Psyllid ID: psy4562
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 112 | ||||||
| 189235544 | 394 | PREDICTED: similar to actin [Tribolium c | 0.491 | 0.139 | 0.836 | 4e-19 | |
| 347964888 | 395 | AGAP000985-PA [Anopheles gambiae str. PE | 0.491 | 0.139 | 0.818 | 2e-18 | |
| 312383097 | 343 | hypothetical protein AND_03954 [Anophele | 0.491 | 0.160 | 0.818 | 2e-18 | |
| 170028731 | 395 | actin [Culex quinquefasciatus] gi|167877 | 0.491 | 0.139 | 0.818 | 3e-18 | |
| 157130317 | 395 | actin [Aedes aegypti] gi|108871910|gb|EA | 0.491 | 0.139 | 0.818 | 3e-18 | |
| 289740925 | 394 | actin-related protein ARP2/3 complex sub | 0.464 | 0.131 | 0.846 | 3e-18 | |
| 242007573 | 375 | conserved hypothetical protein [Pediculu | 0.491 | 0.146 | 0.781 | 9e-18 | |
| 321474107 | 393 | hypothetical protein DAPPUDRAFT_209234 [ | 0.491 | 0.139 | 0.781 | 1e-17 | |
| 195567126 | 400 | GD15743 [Drosophila simulans] gi|1942045 | 0.455 | 0.127 | 0.843 | 2e-17 | |
| 195447458 | 394 | GK25245 [Drosophila willistoni] gi|19416 | 0.455 | 0.129 | 0.843 | 2e-17 |
| >gi|189235544|ref|XP_001814869.1| PREDICTED: similar to actin [Tribolium castaneum] gi|270003115|gb|EEZ99562.1| hypothetical protein TcasGA2_TC000144 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 98.6 bits (244), Expect = 4e-19, Method: Compositional matrix adjust.
Identities = 46/55 (83%), Positives = 51/55 (92%)
Query: 57 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRA 111
KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMS +EY+E+G+ VL KLG R+
Sbjct: 339 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSKQEYEEQGLKVLKKLGPRS 393
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|347964888|ref|XP_309181.5| AGAP000985-PA [Anopheles gambiae str. PEST] gi|333466524|gb|EAA04899.5| AGAP000985-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312383097|gb|EFR28310.1| hypothetical protein AND_03954 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|170028731|ref|XP_001842248.1| actin [Culex quinquefasciatus] gi|167877933|gb|EDS41316.1| actin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157130317|ref|XP_001655658.1| actin [Aedes aegypti] gi|108871910|gb|EAT36135.1| AAEL011750-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|289740925|gb|ADD19210.1| actin-related protein ARP2/3 complex subunit ARP2 [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|242007573|ref|XP_002424614.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508057|gb|EEB11876.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|321474107|gb|EFX85073.1| hypothetical protein DAPPUDRAFT_209234 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|195567126|ref|XP_002107121.1| GD15743 [Drosophila simulans] gi|194204522|gb|EDX18098.1| GD15743 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195447458|ref|XP_002071223.1| GK25245 [Drosophila willistoni] gi|194167308|gb|EDW82209.1| GK25245 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 112 | ||||||
| ZFIN|ZDB-GENE-050410-4 | 394 | actr2b "ARP2 actin-related pro | 0.571 | 0.162 | 0.640 | 2.3e-19 | |
| FB|FBgn0011742 | 394 | Arp2 "Actin-related protein 2" | 0.455 | 0.129 | 0.843 | 2.2e-18 | |
| UNIPROTKB|F1NRM5 | 378 | ACTR2 "Actin-related protein 2 | 0.571 | 0.169 | 0.656 | 5.1e-18 | |
| UNIPROTKB|F1NHN5 | 393 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| UNIPROTKB|P53488 | 394 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| UNIPROTKB|A7MB62 | 394 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| UNIPROTKB|F1MRG7 | 394 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| UNIPROTKB|P61160 | 394 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| UNIPROTKB|B5APU3 | 394 | ACTR2 "Actin-related protein 2 | 0.571 | 0.162 | 0.656 | 6.1e-18 | |
| MGI|MGI:1913963 | 394 | Actr2 "ARP2 actin-related prot | 0.571 | 0.162 | 0.656 | 6.1e-18 |
| ZFIN|ZDB-GENE-050410-4 actr2b "ARP2 actin-related protein 2b homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 218 (81.8 bits), Expect = 2.3e-19, Sum P(2) = 2.3e-19
Identities = 41/64 (64%), Positives = 50/64 (78%)
Query: 45 DMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVL 104
+ V G KFKIRIEDPPRRK MVF+GGAVLA++MKD+D FW++ +EYQE+GV VL
Sbjct: 327 ERVLKGDVDKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWLTREEYQEKGVRVL 386
Query: 105 SKLG 108
KLG
Sbjct: 387 EKLG 390
|
|
| FB|FBgn0011742 Arp2 "Actin-related protein 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRM5 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHN5 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P53488 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB62 ACTR2 "Actin-related protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MRG7 ACTR2 "Actin-related protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61160 ACTR2 "Actin-related protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5APU3 ACTR2 "Actin-related protein 2-like protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913963 Actr2 "ARP2 actin-related protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 112 | |||
| smart00268 | 373 | smart00268, ACTIN, Actin | 2e-10 | |
| pfam00022 | 367 | pfam00022, Actin, Actin | 1e-08 | |
| PTZ00466 | 380 | PTZ00466, PTZ00466, actin-like protein; Provisiona | 2e-06 | |
| COG5277 | 444 | COG5277, COG5277, Actin and related proteins [Cyto | 9e-06 | |
| PTZ00004 | 378 | PTZ00004, PTZ00004, actin-2; Provisional | 1e-05 | |
| PTZ00281 | 376 | PTZ00281, PTZ00281, actin; Provisional | 2e-05 |
| >gnl|CDD|214592 smart00268, ACTIN, Actin | Back alignment and domain information |
|---|
Score = 55.7 bits (135), Expect = 2e-10
Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
Query: 57 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSK 106
K K+++ PP RK V++GG++LA + D W++ KEY+E G ++ +
Sbjct: 322 KLKVKVIAPPERKYSVWLGGSILASLSTFED-MWITKKEYEESGSQIVER 370
|
ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily. Length = 373 |
| >gnl|CDD|200935 pfam00022, Actin, Actin | Back alignment and domain information |
|---|
| >gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| KOG0676|consensus | 372 | 99.93 | ||
| PTZ00452 | 375 | actin; Provisional | 99.93 | |
| PTZ00466 | 380 | actin-like protein; Provisional | 99.91 | |
| PTZ00281 | 376 | actin; Provisional | 99.91 | |
| PTZ00004 | 378 | actin-2; Provisional | 99.9 | |
| PTZ00280 | 414 | Actin-related protein 3; Provisional | 99.88 | |
| PF00022 | 393 | Actin: Actin; InterPro: IPR004000 Actin [, ] is a | 99.87 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 99.86 | |
| KOG0679|consensus | 426 | 99.81 | ||
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 99.78 | |
| KOG0680|consensus | 400 | 99.77 | ||
| COG5277 | 444 | Actin and related proteins [Cytoskeleton] | 99.76 | |
| KOG0677|consensus | 389 | 99.7 | ||
| KOG0678|consensus | 415 | 99.49 | ||
| KOG0681|consensus | 645 | 99.49 | ||
| KOG0797|consensus | 618 | 98.53 | ||
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 94.43 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 93.87 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 93.71 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 93.4 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 92.73 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 91.94 | |
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 81.12 |
| >KOG0676|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=6.2e-27 Score=188.41 Aligned_cols=90 Identities=29% Similarity=0.479 Sum_probs=82.7
Q ss_pred cccCCCCCCcchh------hhchhcCCccCcCc----eEEecCCCCC----------------CCceEEEecCCCCceee
Q psy4562 19 FGHQPRSPLINYQ------KFKIRIEDPPRRKD----MVFIGGAVLA----------------EKFKIRIEDPPRRKDMV 72 (112)
Q Consensus 19 ~~f~p~~~gi~~~------~~sI~~c~~d~r~~----IvL~GGss~~----------------~~~~v~V~~~~~~~~~a 72 (112)
.+|+|+.+|+... .+||++||+|+|+. |||+||+||+ +..+++|.++|+|.+++
T Consensus 257 ~lFqP~~~g~e~~gi~~~~~~sI~kcd~dlrk~L~~nivLsGGtT~~pGl~~Rl~kEl~~l~P~~~~ikv~~pp~r~~s~ 336 (372)
T KOG0676|consen 257 VLFQPSLLGMESPGIHELTVNSIMKCDIDLRKDLYENIVLSGGTTMFPGLADRLQKELQALAPSTIKIKVIAPPERKYSA 336 (372)
T ss_pred hcCChhhcCCCCCchhHHHHHHHHhCChhHhHHHHhheEEeCCcccchhHHHHHHHHHhhcCCCCcceEEecCcccccce
Confidence 4788888877654 57999999999998 9999999998 46789999999999999
Q ss_pred eecceeeecccccccccceeHHHHhhcCchhhhhccC
Q psy4562 73 FIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGN 109 (112)
Q Consensus 73 W~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~~k~~ 109 (112)
|+||||+|+++ +|+++||||+||+|.|++++||||+
T Consensus 337 WlGgSIlasls-tfq~~witk~eY~e~g~~~~~rk~f 372 (372)
T KOG0676|consen 337 WLGGSILASLS-TFQQMWITKEEYEEHGPSIIHRKCF 372 (372)
T ss_pred ecCceeEeecc-hHhhccccHHHHhhhCCceeeeccC
Confidence 99999999998 7999999999999999999999996
|
|
| >PTZ00452 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00466 actin-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00281 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00004 actin-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00280 Actin-related protein 3; Provisional | Back alignment and domain information |
|---|
| >PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >KOG0679|consensus | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >KOG0680|consensus | Back alignment and domain information |
|---|
| >COG5277 Actin and related proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0677|consensus | Back alignment and domain information |
|---|
| >KOG0678|consensus | Back alignment and domain information |
|---|
| >KOG0681|consensus | Back alignment and domain information |
|---|
| >KOG0797|consensus | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 112 | ||||
| 1k8k_B | 394 | Crystal Structure Of Arp23 COMPLEX Length = 394 | 2e-19 | ||
| 2p9k_B | 394 | Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta | 2e-19 | ||
| 3eks_A | 375 | Crystal Structure Of Monomeric Actin Bound To Cytoc | 6e-05 | ||
| 3u4l_A | 375 | Cryocooled Bovine Profilin:actin Crystal Structure | 6e-05 | ||
| 3byh_A | 374 | Model Of Actin-Fimbrin Abd2 Complex Length = 374 | 6e-05 | ||
| 2btf_A | 375 | The Structure Of Crystalline Profilin-Beta-Actin Le | 7e-05 | ||
| 2hf3_A | 374 | Crystal Structure Of Monomeric Actin In The Adp Bou | 7e-05 | ||
| 1d4x_A | 375 | Crystal Structure Of Caenorhabditis Elegans Mg-Atp | 7e-05 | ||
| 2oan_A | 375 | Structure Of Oxidized Beta-Actin Length = 375 | 7e-05 | ||
| 3a5m_C | 375 | Crystal Structure Of A Dictyostelium P109i Mg2+-Act | 7e-05 | ||
| 3a5l_C | 375 | Crystal Structure Of A Dictyostelium P109a Mg2+-Act | 7e-05 | ||
| 3w3d_A | 374 | Crystal Structure Of Smooth Muscle G Actin Dnase I | 8e-05 | ||
| 4efh_A | 375 | Acanthamoeba Actin Complex With Spir Domain D Lengt | 8e-05 | ||
| 1nlv_A | 375 | Crystal Structure Of Dictyostelium Discoideum Actin | 9e-05 | ||
| 3b63_L | 365 | Actin Filament Model In The Extended Form Of Acroms | 9e-05 | ||
| 3chw_A | 375 | Complex Of Dictyostelium Discoideum Actin With Prof | 9e-05 | ||
| 3ci5_A | 375 | Complex Of Phosphorylated Dictyostelium Discoideum | 9e-05 | ||
| 1c0f_A | 368 | Crystal Structure Of Dictyostelium Caatp-Actin In C | 9e-05 | ||
| 1c0g_A | 375 | Crystal Structure Of 1:1 Complex Between Gelsolin S | 1e-04 | ||
| 1lcu_A | 371 | Polylysine Induces An Antiparallel Actin Dimer That | 2e-04 | ||
| 1eqy_A | 377 | Complex Between Rabbit Muscle Alpha-Actin: Human Ge | 2e-04 | ||
| 1ijj_A | 377 | The X-Ray Crystal Structure Of The Complex Between | 2e-04 | ||
| 4b1v_A | 376 | Structure Of The Phactr1 Rpel-N Domain Bound To G-A | 2e-04 | ||
| 3mn5_A | 359 | Structures Of Actin-Bound Wh2 Domains Of Spire And | 2e-04 | ||
| 1yvn_A | 375 | The Yeast Actin Val 159 Asn Mutant Complex With Hum | 2e-04 | ||
| 2gwj_A | 371 | Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form | 2e-04 | ||
| 1kxp_A | 375 | Crystal Structure Of Human Vitamin D-binding Protei | 2e-04 | ||
| 1t44_A | 370 | Structural Basis Of Actin Sequestration By Thymosin | 2e-04 | ||
| 3b63_C | 365 | Actin Filament Model In The Extended Form Of Acroms | 2e-04 | ||
| 3g37_O | 376 | Cryo-Em Structure Of Actin Filament In The Presence | 2e-04 | ||
| 1qz5_A | 375 | Structure Of Rabbit Actin In Complex With Kabiramid | 2e-04 | ||
| 3b63_A | 365 | Actin Filament Model In The Extended Form Of Acroms | 2e-04 | ||
| 1yag_A | 375 | Structure Of The Yeast Actin-human Gelsolin Segment | 2e-04 | ||
| 2w49_D | 372 | Isometrically Contracting Insect Asynchronous Fligh | 2e-04 | ||
| 1atn_A | 373 | Atomic Structure Of The Actin:dnase I Complex Lengt | 2e-04 | ||
| 1dej_A | 375 | Crystal Structure Of A DictyosteliumTETRAHYMENA CHI | 2e-04 | ||
| 3m6g_A | 371 | Crystal Structure Of Actin In Complex With Lobophor | 2e-04 | ||
| 3b63_E | 365 | Actin Filament Model In The Extended Form Of Acroms | 2e-04 | ||
| 3b63_B | 364 | Actin Filament Model In The Extended Form Of Acroms | 2e-04 |
| >pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 | Back alignment and structure |
|
| >pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 | Back alignment and structure |
| >pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 | Back alignment and structure |
| >pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 | Back alignment and structure |
| >pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 | Back alignment and structure |
| >pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 | Back alignment and structure |
| >pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 | Back alignment and structure |
| >pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 | Back alignment and structure |
| >pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 | Back alignment and structure |
| >pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 | Back alignment and structure |
| >pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 | Back alignment and structure |
| >pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 | Back alignment and structure |
| >pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 | Back alignment and structure |
| >pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 | Back alignment and structure |
| >pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 | Back alignment and structure |
| >pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 | Back alignment and structure |
| >pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 | Back alignment and structure |
| >pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 | Back alignment and structure |
| >pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 | Back alignment and structure |
| >pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 | Back alignment and structure |
| >pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 | Back alignment and structure |
| >pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 | Back alignment and structure |
| >pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 | Back alignment and structure |
| >pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 | Back alignment and structure |
| >pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 | Back alignment and structure |
| >pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 | Back alignment and structure |
| >pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 | Back alignment and structure |
| >pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 | Back alignment and structure |
| >pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 | Back alignment and structure |
| >pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 | Back alignment and structure |
| >pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 | Back alignment and structure |
| >pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 112 | |||
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 4e-15 | |
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 3e-13 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 4e-13 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 2e-12 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 2e-11 |
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 | Back alignment and structure |
|---|
Score = 68.6 bits (168), Expect = 4e-15
Identities = 40/52 (76%), Positives = 47/52 (90%)
Query: 57 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLG 108
KFKIRIEDPPRRK MVF+GGAVLA++MKD+D FWM+ +EYQE+GV VL KLG
Sbjct: 339 KFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLG 390
|
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 99.91 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 99.9 | |
| 4fo0_A | 593 | Actin-related protein 8; chromatin remodeling, nuc | 99.88 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 99.86 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 99.84 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 99.84 | |
| 4am6_A | 655 | Actin-like protein ARP8; nuclear protein, chromati | 99.52 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 96.98 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 95.69 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 94.94 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 94.63 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 92.45 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 92.0 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 83.75 |
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=99.91 E-value=4.6e-26 Score=184.07 Aligned_cols=92 Identities=18% Similarity=0.331 Sum_probs=79.3
Q ss_pred cccCCCCCCcc------hh-hhchhcCCccCcCc----eEEecCCCCC---------------C---------------C
Q psy4562 19 FGHQPRSPLIN------YQ-KFKIRIEDPPRRKD----MVFIGGAVLA---------------E---------------K 57 (112)
Q Consensus 19 ~~f~p~~~gi~------~~-~~sI~~c~~d~r~~----IvL~GGss~~---------------~---------------~ 57 (112)
.+|+|+.+|++ +. .++|++||+|+|+. |||+||+||| + .
T Consensus 292 ~LF~P~~~g~~~~~gI~~~i~~sI~~c~~dlr~~L~~nIvLtGG~sl~~G~~~RL~~El~~l~~~~~~~~~~~~~~~p~~ 371 (427)
T 3dwl_A 292 IFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGG 371 (427)
T ss_dssp GGTCGGGTCSSCCSCHHHHHHHHHHTSCHHHHHHHHHCEEEESGGGCSTTTTHHHHHHHHHHHTTC-------------C
T ss_pred hccCchhcCCccCCCccHHHHHHHHhCCHHHHHHHhCCEEEEccCcCCCChHHHHHHHHHHhhhhhccccccccccCCCc
Confidence 37888655544 33 57999999999999 9999999998 1 2
Q ss_pred ceEEEecCCCCceeeeecceeeecccccccccceeHHHHhhcCchhhhhccCCC
Q psy4562 58 FKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRA 111 (112)
Q Consensus 58 ~~v~V~~~~~~~~~aW~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~~k~~~~ 111 (112)
++|+|.++++|+|++|+|||+||+++ +|+++||||+||+|+|++++|+++.|.
T Consensus 372 ~~vkv~~~~~r~~s~WiGGSilasl~-~f~~~witk~EYeE~G~~iv~~~~~~~ 424 (427)
T 3dwl_A 372 VDVNVISHKRQRNAVWFGGSLLAQTP-EFGSYCHTKADYEEYGASIARRYQIFG 424 (427)
T ss_dssp CCCCEECCTTCTTHHHHHHHHHHHST-THHHHSEEHHHHHHSCGGGGSCCCC--
T ss_pred eeEEEecCCccccceecCceeecccc-chhheeEEHHHHhhhChHhheeccccc
Confidence 46889999999999999999999987 799999999999999999999998764
|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 112 | ||||
| d1k8ka2 | 258 | c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 | 3e-10 | |
| d2fxua2 | 225 | c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI | 8e-08 |
| >d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Actin-related protein 3, Arp3 species: Cow (Bos taurus) [TaxId: 9913]
Score = 53.2 bits (127), Expect = 3e-10
Identities = 14/69 (20%), Positives = 30/69 (43%), Gaps = 1/69 (1%)
Query: 36 RIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKE 95
R D + GG + + +++ ++ V+ GG++LA + + K+
Sbjct: 181 RTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLAS-TPEFYQVCHTKKD 239
Query: 96 YQERGVSVL 104
Y+E G S+
Sbjct: 240 YEEIGPSIC 248
|
| >d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 112 | |||
| d2fxua2 | 225 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1k8ka2 | 258 | Actin-related protein 3, Arp3 {Cow (Bos taurus) [T | 99.91 | |
| d1k8kb1 | 190 | Actin-related protein 2, Arp2 {Cow (Bos taurus) [T | 98.21 | |
| d1jcea2 | 196 | Prokaryotic actin homolog MreB {Thermotoga maritim | 93.48 |
| >d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Actin species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.92 E-value=7.2e-27 Score=171.37 Aligned_cols=96 Identities=32% Similarity=0.469 Sum_probs=83.2
Q ss_pred eeeecCCCCc------------cccCCCCCCcc-----hh-hhchhcCCccCcCc----eEEecCCCCC-----------
Q psy4562 9 AVRVVPDRHP------------FGHQPRSPLIN-----YQ-KFKIRIEDPPRRKD----MVFIGGAVLA----------- 55 (112)
Q Consensus 9 ~~~~~~~~~p------------~~f~p~~~gi~-----~~-~~sI~~c~~d~r~~----IvL~GGss~~----------- 55 (112)
..+.+||.+- .+|+|+.+|++ +. .+||.+||+|+|+. |||+||+|+|
T Consensus 92 ~~~~lpdg~~i~i~~er~~~~E~lF~p~~~~~~~~gl~~~i~~sI~~~~~d~r~~l~~nIvl~GG~s~~~G~~~RL~~El 171 (225)
T d2fxua2 92 KSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEI 171 (225)
T ss_dssp EEEECTTSCEEEESTHHHHHHHTTTCGGGGTCCSCCHHHHHHHHHHTSCHHHHHHHHTCEEEESGGGCSTTHHHHHHHHH
T ss_pred eeEECCCCCEEEEchHhccccHhhcCccccCCccCChhHHHHHHhhcCCcchhhhhhcCEEEeCCcccCCchhHHHHhHH
Confidence 4577888874 47888765554 43 57999999999999 9999999998
Q ss_pred -----CCceEEEecCCCCceeeeecceeeecccccccccceeHHHHhhcCchhhh
Q psy4562 56 -----EKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLS 105 (112)
Q Consensus 56 -----~~~~v~V~~~~~~~~~aW~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~ 105 (112)
...+++|..+++|++++|+|||++|++. .|+++||||+||+|+|++++|
T Consensus 172 ~~~~~~~~~~~v~~~~~~~~~aW~Ggsilasl~-~f~~~~itk~eY~E~G~~ivh 225 (225)
T d2fxua2 172 TALAPSTMKIKIIAPPERKYSVWIGGSILASLS-TFQQMWITKQEYDEAGPSIVH 225 (225)
T ss_dssp HHHSCTTCCCCEECCTTTTSHHHHHHHHHHHCG-GGGGGSEEHHHHHHHCGGGGC
T ss_pred HHhhccccceEEecCCCCCeeEEeCHhhhhcCc-cHhhEEEEHHHHHhhCccccC
Confidence 3557899999999999999999999987 799999999999999999986
|
| >d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|