLN03120 260 nucleic acid binding protein; Provisional 98.67
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.65
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.64
KOG0125|consensus 376 98.62
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.6
KOG0111|consensus 298 98.52
smart0036071 RRM RNA recognition motif. 98.49
KOG0105|consensus241 98.48
KOG4207|consensus 256 98.47
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.45
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.44
KOG0107|consensus195 98.43
KOG0113|consensus 335 98.43
smart0036272 RRM_2 RNA recognition motif. 98.42
KOG1548|consensus382 98.41
KOG0131|consensus 203 98.35
PLN03213 759 repressor of silencing 3; Provisional 98.35
PLN03121 243 nucleic acid binding protein; Provisional 98.34
KOG0122|consensus270 98.28
KOG0122|consensus270 98.26
smart0036071 RRM RNA recognition motif. 98.25
KOG0121|consensus153 98.23
KOG0130|consensus170 98.22
KOG0124|consensus 544 98.17
smart0036272 RRM_2 RNA recognition motif. 98.17
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.14
KOG0121|consensus153 98.12
KOG4208|consensus214 98.12
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.11
KOG0110|consensus 725 98.1
KOG4206|consensus221 98.1
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.09
KOG0108|consensus 435 98.07
KOG4205|consensus 311 98.06
KOG0226|consensus290 98.02
KOG0149|consensus 247 97.98
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.97
KOG4208|consensus214 97.97
KOG4212|consensus 608 97.95
KOG0113|consensus 335 97.95
PLN03120 260 nucleic acid binding protein; Provisional 97.92
COG0724306 RNA-binding proteins (RRM domain) [General functio 97.83
KOG0130|consensus170 97.83
KOG0109|consensus 346 97.8
KOG0108|consensus 435 97.74
KOG4211|consensus 510 97.71
KOG0126|consensus219 97.71
KOG0120|consensus 500 97.71
KOG0117|consensus 506 97.67
KOG0114|consensus124 97.66
PLN03213 759 repressor of silencing 3; Provisional 97.62
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.62
KOG4206|consensus 221 97.59
KOG0126|consensus219 97.59
KOG1190|consensus492 97.55
KOG4661|consensus 940 97.54
KOG4212|consensus 608 97.53
KOG0226|consensus290 97.51
KOG1457|consensus 284 97.45
KOG0105|consensus 241 97.39
KOG0146|consensus371 97.35
KOG0149|consensus 247 97.26
PLN03121 243 nucleic acid binding protein; Provisional 97.21
KOG0114|consensus124 97.03
KOG0106|consensus 216 97.02
KOG4209|consensus231 96.86
KOG1190|consensus 492 96.75
KOG2202|consensus260 96.65
KOG0132|consensus 894 96.61
KOG1456|consensus 494 96.54
KOG1457|consensus 284 96.52
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 96.42
KOG0415|consensus 479 96.41
KOG0132|consensus 894 96.39
KOG1996|consensus378 96.27
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.27
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.14
KOG0415|consensus 479 95.91
KOG1456|consensus494 95.86
KOG4209|consensus231 95.83
KOG0153|consensus377 95.7
KOG0533|consensus243 95.46
KOG4661|consensus 940 95.41
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 95.38
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.36
KOG0151|consensus 877 95.11
KOG2314|consensus 698 94.99
KOG1365|consensus 508 94.79
KOG4210|consensus285 94.75
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 94.64
KOG4454|consensus267 94.49
KOG4660|consensus 549 94.22
KOG4211|consensus 510 94.18
KOG4454|consensus 267 93.98
KOG2314|consensus 698 93.86
KOG1548|consensus 382 93.81
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 93.66
KOG0128|consensus881 93.59
KOG4307|consensus944 93.49
KOG4205|consensus 311 93.48
KOG4660|consensus 549 93.01
KOG0153|consensus377 92.86
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 92.67
KOG0116|consensus419 92.03
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 91.51
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 91.3
KOG2193|consensus 584 90.66
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.48
KOG0533|consensus243 89.37
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.3
KOG1996|consensus378 89.01
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 88.88
KOG2202|consensus260 88.35
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.57
KOG1995|consensus 351 87.13
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 86.73
KOG0151|consensus 877 86.45
PF1182373 DUF3343: Protein of unknown function (DUF3343); In 85.51
KOG1365|consensus 508 85.24
PF1182373 DUF3343: Protein of unknown function (DUF3343); In 84.77
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 81.88
KOG4307|consensus944 81.25
KOG2068|consensus 327 80.58
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
Probab=99.74  E-value=2.1e-17  Score=125.55  Aligned_cols=84  Identities=26%  Similarity=0.377  Sum_probs=72.3

Q ss_pred             cceeEEEEecCHHHHHHHHhhcCCceecCeEeEEEc--------------------------------------------
Q psy4383           2 HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISM--------------------------------------------   37 (89)
Q Consensus         2 ~~Gf~fV~f~~~~~a~~Ai~~l~g~~l~g~~i~v~~--------------------------------------------   37 (89)
                      ++|||||+|.+.++|+.|+..|||..+.|+.|+|+.                                            
T Consensus       148 skGfAFVeF~s~e~A~~Ai~~lnG~~i~GR~IkV~rp~~~p~a~~~~~~~~~~~~~~~rLfVgnLp~~vteedLk~lFs~  227 (612)
T TIGR01645       148 HKGFAFVEYEVPEAAQLALEQMNGQMLGGRNIKVGRPSNMPQAQPIIDMVQEEAKKFNRIYVASVHPDLSETDIKSVFEA  227 (612)
T ss_pred             cCCeEEEEeCcHHHHHHHHHhcCCeEEecceeeecccccccccccccccccccccccceEEeecCCCCCCHHHHHHHHhh
Confidence            689999999999999999999999999999888741                                            


Q ss_pred             -----------------ccCeEEEEeCCHHHHHHHHHhcCCceecCeEEEEEeeeeecceeccCC
Q psy4383          38 -----------------HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKLQYYNGCRYVSP   85 (89)
Q Consensus        38 -----------------~rG~afV~F~~~~~a~~Ai~~l~g~~l~gr~i~~~~~~~~~~~~~~~~   85 (89)
                                       +||||||+|+++++|.+||.+|||..|+|+.|++...---+...+.|.
T Consensus       228 FG~I~svrl~~D~~tgksKGfGFVeFe~~e~A~kAI~amNg~elgGr~LrV~kAi~pP~~~~~pa  292 (612)
T TIGR01645       228 FGEIVKCQLARAPTGRGHKGYGFIEYNNLQSQSEAIASMNLFDLGGQYLRVGKCVTPPDALLQPA  292 (612)
T ss_pred             cCCeeEEEEEecCCCCCcCCeEEEEECCHHHHHHHHHHhCCCeeCCeEEEEEecCCCccccCCCC
Confidence                             689999999999999999999999999999998765543333444333



In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.

>KOG0148|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PF11823 DUF3343: Protein of unknown function (DUF3343); InterPro: IPR021778 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>PF11823 DUF3343: Protein of unknown function (DUF3343); InterPro: IPR021778 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
1wf1_A110 Solution Structure Of Rrm Domain In Rna-Binding Pro 9e-09
1wf2_A98 Solution Structure Of Rrm Domain In Hnrpc Protein L 4e-08
>pdb|1WF1|A Chain A, Solution Structure Of Rrm Domain In Rna-Binding Protein Np_057951 Length = 110 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 24/40 (60%), Positives = 31/40 (77%) Query: 30 GQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69 G+ G S+HKGYAF+Q+SN AR+A LGE+GR + GQTL Sbjct: 53 GRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTL 92
>pdb|1WF2|A Chain A, Solution Structure Of Rrm Domain In Hnrpc Protein Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query89
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-11
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-09
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 5e-09
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-09
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 3e-08
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-06
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 1e-05
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-06
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-05
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 9e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-06
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-06
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 6e-06
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-04
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 9e-04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-04
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-05
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-05
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-05
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-05
1x5p_A97 Negative elongation factor E; structure genomics, 4e-05
1x5p_A97 Negative elongation factor E; structure genomics, 6e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-05
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-05
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 6e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-05
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 8e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 8e-05
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-04
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-04
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-04
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-04
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-04
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 5e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 3e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-04
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-04
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-04
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-04
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-04
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
 Score = 53.9 bits (130), Expect = 3e-11
 Identities = 24/40 (60%), Positives = 31/40 (77%)

Query: 30 GQTLGISMHKGYAFIQFSNPHDARSACLGEDGRTVLGQTL 69
          G+  G S+HKGYAF+Q+SN   AR+A LGE+GR + GQTL
Sbjct: 53 GRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTL 92


>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.76
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.76
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.76
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.74
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.73
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.72
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.71
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.7
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.66
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.66
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.64
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.62
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.6
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.6
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.6
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.6
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.59
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.59
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.57
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.57
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.54
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.5
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.31
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.16
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.15
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.14
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.1
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.1
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.1
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.07
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.07
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.06
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.05
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.04
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.04
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.03
1x5p_A97 Negative elongation factor E; structure genomics, 99.03
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.03
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.03
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.03
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.01
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.01
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.01
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.01
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.0
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.0
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.0
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.0
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.99
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.99
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.98
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.98
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.98
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.98
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.97
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.96
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.96
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.96
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.96
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.96
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.95
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.95
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.95
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.94
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.94
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.94
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.94
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.94
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.94
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.93
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.93
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.93
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.93
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.93
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.92
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.92
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.92
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.92
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.91
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.9
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.9
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.9
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.9
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.9
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.9
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.89
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.89
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.89
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.89
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.89
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.89
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.88
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.88
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.88
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.88
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.88
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.88
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.87
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.87
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.87
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.86
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.86
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.86
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.86
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.86
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.85
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.85
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.85
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.85
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.85
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.85
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.85
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.84
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.84
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.84
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.84
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.84
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.84
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.83
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.83
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.83
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.83
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.83
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.83
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.83
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.83
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.82
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.82
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.82
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.81
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.81
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.81
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.81
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.81
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.81
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.81
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.81
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.8
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.8
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.8
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.8
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.8
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.8
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.8
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.8
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.79
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.79
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.79
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.79
2div_A99 TRNA selenocysteine associated protein; structural 98.79
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.79
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.79
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.78
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.78
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.78
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.78
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.78
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.77
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.77
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.77
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.77
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.76
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.76
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.76
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.76
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.76
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.76
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.76
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.76
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.75
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.75
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.75
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.75
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.75
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.75
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.75
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.74
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.74
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.74
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.74
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.74
1x5p_A97 Negative elongation factor E; structure genomics, 98.74
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.74
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.74
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.73
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.73
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.73
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.73
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.72
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.72
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.72
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.72
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.72
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.71
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.71
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.71
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.71
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.71
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.71
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.71
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.7
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.7
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.7
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.7
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.7
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.7
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.7
2dis_A109 Unnamed protein product; structural genomics, RRM 98.7
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.7
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.69
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.69
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.68
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.67
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.67
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.67
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.67
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.67
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.66
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.66
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.66
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.66
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.65
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.65
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.65
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.65
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.64
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.64
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.64
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.64
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.64
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.64
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.64
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.64
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.64
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.64
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.63
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.63
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.63
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.63
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.63
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.62
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.62
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.62
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.62
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.62
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.62
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.62
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.61
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.61
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.61
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.61
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.61
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.61
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.6
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.6
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.6
2div_A99 TRNA selenocysteine associated protein; structural 98.6
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.6
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.59
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.59
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.59
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.58
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.58
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.58
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.58
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.58
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.57
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.57
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.57
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.57
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.57
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.57
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.57
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.57
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.56
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.56
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.56
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.56
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.56
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.55
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.55
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.55
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.54
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.54
2dis_A109 Unnamed protein product; structural genomics, RRM 98.54
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.54
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.54
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.54
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.54
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.54
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.53
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.53
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.53
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.53
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.52
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.52
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.52
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.52
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.51
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.51
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.5
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.5
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.5
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.5
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.49
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.48
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.47
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.46
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.83
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.45
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.45
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.45
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.44
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.43
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.43
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.43
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.42
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.41
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.41
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.41
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.39
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.39
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.39
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.39
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.38
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.38
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.37
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.37
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.36
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 98.36
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.35
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.35
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.34
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.34
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.34
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.33
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.32
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.28
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.28
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.25
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.24
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.24
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.24
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.21
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.19
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.18
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.16
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.14
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.13
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.12
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.1
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.07
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.88
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 97.86
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 97.63
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.53
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.21
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 95.48
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 95.45
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 95.25
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 94.32
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.69
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 91.89
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 87.85
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 86.94
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
Probab=99.76  E-value=2.9e-18  Score=113.61  Aligned_cols=73  Identities=25%  Similarity=0.413  Sum_probs=67.6

Q ss_pred             cceeEEEEecCHHHHHHHHhhcCCceecCeEeEEEc--------------------------------------------
Q psy4383           2 HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISM--------------------------------------------   37 (89)
Q Consensus         2 ~~Gf~fV~f~~~~~a~~Ai~~l~g~~l~g~~i~v~~--------------------------------------------   37 (89)
                      ++|||||+|.+.++|+.|+..+++..+.|+.+.+.+                                            
T Consensus        56 ~~G~afV~F~~~~~A~~Ai~~~~~~~~~g~~i~~~~~~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~~~i  135 (213)
T 4f02_A           56 SLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKV  135 (213)
T ss_dssp             EEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCCCTHHHHHCTTEEEEESCCTTCCHHHHHHHHGGGSCEEEEEE
T ss_pred             ccccccceeCCHHHHHHHHHHhhhhhcCCcccccccccccccccccccccceECCcccccHHHHHHHHHhhcCCeEEEEe
Confidence            579999999999999999999999999999888762                                            


Q ss_pred             ------ccCeEEEEeCCHHHHHHHHHhcCCceecCeEEEEEee
Q psy4383          38 ------HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYKL   74 (89)
Q Consensus        38 ------~rG~afV~F~~~~~a~~Ai~~l~g~~l~gr~i~~~~~   74 (89)
                            ++|||||+|.++++|++||+.|||..|+|++|.+...
T Consensus       136 ~~d~~~~~g~~fV~f~~~~~a~~Ai~~lng~~~~g~~i~V~~a  178 (213)
T 4f02_A          136 VCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRF  178 (213)
T ss_dssp             EEETTEEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEEC
T ss_pred             eccCCCCceEEEEEeCCHHHHHHHHHHhCCCEECCEEEEEEEc
Confidence                  6899999999999999999999999999999987554



>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 89
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-06
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-04
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.003
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 0.004
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 0.004
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 0.004
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: HIV Tat-specific factor 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.7 bits (95), Expect = 1e-06
 Identities = 15/66 (22%), Positives = 24/66 (36%), Gaps = 10/66 (15%)

Query: 21 LGEDGRTVLGQTLGIS-------MHKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYK 73
          + ED R    +   I           G A + F +P +A       DGR   G+ +    
Sbjct: 32 IREDLRVECSKFGQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQI---T 88

Query: 74 LQYYNG 79
           Q ++G
Sbjct: 89 AQAWDG 94


>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.44
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.34
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.23
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.13
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.1
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.1
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.09
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.08
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.07
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.07
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.06
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.06
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.06
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.04
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.04
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.02
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.02
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.02
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.02
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.01
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.01
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.01
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.01
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.01
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.0
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.0
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.0
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.99
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.99
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.99
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.99
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.98
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.98
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.98
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.98
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.97
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.96
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.96
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.96
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.95
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.95
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.95
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.95
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.94
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.94
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.94
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.94
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.93
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.93
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.92
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.92
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.92
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.92
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.91
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.91
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.91
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.91
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.91
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.91
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.9
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.89
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.88
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.88
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.88
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.88
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.88
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.88
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.87
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.87
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.87
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.87
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.87
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.87
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.87
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.86
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.86
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.85
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.84
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.84
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.83
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.83
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.83
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.83
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.82
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.82
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.82
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.82
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.82
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.81
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.81
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.8
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.8
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.8
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.8
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.8
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.79
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.79
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.78
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.77
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.77
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.76
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.76
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.76
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.76
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.76
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.75
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.75
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.75
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.73
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.73
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.73
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.73
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.72
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.72
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.69
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.69
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.68
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.68
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.67
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.66
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.66
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.64
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.64
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.63
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.63
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.63
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.62
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.61
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.61
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.6
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.6
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.59
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.59
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.58
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.58
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.58
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.57
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.56
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.56
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.55
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.55
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.54
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.53
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.53
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.53
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.52
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.47
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.47
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.45
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.41
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.4
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.39
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.36
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.34
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.31
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.3
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.29
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.25
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.24
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.2
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.17
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.09
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.06
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.57
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.88
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 94.71
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 94.32
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 94.19
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.44  E-value=3.2e-13  Score=85.40  Aligned_cols=70  Identities=19%  Similarity=0.388  Sum_probs=58.9

Q ss_pred             cceeEEEEecCHHHHHHHHhhcCCceecCeEeEEEc--------------------------------------------
Q psy4383           2 HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLGISM--------------------------------------------   37 (89)
Q Consensus         2 ~~Gf~fV~f~~~~~a~~Ai~~l~g~~l~g~~i~v~~--------------------------------------------   37 (89)
                      ++|||||+|.+.++|+.|+. +++..+.++.+.+..                                            
T Consensus        47 ~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~  125 (183)
T d1u1qa_          47 SRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIE  125 (183)
T ss_dssp             EEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEE
T ss_pred             ccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCcee
Confidence            57999999999999999998 556666666555431                                            


Q ss_pred             ------------ccCeEEEEeCCHHHHHHHHHhcCCceecCeEEEEEe
Q psy4383          38 ------------HKGYAFIQFSNPHDARSACLGEDGRTVLGQTLVSYK   73 (89)
Q Consensus        38 ------------~rG~afV~F~~~~~a~~Ai~~l~g~~l~gr~i~~~~   73 (89)
                                  ++|||||+|.++++|++||. +++..+.|++|.+..
T Consensus       126 ~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~  172 (183)
T d1u1qa_         126 VIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRK  172 (183)
T ss_dssp             EEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEETTEEEEEEE
T ss_pred             eeeeecccccCccceeEEEEECCHHHHHHHHH-hCCCeECCEEEEEEe
Confidence                        67899999999999999997 899999999997653



>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure