Psyllid ID: psy4399

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNHYQTVD
ccccccHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHcccccccccccccEEEEEEEcccccEEEEEEEEEccEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccEEEEEEcccEEEEEcccccccccccccccccEEEEEEcccccccc
HHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccccccccEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHccEEEEEcHHHHcHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccEcccccccHHHHHHHHHHHHHcccccHHHHHHHHHccccccccEEEEccccccHcHHccccccccccccEEEEEccccccccccccccccccccccc
MVLTKMKETAEAYLGKTVSNAVItvpayfndsqrqatkdsgtiaGLNVLRIINEPTAAAIAYGLdkkvgsaagsgerNVLIFDlgggtfdvsILTIEDGIFEvkstagdthlggedfdnRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRtlssstqasiEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFfngkelnksinpdvttLCWSVAQPVQKLLQDFfngkelnksinpdeAVAYGAAVQAAILhgdkseevQDLLLldvtpqlawrsfkndsygvdIDTIMNNLAIKIPLQQVKNTVEELINEghiyttiddnhyqtvd
MVLTKMKETAEaylgktvsnaVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFkrkykkdlttnkralRRLRTACErakrtlssstqasieidslfegvdfyTSVTRARLSVTRARFEelnadlfrgtmePVEKSLRDAKMDKAQIHDIvlvggstriPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEghiyttiddnhyqtvd
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEavaygaavqaaILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNHYQTVD
***********AYLGKTVSNAVITVPAYFNDS******DSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTAC*************SIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTM************DKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNH*****
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNHYQ***
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACE***********ASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNHYQTVD
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKV***AGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELIN*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNTVEELINEGHIYTTIDDNHYQTVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q9U639 652 Heat shock 70 kDa protein N/A N/A 0.730 0.424 0.841 1e-149
Q9W6Y1 686 Heat shock cognate 71 kDa N/A N/A 0.730 0.403 0.803 1e-143
P08108 651 Heat shock cognate 70 kDa N/A N/A 0.730 0.425 0.794 1e-142
Q71U34 646 Heat shock cognate 71 kDa N/A N/A 0.730 0.428 0.791 1e-142
P11142 646 Heat shock cognate 71 kDa yes N/A 0.730 0.428 0.791 1e-142
A2Q0Z1 646 Heat shock cognate 71 kDa yes N/A 0.730 0.428 0.791 1e-142
P19120 650 Heat shock cognate 71 kDa yes N/A 0.730 0.426 0.791 1e-142
P63018 646 Heat shock cognate 71 kDa yes N/A 0.730 0.428 0.791 1e-142
P63017 646 Heat shock cognate 71 kDa yes N/A 0.730 0.428 0.791 1e-142
P11147 651 Heat shock 70 kDa protein yes N/A 0.730 0.425 0.800 1e-141
>sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 Back     alignment and function desciption
 Score =  528 bits (1359), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 270/321 (84%), Positives = 275/321 (85%), Gaps = 44/321 (13%)

Query: 1   MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
           MVLTKMKETAEAYLGKTV NAVITVPAYFNDSQRQATKD+GTI+GLNVLRIINEPTAAAI
Sbjct: 122 MVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 181

Query: 61  AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
           AYGLDKK     GSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR
Sbjct: 182 AYGLDKK-----GSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 236

Query: 121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
           MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEG+DFYT 
Sbjct: 237 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYT- 295

Query: 181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
                 S+TRARFEELNADLFR TMEPVEKSLRDAKMDK+QIHDIVLVGGSTRIPKVQKL
Sbjct: 296 ------SITRARFEELNADLFRSTMEPVEKSLRDAKMDKSQIHDIVLVGGSTRIPKVQKL 349

Query: 241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 300
           LQDFFNGKELNKSI                                NPDEAVAYGAAVQA
Sbjct: 350 LQDFFNGKELNKSI--------------------------------NPDEAVAYGAAVQA 377

Query: 301 AILHGDKSEEVQDLLLLDVTP 321
           AILHGDKSEEVQDLLLLDVTP
Sbjct: 378 AILHGDKSEEVQDLLLLDVTP 398

Manduca sexta (taxid: 7130)
>sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 Back     alignment and function description
>sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 Back     alignment and function description
>sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 Back     alignment and function description
>sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 Back     alignment and function description
>sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 Back     alignment and function description
>sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 Back     alignment and function description
>sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 Back     alignment and function description
>sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 Back     alignment and function description
>sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
12585261 652 RecName: Full=Heat shock 70 kDa protein 0.730 0.424 0.841 1e-147
242003741 660 Heat shock 70 kDa protein cognate, putat 0.736 0.422 0.844 1e-147
291419607 652 heat shock protein 70 [Chilo suppressali 0.730 0.424 0.841 1e-147
378760814 650 Hsc70 [Plutella xylostella] 0.730 0.426 0.841 1e-147
256862214 635 heat shock protein 70 cognate [Helicover 0.730 0.436 0.838 1e-147
124100014 653 heat shock protein 70 [Dendrolimus super 0.730 0.424 0.841 1e-147
112982828 649 heat shock cognate protein [Bombyx mori] 0.730 0.426 0.838 1e-147
357613212 653 Heat shock 70 kDa protein cognate 4 [Dan 0.730 0.424 0.838 1e-147
82941224 626 heat shock cognate 70 [Plutella xylostel 0.730 0.442 0.841 1e-147
124108394 653 heat shock protein 70 [Dendrolimus punct 0.730 0.424 0.841 1e-147
>gi|12585261|sp|Q9U639.1|HSP7D_MANSE RecName: Full=Heat shock 70 kDa protein cognate 4; Short=Hsc 70-4 gi|6457366|gb|AAF09496.1|AF194819_1 heat shock cognate 70 protein [Manduca sexta] Back     alignment and taxonomy information
 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 270/321 (84%), Positives = 275/321 (85%), Gaps = 44/321 (13%)

Query: 1   MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
           MVLTKMKETAEAYLGKTV NAVITVPAYFNDSQRQATKD+GTI+GLNVLRIINEPTAAAI
Sbjct: 122 MVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAI 181

Query: 61  AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
           AYGLDKK     GSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR
Sbjct: 182 AYGLDKK-----GSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 236

Query: 121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
           MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEG+DFYT 
Sbjct: 237 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYT- 295

Query: 181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
                 S+TRARFEELNADLFR TMEPVEKSLRDAKMDK+QIHDIVLVGGSTRIPKVQKL
Sbjct: 296 ------SITRARFEELNADLFRSTMEPVEKSLRDAKMDKSQIHDIVLVGGSTRIPKVQKL 349

Query: 241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 300
           LQDFFNGKELNKSI                                NPDEAVAYGAAVQA
Sbjct: 350 LQDFFNGKELNKSI--------------------------------NPDEAVAYGAAVQA 377

Query: 301 AILHGDKSEEVQDLLLLDVTP 321
           AILHGDKSEEVQDLLLLDVTP
Sbjct: 378 AILHGDKSEEVQDLLLLDVTP 398

Source: Manduca sexta

Species: Manduca sexta

Genus: Manduca

Family: Sphingidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242003741|ref|XP_002422844.1| Heat shock 70 kDa protein cognate, putative [Pediculus humanus corporis] gi|212505714|gb|EEB10106.1| Heat shock 70 kDa protein cognate, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|291419607|gb|ADE05296.1| heat shock protein 70 [Chilo suppressalis] Back     alignment and taxonomy information
>gi|378760814|gb|AFC38439.1| Hsc70 [Plutella xylostella] Back     alignment and taxonomy information
>gi|256862214|gb|ACV32641.1| heat shock protein 70 cognate [Helicoverpa zea] Back     alignment and taxonomy information
>gi|124100014|gb|ABM90551.1| heat shock protein 70 [Dendrolimus superans] Back     alignment and taxonomy information
>gi|112982828|ref|NP_001036892.1| heat shock cognate protein [Bombyx mori] gi|20563125|dbj|BAB92074.1| heat shock cognate protein [Bombyx mori] gi|320526705|gb|ADW41775.1| heat shock protein 70 [Bombyx mori] Back     alignment and taxonomy information
>gi|357613212|gb|EHJ68380.1| Heat shock 70 kDa protein cognate 4 [Danaus plexippus] Back     alignment and taxonomy information
>gi|82941224|dbj|BAE48743.1| heat shock cognate 70 [Plutella xylostella] Back     alignment and taxonomy information
>gi|124108394|gb|ABM90803.1| heat shock protein 70 [Dendrolimus punctatus] gi|125663923|gb|ABN50911.1| heat shock protein 70 [Dendrolimus punctatus x Dendrolimus tabulaeformis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
ZFIN|ZDB-GENE-040426-1221 647 hsc70 "heat shock cognate 70" 0.646 0.378 0.887 2.6e-117
ZFIN|ZDB-GENE-031217-2 647 hspa8l "heat shock protein 8-l 0.646 0.378 0.871 1.8e-116
UNIPROTKB|F1NRW7 647 HSPA8 "Heat shock cognate 71 k 0.646 0.378 0.871 2.9e-116
UNIPROTKB|F1NWP3 646 HSPA8 "Heat shock cognate 71 k 0.646 0.379 0.871 2.9e-116
UNIPROTKB|P19120 650 HSPA8 "Heat shock cognate 71 k 0.646 0.376 0.871 2.9e-116
UNIPROTKB|E2R0T6 646 HSPA8 "Uncharacterized protein 0.646 0.379 0.871 2.9e-116
UNIPROTKB|P11142 646 HSPA8 "Heat shock cognate 71 k 0.646 0.379 0.871 2.9e-116
UNIPROTKB|A2Q0Z1 646 HSPA8 "Heat shock cognate 71 k 0.646 0.379 0.871 2.9e-116
MGI|MGI:105384 646 Hspa8 "heat shock protein 8" [ 0.646 0.379 0.871 2.9e-116
RGD|621725 646 Hspa8 "heat shock 70kDa protei 0.646 0.379 0.871 2.9e-116
ZFIN|ZDB-GENE-040426-1221 hsc70 "heat shock cognate 70" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1139 (406.0 bits), Expect = 2.6e-117, Sum P(2) = 2.6e-117
 Identities = 228/257 (88%), Positives = 241/257 (93%)

Query:     1 MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
             MVLTKMKE +EAYLGKTVSNAVITVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAI
Sbjct:   122 MVLTKMKEISEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI 181

Query:    61 AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
             AYGLDKKVG     GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR
Sbjct:   182 AYGLDKKVG-----GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 236

Query:   121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
             MVNHF+ EFKRK+KKD+T NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG DFYTS
Sbjct:   237 MVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTS 296

Query:   181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
             +TRAR       FEELNADLFRGT+EPVEK+LRDAKMDKAQIHDIVLVGGSTRIPK+QKL
Sbjct:   297 ITRAR-------FEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKL 349

Query:   241 LQDFFNGKELNKSINPD 257
             LQDFFNG++LNKSINPD
Sbjct:   350 LQDFFNGRDLNKSINPD 366
GO:0005575 "cellular_component" evidence=ND
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
ZFIN|ZDB-GENE-031217-2 hspa8l "heat shock protein 8-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRW7 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWP3 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P19120 HSPA8 "Heat shock cognate 71 kDa protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0T6 HSPA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P11142 HSPA8 "Heat shock cognate 71 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2Q0Z1 HSPA8 "Heat shock cognate 71 kDa protein" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
MGI|MGI:105384 Hspa8 "heat shock protein 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621725 Hspa8 "heat shock 70kDa protein 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5NVM9HSP7C_PONABNo assigned EC number0.78810.73080.4287yesN/A
P09446HSP7A_CAEELNo assigned EC number0.76940.73080.4328yesN/A
O73885HSP7C_CHICKNo assigned EC number0.77570.73080.4287yesN/A
P63018HSP7C_RATNo assigned EC number0.79120.73080.4287yesN/A
P63017HSP7C_MOUSENo assigned EC number0.79120.73080.4287yesN/A
Q90473HSP7C_DANRENo assigned EC number0.78810.73080.4268yesN/A
P19378HSP7C_CRIGRNo assigned EC number0.78810.73080.4287yesN/A
A2Q0Z1HSP7C_HORSENo assigned EC number0.79120.73080.4287yesN/A
P11147HSP7D_DROMENo assigned EC number0.80060.73080.4254yesN/A
P11142HSP7C_HUMANNo assigned EC number0.79120.73080.4287yesN/A
P19120HSP7C_BOVINNo assigned EC number0.79120.73080.4261yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 0.0
PTZ00009 653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 0.0
pfam00012 598 pfam00012, HSP70, Hsp70 protein 1e-166
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-160
PRK00290 627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 1e-146
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 1e-130
TIGR02350 595 TIGR02350, prok_dnaK, chaperone protein DnaK 1e-128
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-125
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslatio 1e-124
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 1e-121
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 1e-113
CHL00094 621 CHL00094, dnaK, heat shock protein 70 1e-110
PTZ00400 663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 1e-109
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-107
PRK13410 668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 1e-104
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-98
PLN03184 673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 2e-96
PRK05183 616 PRK05183, hscA, chaperone protein HscA; Provisiona 2e-95
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 1e-90
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 2e-90
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone H 2e-86
PTZ00186 657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 4e-83
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 7e-82
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 2e-77
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 3e-73
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 2e-71
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 3e-62
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 9e-61
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 6e-57
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 7e-54
PRK01433 595 PRK01433, hscA, chaperone protein HscA; Provisiona 4e-44
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 2e-21
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 2e-14
cd10225320 cd10225, MreB_like, MreB and similar proteins 5e-11
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 2e-09
PRK13930335 PRK13930, PRK13930, rod shape-determining protein 3e-09
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-08
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 4e-08
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 1e-07
pfam08784103 pfam08784, RPA_C, Replication protein A C terminal 2e-07
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 5e-07
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 9e-07
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 3e-06
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 8e-06
COG0849418 COG0849, ftsA, Cell division ATPase FtsA [Cell div 1e-05
PRK13927334 PRK13927, PRK13927, rod shape-determining protein 2e-05
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 1e-04
cd11736468 cd11736, HSPA12B_like_NBD, Nucleotide-binding doma 0.001
PRK13929335 PRK13929, PRK13929, rod-share determining protein 0.001
PRK11678450 PRK11678, PRK11678, putative chaperone; Provisiona 0.001
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information 
 Score =  568 bits (1465), Expect = 0.0
 Identities = 241/304 (79%), Positives = 254/304 (83%), Gaps = 44/304 (14%)

Query: 1   MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
           MVLTKMKE AEAYLGKTV+NAVITVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAI
Sbjct: 117 MVLTKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI 176

Query: 61  AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
           AYGLDKK     G GERNVLIFDLGGGTFDVS+LTIEDGIFEVK+TAGDTHLGGEDFDNR
Sbjct: 177 AYGLDKK-----GGGERNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR 231

Query: 121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
           +VNHFVQEFKRK+KKD++ NKRALRRLRTACERAKRTLSSSTQASIEIDSLFEG+DFYT 
Sbjct: 232 LVNHFVQEFKRKHKKDISGNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYT- 290

Query: 181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
                 S+TRARFEEL ADLFRGT+EPVEK LRDAK+DK+QIHDIVLVGGSTRIPK    
Sbjct: 291 ------SITRARFEELCADLFRGTLEPVEKVLRDAKLDKSQIHDIVLVGGSTRIPK---- 340

Query: 241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 300
                                       VQKLLQDFFNGKELNKSINPDEAVAYGAAVQA
Sbjct: 341 ----------------------------VQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 372

Query: 301 AILH 304
           AIL 
Sbjct: 373 AILS 376

This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|220015 pfam08784, RPA_C, Replication protein A C terminal Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223918 COG0849, ftsA, Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|212686 cd11736, HSPA12B_like_NBD, Nucleotide-binding domain of HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG0100|consensus 663 100.0
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 100.0
PTZ00009 653 heat shock 70 kDa protein; Provisional 100.0
PRK13410 668 molecular chaperone DnaK; Provisional 100.0
PRK13411 653 molecular chaperone DnaK; Provisional 100.0
PLN03184 673 chloroplast Hsp70; Provisional 100.0
PTZ00400 663 DnaK-type molecular chaperone; Provisional 100.0
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 100.0
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 100.0
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 100.0
CHL00094 621 dnaK heat shock protein 70 100.0
PRK05183 616 hscA chaperone protein HscA; Provisional 100.0
KOG0101|consensus 620 100.0
KOG0102|consensus 640 100.0
PRK01433 595 hscA chaperone protein HscA; Provisional 100.0
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
KOG0103|consensus 727 100.0
KOG0104|consensus 902 100.0
PRK11678450 putative chaperone; Provisional 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13927334 rod shape-determining protein MreB; Provisional 100.0
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.98
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.97
PRK13930335 rod shape-determining protein MreB; Provisional 99.97
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.96
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.95
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.91
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.89
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.88
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 99.84
COG4820277 EutJ Ethanolamine utilization protein, possible ch 99.68
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.54
PRK13917344 plasmid segregation protein ParM; Provisional 99.54
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.47
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 99.42
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 99.4
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 99.39
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.27
PTZ00280414 Actin-related protein 3; Provisional 99.24
PTZ00281376 actin; Provisional 99.12
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 99.1
PTZ00004378 actin-2; Provisional 99.1
PF08841332 DDR: Diol dehydratase reactivase ATPase-like domai 99.05
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 99.03
PTZ00466380 actin-like protein; Provisional 99.02
PTZ00452375 actin; Provisional 99.01
KOG0679|consensus426 98.86
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 98.86
PF075201002 SrfB: Virulence factor SrfB; InterPro: IPR009216 T 98.8
COG5277444 Actin and related proteins [Cytoskeleton] 98.48
KOG0797|consensus618 98.32
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 98.31
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 98.19
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 98.15
PRK10719475 eutA reactivating factor for ethanolamine ammonia 98.15
KOG0676|consensus372 98.12
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 98.11
KOG0677|consensus389 98.07
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 98.04
COG44571014 SrfB Uncharacterized protein conserved in bacteria 97.67
PRK13317277 pantothenate kinase; Provisional 97.59
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 97.11
KOG0680|consensus400 96.96
COG1069544 AraB Ribulose kinase [Energy production and conver 96.85
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 96.81
PRK15027484 xylulokinase; Provisional 96.5
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 96.48
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 96.37
PLN02669556 xylulokinase 96.26
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 96.22
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 95.91
KOG2517|consensus516 95.85
PRK00047498 glpK glycerol kinase; Provisional 95.78
PF01968290 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr 95.77
PTZ00294504 glycerol kinase-like protein; Provisional 95.76
TIGR01311493 glycerol_kin glycerol kinase. This model describes 95.69
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 95.69
PRK04123548 ribulokinase; Provisional 95.61
PRK10331470 L-fuculokinase; Provisional 95.52
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 95.49
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 95.39
PF02541285 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I 95.38
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 95.29
COG0533342 QRI7 Metal-dependent proteases with possible chape 95.23
PLN02295512 glycerol kinase 95.19
PRK11031496 guanosine pentaphosphate phosphohydrolase; Provisi 95.16
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 95.04
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 94.79
PRK10640471 rhaB rhamnulokinase; Provisional 94.73
PRK10854513 exopolyphosphatase; Provisional 94.63
KOG2531|consensus545 94.56
PLN02666 1275 5-oxoprolinase 94.53
KOG0681|consensus 645 94.36
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 94.27
TIGR00744318 ROK_glcA_fam ROK family protein (putative glucokin 94.13
PF08735254 DUF1786: Putative pyruvate format-lyase activating 93.51
PF07318343 DUF1464: Protein of unknown function (DUF1464); In 93.48
TIGR03706300 exo_poly_only exopolyphosphatase. It appears that 93.26
PRK03011358 butyrate kinase; Provisional 92.33
PTZ00340345 O-sialoglycoprotein endopeptidase-like protein; Pr 92.05
COG3426358 Butyrate kinase [Energy production and conversion] 91.9
PRK09604332 UGMP family protein; Validated 91.38
COG4012342 Uncharacterized protein conserved in archaea [Func 90.83
PF06277473 EutA: Ethanolamine utilisation protein EutA; Inter 90.77
COG0248492 GppA Exopolyphosphatase [Nucleotide transport and 90.46
PF03702364 UPF0075: Uncharacterised protein family (UPF0075); 90.2
COG0145674 HyuA N-methylhydantoinase A/acetone carboxylase, b 89.79
TIGR03281326 methan_mark_12 putative methanogenesis marker prot 88.78
PRK14878323 UGMP family protein; Provisional 87.9
PLN02920398 pantothenate kinase 1 86.81
PRK00976326 hypothetical protein; Provisional 85.83
PF02543360 CmcH_NodU: Carbamoyltransferase; InterPro: IPR0036 85.79
PF13941457 MutL: MutL protein 84.82
cd0600759 R3H_DEXH_helicase R3H domain of a group of protein 84.12
KOG3108|consensus265 83.27
TIGR00143711 hypF [NiFe] hydrogenase maturation protein HypF. A 83.05
PRK09557301 fructokinase; Reviewed 82.51
PRK05082291 N-acetylmannosamine kinase; Provisional 82.0
COG2441374 Predicted butyrate kinase [Energy production and c 81.11
TIGR00329305 gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami 80.51
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 80.06
>KOG0100|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.9e-68  Score=478.71  Aligned_cols=329  Identities=61%  Similarity=0.918  Sum_probs=307.7

Q ss_pred             ChHHHHHHHHHHHcCCCCCcEEEEcCCCCCHHHHHHHHHHHHHcCCceeeeccchHHHHHHhccccccCCCCCCCCceEE
Q psy4399           1 MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVL   80 (379)
Q Consensus         1 ~iL~~l~~~a~~~~~~~~~~~vitvPa~~~~~~r~~l~~a~~~AGl~~~~lv~Ep~Aaa~~~~~~~~~~~~~~~~~~~vl   80 (379)
                      |+|-++|+.||.|+|.+++++|+|||+||++.||++.++|..+||++++++++||+|||++|+.++..      .+++++
T Consensus       155 MiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKDAGtIAgLnV~RIiNePTaAAIAYGLDKk~------gEknil  228 (663)
T KOG0100|consen  155 MILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDKKD------GEKNIL  228 (663)
T ss_pred             HHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhcccceeccceEEEeecCccHHHHHhcccccC------CcceEE
Confidence            89999999999999999999999999999999999999999999999999999999999999998763      468999


Q ss_pred             EEEcCCceeEEEEEEEeCCeEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHhccCccccHHHHHHHHHHHHHHhhhcCC
Q psy4399          81 IFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSS  160 (379)
Q Consensus        81 VvD~GggT~disv~~~~~~~~~~~~~~~~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~~ls~  160 (379)
                      |+|+||||||+|++.+.+|+|+++++.|+..+||++||+++++|+.+-++++.+.+++++.+++.+|+++||++|+.||+
T Consensus       229 VfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm~~fiklykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSs  308 (663)
T KOG0100|consen  229 VFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSS  308 (663)
T ss_pred             EEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHHHHHHHHHhhhcCCccchhhHHHHHHHHHHHHHHhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeEEEeecccCCcceeeeeecccccccHHHHHHHHHHHhhchhhHHHHHHHHhcCCcCCcCEEEEEcCCCChHHHHHH
Q psy4399         161 STQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL  240 (379)
Q Consensus       161 ~~~~~~~i~~~~~~~~~~~~i~~~~~~ltr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~VvLvGG~sr~p~v~~~  240 (379)
                      +.+..+.++.+++|.||+..++       |..|+++.-+++..++.+++++|+++++.+.+|+.|+||||++|+|.||+.
T Consensus       309 qhq~riEIeS~fdG~DfSEtLt-------RAkFEElNmDLFr~TlkPv~kvl~Ds~lkKsdideiVLVGGsTrIPKvQql  381 (663)
T KOG0100|consen  309 QHQVRIEIESLFDGVDFSETLT-------RAKFEELNMDLFRKTLKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKVQQL  381 (663)
T ss_pred             ccceEEeeeeccccccccchhh-------hhHHHHhhhHHHHHhhHHHHHHHhhcCcccccCceEEEecCcccChhHHHH
Confidence            9999999999999999999999       999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCCcccccccCCCccccccccccchhhhhhhcccCccccCCCChhhHHHhhHHHHHHHHhCCCchhcccceeEeec
Q psy4399         241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVT  320 (379)
Q Consensus       241 l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~aVA~Gaa~~a~~l~~~~~~~~~~~~~~~~~  320 (379)
                      ++++|.+                                +++...+||++|||+|||.+|..|||+  +...+++|+||+
T Consensus       382 lk~fF~G--------------------------------KepskGinPdEAVAYGAAVQaGvlsGe--e~t~divLLDv~  427 (663)
T KOG0100|consen  382 LKDFFNG--------------------------------KEPSKGINPDEAVAYGAAVQAGVLSGE--EDTGDIVLLDVN  427 (663)
T ss_pred             HHHHhCC--------------------------------CCccCCCChHHHHHhhhhhhhcccccc--cCcCcEEEEeec
Confidence            9999976                                788999999999999999999999995  678999999999


Q ss_pred             ccccccccCCCCcccccccccccccccccccccchh-------hhhhhhcCceeeeecCCccccCC
Q psy4399         321 PQLAWRSFKNDSYGVDIDTIMNNLAIKIPLQQVKNT-------VEELINEGHIYTTIDDNHYQTVD  379 (379)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~i~~~~~~~ip~~~~~~~-------~~~~~~~~~~~~t~~~~~~~~~~  379 (379)
                      |+..+...   ..|++.+.|++|+.+|..++|+..+       +-..|+||+.-.|.|++++.+||
T Consensus       428 pLtlGIET---vGGVMTklI~RNTviPTkKSQvFsTa~DnQ~tV~I~vyEGER~mtkdn~lLGkFd  490 (663)
T KOG0100|consen  428 PLTLGIET---VGGVMTKLIPRNTVIPTKKSQVFSTAQDNQPTVTIQVYEGERPMTKDNHLLGKFD  490 (663)
T ss_pred             cccceeee---ecceeeccccCCcccCccccceeeecccCCceEEEEEeecccccccccccccccc
Confidence            99433321   2457788999999888887777665       33457899999999999999886

>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>COG0533 QRI7 Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>KOG2531|consensus Back     alignment and domain information
>PLN02666 5-oxoprolinase Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) Back     alignment and domain information
>PF08735 DUF1786: Putative pyruvate format-lyase activating enzyme (DUF1786); InterPro: IPR014846 This family is annotated as pyruvate formate-lyase activating enzyme (1 Back     alignment and domain information
>PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PTZ00340 O-sialoglycoprotein endopeptidase-like protein; Provisional Back     alignment and domain information
>COG3426 Butyrate kinase [Energy production and conversion] Back     alignment and domain information
>PRK09604 UGMP family protein; Validated Back     alignment and domain information
>COG4012 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03702 UPF0075: Uncharacterised protein family (UPF0075); InterPro: IPR005338 Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>PRK14878 UGMP family protein; Provisional Back     alignment and domain information
>PLN02920 pantothenate kinase 1 Back     alignment and domain information
>PRK00976 hypothetical protein; Provisional Back     alignment and domain information
>PF02543 CmcH_NodU: Carbamoyltransferase; InterPro: IPR003696 The putative O-carbamoyltransferases (O-Cases) encoded by the nodU genes of Rhizobium fredii and Bradyrhizobium japonicum are involved in the synthesis of nodulation factors [] Back     alignment and domain information
>PF13941 MutL: MutL protein Back     alignment and domain information
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases Back     alignment and domain information
>KOG3108|consensus Back     alignment and domain information
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>COG2441 Predicted butyrate kinase [Energy production and conversion] Back     alignment and domain information
>TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-136
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-134
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-133
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 1e-133
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 1e-131
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-130
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-130
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-130
3cqx_A386 Chaperone Complex Length = 386 1e-130
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 1e-130
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 1e-130
1hpm_A386 How Potassium Affects The Activity Of The Molecular 1e-130
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 1e-130
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 1e-130
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 1e-130
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-130
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 1e-130
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-130
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 1e-129
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-129
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-129
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-129
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-129
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-129
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-129
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-129
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-128
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-127
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-126
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-124
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 1e-124
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-124
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 1e-124
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 1e-124
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-124
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 1e-124
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-124
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-123
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-123
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-123
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 1e-121
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 1e-109
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 3e-97
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-95
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 3e-95
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 9e-91
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-86
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 1e-86
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 1e-70
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-70
4b9q_A 605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 2e-68
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 3e-68
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 1e-40
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-40
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 1e-40
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 4e-39
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 1e-31
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 2e-06
1jce_A344 Mreb From Thermotoga Maritima Length = 344 7e-06
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure 
Iteration: 1

 Score =  480 bits (1235), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 243/321 (75%), Positives = 262/321 (81%), Gaps = 44/321 (13%)
Query: 1   MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
           MVLTKMKE AEAYLGKTV+NAV+TVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAI
Sbjct: 122 MVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI 181
Query: 61  AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
           AYGLDKKVG+     ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR
Sbjct: 182 AYGLDKKVGA-----ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 236
Query: 121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
           MVNHF+ EFKRK+KKD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYT 
Sbjct: 237 MVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYT- 295
Query: 181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
                 S+TRARFEELNADLFRGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK+QKL
Sbjct: 296 ------SITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKL 349
Query: 241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEXXXXXXXXXX 300
           LQDFFNGKELNKSINPD      +  Q                                 
Sbjct: 350 LQDFFNGKELNKSINPDEAVAYGAAVQAA------------------------------- 378
Query: 301 XILHGDKSEEVQDLLLLDVTP 321
            IL GDKSE VQDLLLLDVTP
Sbjct: 379 -ILSGDKSENVQDLLLLDVTP 398
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 0.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 0.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 0.0
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 0.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 1e-138
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 1e-138
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 1e-137
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 2e-29
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 3e-19
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 2e-14
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 1e-11
3js6_A355 Uncharacterized PARM protein; partition, segregati 9e-09
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 2e-08
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 5e-07
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 2e-06
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 6e-04
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
 Score =  618 bits (1596), Expect = 0.0
 Identities = 250/321 (77%), Positives = 267/321 (83%), Gaps = 44/321 (13%)

Query: 1   MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAI 60
           MVLTKMKE AEAYLGKTV+NAV+TVPAYFNDSQRQATKD+GTIAGLNVLRIINEPTAAAI
Sbjct: 122 MVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAI 181

Query: 61  AYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNR 120
           AYGLDKK        ERNVLIFDLGGGTFDVSILTI  GIFEVKSTAGDTHLGGEDFDNR
Sbjct: 182 AYGLDKK-----VGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGEDFDNR 236

Query: 121 MVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTS 180
           MVNHF+ EFKRK+KKD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYT 
Sbjct: 237 MVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYT- 295

Query: 181 VTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKL 240
                 S+TRARFEELNADLFRGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK    
Sbjct: 296 ------SITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPK---- 345

Query: 241 LQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 300
                                       +QKLLQDFFNGKELNKSINPDEAVAYGAAVQA
Sbjct: 346 ----------------------------IQKLLQDFFNGKELNKSINPDEAVAYGAAVQA 377

Query: 301 AILHGDKSEEVQDLLLLDVTP 321
           AIL GDKSE VQDLLLLDVTP
Sbjct: 378 AILSGDKSENVQDLLLLDVTP 398
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Length = 270 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Length = 419 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.94
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.93
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.92
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.9
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.88
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.87
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.81
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.67
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.66
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 99.6
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 99.6
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 99.58
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 99.56
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.39
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.26
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 99.04
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 98.58
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 98.36
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 97.73
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 97.72
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 96.58
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 96.53
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 96.46
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 96.41
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 96.4
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 96.26
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 96.24
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 96.13
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 95.97
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 95.91
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 95.86
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 95.86
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 95.83
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 95.76
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 95.71
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 95.71
2w40_A503 Glycerol kinase, putative; closed conformation, ma 95.44
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 95.43
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 95.32
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 95.3
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 94.92
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 94.71
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 94.5
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 94.06
1u6z_A513 Exopolyphosphatase; alpha/beta protein, askha (ace 92.8
3cer_A343 Possible exopolyphosphatase-like protein; NESG, BL 92.79
3ven_A 576 O-carbamoyltransferase TOBZ; antibiotic biosynthes 92.44
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 92.25
3hi0_A508 Putative exopolyphosphatase; 17739545, structural 91.52
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 91.38
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 89.57
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 89.14
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 87.93
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 87.27
2ap1_A327 Putative regulator protein; zinc binding protein, 87.22
4g9i_A772 Hydrogenase maturation protein HYPF; zinc finger, 87.0
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 86.01
3vth_A761 Hydrogenase maturation factor; carbamoyltransfer, 85.78
3aap_A353 Ectonucleoside triphosphate diphosphohydrolase I; 85.22
3qbx_A371 Anhydro-N-acetylmuramic acid kinase; acetate and s 84.04
3n8e_A 182 Stress-70 protein, mitochondrial; beta-sandwich, h 82.73
3ttc_A657 HYPF, transcriptional regulatory protein; Zn finge 82.15
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=100.00  E-value=1.3e-53  Score=432.18  Aligned_cols=289  Identities=55%  Similarity=0.863  Sum_probs=260.9

Q ss_pred             ChHHHHHHHHHHHcCCCCCcEEEEcCCCCCHHHHHHHHHHHHHcCCceeeeccchHHHHHHhccccccCCCCCCCCceEE
Q psy4399           1 MVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVL   80 (379)
Q Consensus         1 ~iL~~l~~~a~~~~~~~~~~~vitvPa~~~~~~r~~l~~a~~~AGl~~~~lv~Ep~Aaa~~~~~~~~~~~~~~~~~~~vl   80 (379)
                      |+|++|++.++.++|.++.++|||||++|++.||+++++|++.||++++++++||+|||++|+.....      .+..++
T Consensus       118 ~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~AGl~v~~li~EP~AAAlaygl~~~~------~~~~vl  191 (605)
T 4b9q_A          118 EVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT------GNRTIA  191 (605)
T ss_dssp             HHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEEHHHHHHHHHHTTSCC------SSEEEE
T ss_pred             HHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcCCceEEEeCcHHHHHHHhhhhccC------CCCEEE
Confidence            58999999999999999999999999999999999999999999999999999999999999877541      468999


Q ss_pred             EEEcCCceeEEEEEEEeC----CeEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHhccCccccHHHHHHHHHHHHHHhh
Q psy4399          81 IFDLGGGTFDVSILTIED----GIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKR  156 (379)
Q Consensus        81 VvD~GggT~disv~~~~~----~~~~~~~~~~~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~  156 (379)
                      |||+||||||+|++++.+    +.++++++.++..+||++||+.|.+++.+++.++++.+...+++.+.+|+.+||++|+
T Consensus       192 V~DlGGGT~Dvsi~~~~~~~~~~~~evla~~gd~~lGG~d~D~~l~~~l~~~f~~~~~~~~~~~~~~~~~L~~~aE~~K~  271 (605)
T 4b9q_A          192 VYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKI  271 (605)
T ss_dssp             EEEECSSCEEEEEEEEEESSSCEEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHTCCCGGGCHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCeEEEEEEEEecCCCCceEEEEEecCCCCcChHHHHHHHHHHHHHHHhhhcCCCcccCHHHHHHHHHHHHHHHH
Confidence            999999999999999987    8999999999999999999999999999999999998888899999999999999999


Q ss_pred             hcCCCceeEEEeecccCC----cceeeeeecccccccHHHHHHHHHHHhhchhhHHHHHHHHhcCCcCCcCEEEEEcCCC
Q psy4399         157 TLSSSTQASIEIDSLFEG----VDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGST  232 (379)
Q Consensus       157 ~ls~~~~~~~~i~~~~~~----~~~~~~i~~~~~~ltr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~VvLvGG~s  232 (379)
                      .||......+.++.+..+    .++...++       |++|+++++++++++..+++++|+++++...+|+.|+||||+|
T Consensus       272 ~Ls~~~~~~i~~~~~~~~~~g~~~~~~~it-------r~~~e~l~~~~~~~i~~~v~~~L~~a~~~~~~i~~VvLvGG~s  344 (605)
T 4b9q_A          272 ELSSAQQTDVNLPYITADATGPKHMNIKVT-------RAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQT  344 (605)
T ss_dssp             HTTTCSEEEEEEEEEEECSSSEEEEEEEEE-------HHHHHHHHHHHHHHTTHHHHHHHHHTTCCGGGCSEEEEESGGG
T ss_pred             hcCcCCCeEEEEeeeccCCCCCeeEEEEEe-------HHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCcEEEEeCCcc
Confidence            999999888887765433    34444455       9999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHHHcCCcccccccCCCccccccccccchhhhhhhcccCccccCCCChhhHHHhhHHHHHHHHhCCCchhcc
Q psy4399         233 RIPKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQ  312 (379)
Q Consensus       233 r~p~v~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~aVA~Gaa~~a~~l~~~~~~~~~  312 (379)
                      ++|+|++.|++.|+                                 .++..+.||++|||+|||++|+.++|.    .+
T Consensus       345 riP~v~~~l~~~fg---------------------------------~~~~~~~nPdeaVA~GAai~a~~l~~~----~~  387 (605)
T 4b9q_A          345 RMPMVQKKVAEFFG---------------------------------KEPRKDVNPDEAVAIGAAVQGGVLTGD----VK  387 (605)
T ss_dssp             GSHHHHHHHHHHHT---------------------------------SCCCSSSCTTTHHHHHHHHHHHHHHTS----SC
T ss_pred             CchHHHHHHHHHhc---------------------------------cCcCCCcChhHHHHHhHHHHHHHhcCC----CC
Confidence            99999999999997                                 467778899999999999999999985    57


Q ss_pred             cceeEeecccccccccCCCCccccc------ccccccccccccc
Q psy4399         313 DLLLLDVTPQLAWRSFKNDSYGVDI------DTIMNNLAIKIPL  350 (379)
Q Consensus       313 ~~~~~~~~~~~~~~~~~~~~~~~~~------~~i~~~~~~~ip~  350 (379)
                      +++++||+|+         +||++.      ..|++|+  ++|.
T Consensus       388 ~~~l~dv~p~---------slgie~~~g~~~~ii~rnt--~iP~  420 (605)
T 4b9q_A          388 DVLLLDVTPL---------SLGIETMGGVMTTLIAKNT--TIPT  420 (605)
T ss_dssp             SEEEECBCSS---------CEEEEETTTEEEEEECTTC--BSSE
T ss_pred             ceEEEeeeee---------EEEEEEcCCEEEEEEeCCC--cCCc
Confidence            8999999999         666553      3555666  4554
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>3ven_A O-carbamoyltransferase TOBZ; antibiotic biosynthesis, substrate assisted catalysis, subst channeling, adenylation; HET: TLA; 1.57A {Streptoalloteichus tenebrarius} PDB: 3veo_A 3ves_A* 3vet_A* 3vew_A* 3ver_A* 3vf4_A* 3vf2_A* 3vex_A* 3vez_A* Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis} Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>3vth_A Hydrogenase maturation factor; carbamoyltransfer, maturation of [NIFE]-hydrogenase, carbamoylphosphate, iron, HYPE; HET: APC AP2; 2.00A {Thermoanaerobacter tengcongensis} PDB: 3vti_A Back     alignment and structure
>3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A* Back     alignment and structure
>3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>3ttc_A HYPF, transcriptional regulatory protein; Zn finger, nucleotide binding, hydrogenase maturation factor transferase; HET: ADP; 1.86A {Escherichia coli} PDB: 3tsp_A* 3tsu_A* 3ttf_A* 3ttd_A 3tsq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 8e-82
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 5e-81
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 2e-32
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 1e-30
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 6e-27
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 2e-22
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 4e-18
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 7e-18
d1dpua_69 a.4.5.16 (A:) C-terminal domain of RPA32 {Human (H 6e-11
d1e4ft2191 c.55.1.1 (T:200-390) Cell division protein FtsA {T 2e-04
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  246 bits (629), Expect = 8e-82
 Identities = 173/229 (75%), Positives = 187/229 (81%), Gaps = 39/229 (17%)

Query: 75  GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 134
            ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+K
Sbjct: 3   AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHK 62

Query: 135 KDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFE 194
           KD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYT       S+TRARFE
Sbjct: 63  KDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYT-------SITRARFE 115

Query: 195 ELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSI 254
           ELNADLFRGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK                  
Sbjct: 116 ELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPK------------------ 157

Query: 255 NPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL 303
                         +QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL
Sbjct: 158 --------------IQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAIL 192
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.87
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 99.69
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.63
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.58
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.56
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 99.47
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.4
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 98.79
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 98.77
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 98.44
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.25
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 98.2
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 98.03
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 97.8
d1yuwa1 159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 96.47
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 96.34
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 96.28
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 96.18
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 94.63
d1t6ca2180 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 93.65
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 93.12
d1u6za3177 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 91.8
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 91.24
d2ap1a1186 Putative regulator protein YcfX {Salmonella typhim 90.94
d2hoea2169 N-acetylglucosamine kinase {Thermotoga maritima [T 90.37
d2aa4a2170 N-acetylmannosamine kinase NanK {Escherichia coli 89.85
d1z05a2197 Transcriptional regulator VC2007 {Vibrio cholerae 89.15
d2gupa2175 Hypothetical protein SP2142 {Streptococcus pneumon 87.73
d1xc3a2176 Putative fructokinase YhdR {Bacillus subtilis [Tax 83.95
d2ch5a1227 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 82.96
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=2.7e-39  Score=279.71  Aligned_cols=191  Identities=91%  Similarity=1.318  Sum_probs=180.2

Q ss_pred             CCceEEEEEcCCceeEEEEEEEeCCeEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHhccCccccHHHHHHHHHHHHHH
Q psy4399          75 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERA  154 (379)
Q Consensus        75 ~~~~vlVvD~GggT~disv~~~~~~~~~~~~~~~~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~~L~~~~e~~  154 (379)
                      .+++|||||+||||||+|++++.++.++++++.++..+||++||+.|++++.+++.++++.+...+++.+.+|+.+||++
T Consensus         3 ~e~~VlV~D~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~~D~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~   82 (193)
T d1bupa2           3 AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERA   82 (193)
T ss_dssp             SCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHHSCCCTTCHHHHHHHHHHHHHH
T ss_pred             CCcEEEEEEeCCCeEEEEEEEEeCCEEEEEEecCCCCcchhHHHHHHHHHHHHHHHHHhCCCCccCHHHHHHHHHHHHHH
Confidence            46789999999999999999999999999999999999999999999999999999999988999999999999999999


Q ss_pred             hhhcCCCceeEEEeecccCCcceeeeeecccccccHHHHHHHHHHHhhchhhHHHHHHHHhcCCcCCcCEEEEEcCCCCh
Q psy4399         155 KRTLSSSTQASIEIDSLFEGVDFYTSVTRARLSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRI  234 (379)
Q Consensus       155 K~~ls~~~~~~~~i~~~~~~~~~~~~i~~~~~~ltr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~VvLvGG~sr~  234 (379)
                      |+.||.+.++.+.++....+.++...++       |++|+++++|+++++.+.++++|++++..+.+|+.|+|+||+|++
T Consensus        83 K~~ls~~~~~~~~~~~~~~~~~~~~~it-------r~~~e~~~~~~~~~~~~~i~~~l~~~~~~~~~i~~V~lvGG~sr~  155 (193)
T d1bupa2          83 KRTLSSSTQASIEIDSLYEGIDFYTSIT-------RARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRI  155 (193)
T ss_dssp             HHHHTTSSEEEEEEEEEETTEEEEEEEE-------HHHHHHHTHHHHHHTHHHHHHHHHHHTCCGGGCCEEEEESGGGGC
T ss_pred             hhccCCCceEEEEEecccCCCccceEEc-------HHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCCEEEEECCcccc
Confidence            9999999999999988878888877777       999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCcccccccCCCccccccccccchhhhhhhcccCccccCCCChhhHHHhhHHHHHHHHh
Q psy4399         235 PKVQKLLQDFFNGKELNKSINPDVTTLCWSVAQPVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILH  304 (379)
Q Consensus       235 p~v~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~aVA~Gaa~~a~~l~  304 (379)
                      |+|++.|+++|++                                .++..+.||++|||.|||++|++||
T Consensus       156 p~v~~~i~~~f~~--------------------------------~~i~~~~~p~~aVa~GaA~~aa~ls  193 (193)
T d1bupa2         156 PKIQKLLQDFFNG--------------------------------KELNKSINPDEAVAYGAAVQAAILS  193 (193)
T ss_dssp             HHHHHHHHHHTTT--------------------------------CCCBCSSCGGGHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHcCC--------------------------------CCCCCCCChHHHHHHHHHHHHHhhC
Confidence            9999999999975                                5677788999999999999999885
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z05a2 c.55.1.10 (A:209-405) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2gupa2 c.55.1.10 (A:115-289) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xc3a2 c.55.1.10 (A:119-294) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ch5a1 c.55.1.5 (A:118-344) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure