Psyllid ID: psy4562


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
AEYTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRAE
ccEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEcccccccccEEEEEcccccccEEEEccEEEcccccccccEEEEHHHHHcccccEEEccccccc
cEEEEEEcEEEEcccccccccccccccccccccccHHHcHHHHHHHHccccHHHHHHcEEEEccccccccEEEEHHHHHHHHHHcccccEEEHHHHHHccHHHHHHcccccc
aeytlkwsavrvvpdrhpfghqprsplinyqkfkiriedpprrkdmVFIGGAVLAEKFKiriedpprrkdMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRAE
aeytlkwsavrvvpdrhpfghqprsplinyqkFKIRIEDPPRRKDMVFiggavlaekfkiriedpprrkdMVFIGGAVLAEVMKDRDAFWMSNkeyqergvsvlsklgnrae
AEYTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRAE
****LKWSAVRVVPDRHPFG****SPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNK******************
**YTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPR**DMVF***AVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVL*KLGN***
AEYTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRAE
AEYTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AEYTLKWSAVRVVPDRHPFGHQPRSPLINYQKFKIRIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
P45888394 Actin-related protein 2 O yes N/A 0.455 0.129 0.843 6e-19
Q5M7U6394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
P61161394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
P61160394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
A7MB62394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
Q5R4K0394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
P53488394 Actin-related protein 2 O yes N/A 0.464 0.131 0.769 3e-18
Q7ZXV3394 Actin-related protein 2-B N/A N/A 0.464 0.131 0.75 8e-18
Q7ZTP2394 Actin-related protein 2-A N/A N/A 0.464 0.131 0.75 8e-18
Q5BL41394 Actin-related protein 2 O yes N/A 0.464 0.131 0.75 9e-18
>sp|P45888|ARP2_DROME Actin-related protein 2 OS=Drosophila melanogaster GN=Arp14D PE=2 SV=2 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%)

Query: 57  KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKL 107
           KFKIRIEDPPRRKDMVFIGGAVLAEV KDRD FWMS +EYQE+G+ VL KL
Sbjct: 339 KFKIRIEDPPRRKDMVFIGGAVLAEVTKDRDGFWMSKQEYQEQGLKVLQKL 389




Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament.
Drosophila melanogaster (taxid: 7227)
>sp|Q5M7U6|ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=1 SV=1 Back     alignment and function description
>sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 Back     alignment and function description
>sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 Back     alignment and function description
>sp|A7MB62|ARP2_BOVIN Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4K0|ARP2_PONAB Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 Back     alignment and function description
>sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXV3|ARP2B_XENLA Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 Back     alignment and function description
>sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 Back     alignment and function description
>sp|Q5BL41|ARP2_XENTR Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
189235544 394 PREDICTED: similar to actin [Tribolium c 0.491 0.139 0.836 4e-19
347964888 395 AGAP000985-PA [Anopheles gambiae str. PE 0.491 0.139 0.818 2e-18
312383097 343 hypothetical protein AND_03954 [Anophele 0.491 0.160 0.818 2e-18
170028731 395 actin [Culex quinquefasciatus] gi|167877 0.491 0.139 0.818 3e-18
157130317 395 actin [Aedes aegypti] gi|108871910|gb|EA 0.491 0.139 0.818 3e-18
289740925 394 actin-related protein ARP2/3 complex sub 0.464 0.131 0.846 3e-18
242007573 375 conserved hypothetical protein [Pediculu 0.491 0.146 0.781 9e-18
321474107 393 hypothetical protein DAPPUDRAFT_209234 [ 0.491 0.139 0.781 1e-17
195567126 400 GD15743 [Drosophila simulans] gi|1942045 0.455 0.127 0.843 2e-17
195447458 394 GK25245 [Drosophila willistoni] gi|19416 0.455 0.129 0.843 2e-17
>gi|189235544|ref|XP_001814869.1| PREDICTED: similar to actin [Tribolium castaneum] gi|270003115|gb|EEZ99562.1| hypothetical protein TcasGA2_TC000144 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/55 (83%), Positives = 51/55 (92%)

Query: 57  KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRA 111
           KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMS +EY+E+G+ VL KLG R+
Sbjct: 339 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSKQEYEEQGLKVLKKLGPRS 393




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|347964888|ref|XP_309181.5| AGAP000985-PA [Anopheles gambiae str. PEST] gi|333466524|gb|EAA04899.5| AGAP000985-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312383097|gb|EFR28310.1| hypothetical protein AND_03954 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170028731|ref|XP_001842248.1| actin [Culex quinquefasciatus] gi|167877933|gb|EDS41316.1| actin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157130317|ref|XP_001655658.1| actin [Aedes aegypti] gi|108871910|gb|EAT36135.1| AAEL011750-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|289740925|gb|ADD19210.1| actin-related protein ARP2/3 complex subunit ARP2 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|242007573|ref|XP_002424614.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508057|gb|EEB11876.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321474107|gb|EFX85073.1| hypothetical protein DAPPUDRAFT_209234 [Daphnia pulex] Back     alignment and taxonomy information
>gi|195567126|ref|XP_002107121.1| GD15743 [Drosophila simulans] gi|194204522|gb|EDX18098.1| GD15743 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195447458|ref|XP_002071223.1| GK25245 [Drosophila willistoni] gi|194167308|gb|EDW82209.1| GK25245 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
ZFIN|ZDB-GENE-050410-4394 actr2b "ARP2 actin-related pro 0.571 0.162 0.640 2.3e-19
FB|FBgn0011742394 Arp2 "Actin-related protein 2" 0.455 0.129 0.843 2.2e-18
UNIPROTKB|F1NRM5378 ACTR2 "Actin-related protein 2 0.571 0.169 0.656 5.1e-18
UNIPROTKB|F1NHN5393 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
UNIPROTKB|P53488394 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
UNIPROTKB|A7MB62394 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
UNIPROTKB|F1MRG7394 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
UNIPROTKB|P61160394 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
UNIPROTKB|B5APU3394 ACTR2 "Actin-related protein 2 0.571 0.162 0.656 6.1e-18
MGI|MGI:1913963394 Actr2 "ARP2 actin-related prot 0.571 0.162 0.656 6.1e-18
ZFIN|ZDB-GENE-050410-4 actr2b "ARP2 actin-related protein 2b homolog (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 2.3e-19, Sum P(2) = 2.3e-19
 Identities = 41/64 (64%), Positives = 50/64 (78%)

Query:    45 DMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVL 104
             + V  G      KFKIRIEDPPRRK MVF+GGAVLA++MKD+D FW++ +EYQE+GV VL
Sbjct:   327 ERVLKGDVDKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWLTREEYQEKGVRVL 386

Query:   105 SKLG 108
              KLG
Sbjct:   387 EKLG 390


GO:0008150 "biological_process" evidence=ND
GO:0003779 "actin binding" evidence=IEA
GO:0005856 "cytoskeleton" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0042995 "cell projection" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
FB|FBgn0011742 Arp2 "Actin-related protein 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRM5 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHN5 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P53488 ACTR2 "Actin-related protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB62 ACTR2 "Actin-related protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRG7 ACTR2 "Actin-related protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61160 ACTR2 "Actin-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B5APU3 ACTR2 "Actin-related protein 2-like protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913963 Actr2 "ARP2 actin-related protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6Z256ARP2_ORYSJNo assigned EC number0.52230.59820.1722yesN/A
P61160ARP2_HUMANNo assigned EC number0.76920.46420.1319yesN/A
P53488ARP2_CHICKNo assigned EC number0.76920.46420.1319yesN/A
P53489ARP2_CAEELNo assigned EC number0.57970.59820.1696yesN/A
A7MB62ARP2_BOVINNo assigned EC number0.76920.46420.1319yesN/A
Q5M7U6ARP2_RATNo assigned EC number0.76920.46420.1319yesN/A
Q5R4K0ARP2_PONABNo assigned EC number0.76920.46420.1319yesN/A
Q5BL41ARP2_XENTRNo assigned EC number0.750.46420.1319yesN/A
P32381ARP2_YEASTNo assigned EC number0.63630.49100.1406yesN/A
P61161ARP2_MOUSENo assigned EC number0.76920.46420.1319yesN/A
P45888ARP2_DROMENo assigned EC number0.84310.45530.1294yesN/A
O96621ARP2_DICDINo assigned EC number0.66660.45530.1301yesN/A
Q56A35ARP2B_DANRENo assigned EC number0.750.46420.1319yesN/A
Q9UUJ1ARP2_SCHPONo assigned EC number0.54540.49100.1410yesN/A
Q7SXW6ARP2A_DANRENo assigned EC number0.750.46420.1319yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
smart00268373 smart00268, ACTIN, Actin 2e-10
pfam00022367 pfam00022, Actin, Actin 1e-08
PTZ00466380 PTZ00466, PTZ00466, actin-like protein; Provisiona 2e-06
COG5277444 COG5277, COG5277, Actin and related proteins [Cyto 9e-06
PTZ00004378 PTZ00004, PTZ00004, actin-2; Provisional 1e-05
PTZ00281376 PTZ00281, PTZ00281, actin; Provisional 2e-05
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
 Score = 55.7 bits (135), Expect = 2e-10
 Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 57  KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSK 106
           K K+++  PP RK  V++GG++LA +    D  W++ KEY+E G  ++ +
Sbjct: 322 KLKVKVIAPPERKYSVWLGGSILASLSTFED-MWITKKEYEESGSQIVER 370


ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily. Length = 373

>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
KOG0676|consensus372 99.93
PTZ00452375 actin; Provisional 99.93
PTZ00466380 actin-like protein; Provisional 99.91
PTZ00281376 actin; Provisional 99.91
PTZ00004378 actin-2; Provisional 99.9
PTZ00280414 Actin-related protein 3; Provisional 99.88
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.87
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.86
KOG0679|consensus426 99.81
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.78
KOG0680|consensus400 99.77
COG5277444 Actin and related proteins [Cytoskeleton] 99.76
KOG0677|consensus389 99.7
KOG0678|consensus415 99.49
KOG0681|consensus645 99.49
KOG0797|consensus618 98.53
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 94.43
PRK13927334 rod shape-determining protein MreB; Provisional 93.87
PRK13930335 rod shape-determining protein MreB; Provisional 93.71
PRK13929335 rod-share determining protein MreBH; Provisional 93.4
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 92.73
PRK13928336 rod shape-determining protein Mbl; Provisional 91.94
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 81.12
>KOG0676|consensus Back     alignment and domain information
Probab=99.93  E-value=6.2e-27  Score=188.41  Aligned_cols=90  Identities=29%  Similarity=0.479  Sum_probs=82.7

Q ss_pred             cccCCCCCCcchh------hhchhcCCccCcCc----eEEecCCCCC----------------CCceEEEecCCCCceee
Q psy4562          19 FGHQPRSPLINYQ------KFKIRIEDPPRRKD----MVFIGGAVLA----------------EKFKIRIEDPPRRKDMV   72 (112)
Q Consensus        19 ~~f~p~~~gi~~~------~~sI~~c~~d~r~~----IvL~GGss~~----------------~~~~v~V~~~~~~~~~a   72 (112)
                      .+|+|+.+|+...      .+||++||+|+|+.    |||+||+||+                +..+++|.++|+|.+++
T Consensus       257 ~lFqP~~~g~e~~gi~~~~~~sI~kcd~dlrk~L~~nivLsGGtT~~pGl~~Rl~kEl~~l~P~~~~ikv~~pp~r~~s~  336 (372)
T KOG0676|consen  257 VLFQPSLLGMESPGIHELTVNSIMKCDIDLRKDLYENIVLSGGTTMFPGLADRLQKELQALAPSTIKIKVIAPPERKYSA  336 (372)
T ss_pred             hcCChhhcCCCCCchhHHHHHHHHhCChhHhHHHHhheEEeCCcccchhHHHHHHHHHhhcCCCCcceEEecCcccccce
Confidence            4788888877654      57999999999998    9999999998                46789999999999999


Q ss_pred             eecceeeecccccccccceeHHHHhhcCchhhhhccC
Q psy4562          73 FIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGN  109 (112)
Q Consensus        73 W~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~~k~~  109 (112)
                      |+||||+|+++ +|+++||||+||+|.|++++||||+
T Consensus       337 WlGgSIlasls-tfq~~witk~eY~e~g~~~~~rk~f  372 (372)
T KOG0676|consen  337 WLGGSILASLS-TFQQMWITKEEYEEHGPSIIHRKCF  372 (372)
T ss_pred             ecCceeEeecc-hHhhccccHHHHhhhCCceeeeccC
Confidence            99999999998 7999999999999999999999996



>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1k8k_B394 Crystal Structure Of Arp23 COMPLEX Length = 394 2e-19
2p9k_B394 Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta 2e-19
3eks_A375 Crystal Structure Of Monomeric Actin Bound To Cytoc 6e-05
3u4l_A375 Cryocooled Bovine Profilin:actin Crystal Structure 6e-05
3byh_A374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 6e-05
2btf_A375 The Structure Of Crystalline Profilin-Beta-Actin Le 7e-05
2hf3_A374 Crystal Structure Of Monomeric Actin In The Adp Bou 7e-05
1d4x_A375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 7e-05
2oan_A375 Structure Of Oxidized Beta-Actin Length = 375 7e-05
3a5m_C375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 7e-05
3a5l_C375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 7e-05
3w3d_A374 Crystal Structure Of Smooth Muscle G Actin Dnase I 8e-05
4efh_A375 Acanthamoeba Actin Complex With Spir Domain D Lengt 8e-05
1nlv_A375 Crystal Structure Of Dictyostelium Discoideum Actin 9e-05
3b63_L365 Actin Filament Model In The Extended Form Of Acroms 9e-05
3chw_A375 Complex Of Dictyostelium Discoideum Actin With Prof 9e-05
3ci5_A375 Complex Of Phosphorylated Dictyostelium Discoideum 9e-05
1c0f_A368 Crystal Structure Of Dictyostelium Caatp-Actin In C 9e-05
1c0g_A375 Crystal Structure Of 1:1 Complex Between Gelsolin S 1e-04
1lcu_A371 Polylysine Induces An Antiparallel Actin Dimer That 2e-04
1eqy_A377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 2e-04
1ijj_A377 The X-Ray Crystal Structure Of The Complex Between 2e-04
4b1v_A376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 2e-04
3mn5_A359 Structures Of Actin-Bound Wh2 Domains Of Spire And 2e-04
1yvn_A375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 2e-04
2gwj_A371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 2e-04
1kxp_A375 Crystal Structure Of Human Vitamin D-binding Protei 2e-04
1t44_A370 Structural Basis Of Actin Sequestration By Thymosin 2e-04
3b63_C365 Actin Filament Model In The Extended Form Of Acroms 2e-04
3g37_O376 Cryo-Em Structure Of Actin Filament In The Presence 2e-04
1qz5_A375 Structure Of Rabbit Actin In Complex With Kabiramid 2e-04
3b63_A365 Actin Filament Model In The Extended Form Of Acroms 2e-04
1yag_A375 Structure Of The Yeast Actin-human Gelsolin Segment 2e-04
2w49_D372 Isometrically Contracting Insect Asynchronous Fligh 2e-04
1atn_A373 Atomic Structure Of The Actin:dnase I Complex Lengt 2e-04
1dej_A375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 2e-04
3m6g_A371 Crystal Structure Of Actin In Complex With Lobophor 2e-04
3b63_E365 Actin Filament Model In The Extended Form Of Acroms 2e-04
3b63_B364 Actin Filament Model In The Extended Form Of Acroms 2e-04
>pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 Back     alignment and structure

Iteration: 1

Score = 90.1 bits (222), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 40/52 (76%), Positives = 47/52 (90%) Query: 57 KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLG 108 KFKIRIEDPPRRK MVF+GGAVLA++MKD+D FWM+ +EYQE+GV VL KLG Sbjct: 339 KFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLG 390
>pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 Back     alignment and structure
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 4e-15
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 3e-13
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 4e-13
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 2e-12
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 2e-11
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
 Score = 68.6 bits (168), Expect = 4e-15
 Identities = 40/52 (76%), Positives = 47/52 (90%)

Query: 57  KFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLG 108
           KFKIRIEDPPRRK MVF+GGAVLA++MKD+D FWM+ +EYQE+GV VL KLG
Sbjct: 339 KFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLG 390


>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.91
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.9
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 99.88
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.86
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.84
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.84
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 99.52
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 96.98
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 95.69
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 94.94
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 94.63
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 92.45
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 92.0
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 83.75
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.91  E-value=4.6e-26  Score=184.07  Aligned_cols=92  Identities=18%  Similarity=0.331  Sum_probs=79.3

Q ss_pred             cccCCCCCCcc------hh-hhchhcCCccCcCc----eEEecCCCCC---------------C---------------C
Q psy4562          19 FGHQPRSPLIN------YQ-KFKIRIEDPPRRKD----MVFIGGAVLA---------------E---------------K   57 (112)
Q Consensus        19 ~~f~p~~~gi~------~~-~~sI~~c~~d~r~~----IvL~GGss~~---------------~---------------~   57 (112)
                      .+|+|+.+|++      +. .++|++||+|+|+.    |||+||+|||               +               .
T Consensus       292 ~LF~P~~~g~~~~~gI~~~i~~sI~~c~~dlr~~L~~nIvLtGG~sl~~G~~~RL~~El~~l~~~~~~~~~~~~~~~p~~  371 (427)
T 3dwl_A          292 IFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLFKNFGNRLQRDLKRIVDERIHRSEMLSGAKSGG  371 (427)
T ss_dssp             GGTCGGGTCSSCCSCHHHHHHHHHHTSCHHHHHHHHHCEEEESGGGCSTTTTHHHHHHHHHHHTTC-------------C
T ss_pred             hccCchhcCCccCCCccHHHHHHHHhCCHHHHHHHhCCEEEEccCcCCCChHHHHHHHHHHhhhhhccccccccccCCCc
Confidence            37888655544      33 57999999999999    9999999998               1               2


Q ss_pred             ceEEEecCCCCceeeeecceeeecccccccccceeHHHHhhcCchhhhhccCCC
Q psy4562          58 FKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLSKLGNRA  111 (112)
Q Consensus        58 ~~v~V~~~~~~~~~aW~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~~k~~~~  111 (112)
                      ++|+|.++++|+|++|+|||+||+++ +|+++||||+||+|+|++++|+++.|.
T Consensus       372 ~~vkv~~~~~r~~s~WiGGSilasl~-~f~~~witk~EYeE~G~~iv~~~~~~~  424 (427)
T 3dwl_A          372 VDVNVISHKRQRNAVWFGGSLLAQTP-EFGSYCHTKADYEEYGASIARRYQIFG  424 (427)
T ss_dssp             CCCCEECCTTCTTHHHHHHHHHHHST-THHHHSEEHHHHHHSCGGGGSCCCC--
T ss_pred             eeEEEecCCccccceecCceeecccc-chhheeEEHHHHhhhChHhheeccccc
Confidence            46889999999999999999999987 799999999999999999999998764



>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1k8ka2258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 3e-10
d2fxua2225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 8e-08
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 53.2 bits (127), Expect = 3e-10
 Identities = 14/69 (20%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 36  RIEDPPRRKDMVFIGGAVLAEKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKE 95
           R  D   +      GG +  +   +++     ++  V+ GG++LA    +      + K+
Sbjct: 181 RTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLAS-TPEFYQVCHTKKD 239

Query: 96  YQERGVSVL 104
           Y+E G S+ 
Sbjct: 240 YEEIGPSIC 248


>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.91
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 98.21
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 93.48
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.92  E-value=7.2e-27  Score=171.37  Aligned_cols=96  Identities=32%  Similarity=0.469  Sum_probs=83.2

Q ss_pred             eeeecCCCCc------------cccCCCCCCcc-----hh-hhchhcCCccCcCc----eEEecCCCCC-----------
Q psy4562           9 AVRVVPDRHP------------FGHQPRSPLIN-----YQ-KFKIRIEDPPRRKD----MVFIGGAVLA-----------   55 (112)
Q Consensus         9 ~~~~~~~~~p------------~~f~p~~~gi~-----~~-~~sI~~c~~d~r~~----IvL~GGss~~-----------   55 (112)
                      ..+.+||.+-            .+|+|+.+|++     +. .+||.+||+|+|+.    |||+||+|+|           
T Consensus        92 ~~~~lpdg~~i~i~~er~~~~E~lF~p~~~~~~~~gl~~~i~~sI~~~~~d~r~~l~~nIvl~GG~s~~~G~~~RL~~El  171 (225)
T d2fxua2          92 KSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEI  171 (225)
T ss_dssp             EEEECTTSCEEEESTHHHHHHHTTTCGGGGTCCSCCHHHHHHHHHHTSCHHHHHHHHTCEEEESGGGCSTTHHHHHHHHH
T ss_pred             eeEECCCCCEEEEchHhccccHhhcCccccCCccCChhHHHHHHhhcCCcchhhhhhcCEEEeCCcccCCchhHHHHhHH
Confidence            4577888874            47888765554     43 57999999999999    9999999998           


Q ss_pred             -----CCceEEEecCCCCceeeeecceeeecccccccccceeHHHHhhcCchhhh
Q psy4562          56 -----EKFKIRIEDPPRRKDMVFIGGAVLAEVMKDRDAFWMSNKEYQERGVSVLS  105 (112)
Q Consensus        56 -----~~~~v~V~~~~~~~~~aW~Ggsila~~~~~f~~~~iTr~eYeE~G~~iv~  105 (112)
                           ...+++|..+++|++++|+|||++|++. .|+++||||+||+|+|++++|
T Consensus       172 ~~~~~~~~~~~v~~~~~~~~~aW~Ggsilasl~-~f~~~~itk~eY~E~G~~ivh  225 (225)
T d2fxua2         172 TALAPSTMKIKIIAPPERKYSVWIGGSILASLS-TFQQMWITKQEYDEAGPSIVH  225 (225)
T ss_dssp             HHHSCTTCCCCEECCTTTTSHHHHHHHHHHHCG-GGGGGSEEHHHHHHHCGGGGC
T ss_pred             HHhhccccceEEecCCCCCeeEEeCHhhhhcCc-cHhhEEEEHHHHHhhCccccC
Confidence                 3557899999999999999999999987 799999999999999999986



>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure