Psyllid ID: psy4626


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540--
MPGIMALRKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDR
cccHHHHHHHHccccccccccHHHHHHHHHHHHcccccccEEEcccccccccccccccccHHHHHHHHHHHcEEEcccEEEEEccccccHHHHHHHcccccEEEEEEcccHHHHHHHccccEEEcHHHHHccccEEEEcccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHccccccEEcccccHHHHHHcccccccccccccEEEcccccccHHHHHccccEEEEcccccccccHHHHHccccccEEEccccccccccccccccccccEEEccccccEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHcccccccccccEEEcccccHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHHcccccccEEEccccHHHHccccccccccccccc
cHHHHHHHHHHcccccccccEEEHHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHHHccEEEEEEccEEEEEcccccEEEEEHHHccHHHHccccccEEEccccccHEEEEEEHHHccccHcccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHcEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHHHccEEEEEEccEEEEEcccccEEEEEHHHccHHHHccccccEEEEEEEEccccccEEEEEcccHHHHHccEEEcccccccccccEEEEEccccHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHcHHHHHHccEEEEccHHHHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHc
MPGIMALRkragddkplknarivgcthinaqtaagkltvpamnvndsvtktkfdnLYMCRESIIDSLKrstdvmfggkQVVLCGygevgkgccqslkglgcvIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMdkmkngcvvcnmghsnteidvnslrtpdltwEKVRSQVDhviwpdgkRIVLLAEGrlvnlscsslpSFVVSITACTQALALIELfnapsgryksdvyllpkKMDEYVASLHLPTFDAHLTELSDEQAKYMglnkagpfkpsyysmdgfsvVKLNEVIRTVDIVVTATGNKNVVTREHMdkmkngcvvcnmghsnteidvnslrtpdltwEKVRSQVDhviwpdgkRIVLLAEGrlvnlscsslpSFVVSITActqrdksslipcyhlRFASNLAKYLLNSLtssytglpvfawrgeteeDFWWCIDKcvnswqpnmilddggdaTHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLskagkltvpamnvndsvtktkfdnLYMCRESIIDR
mpgimalrkragddkplknARIVGCTHInaqtaagkltvpamnvndsvtktkfdnlYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTatgnknvvtrehmdkMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIElfnapsgryKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTatgnknvvtrehmdkMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSkagkltvpamnvndsvtktkfdnlymcresiidr
MPGIMALRKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDR
******************NARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRES****
*PGI*A*RKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESII**
MPGIMALRKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDR
MPGIMALRKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGIMALRKRAGDDKPLKNARIVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCSSLPSFVVSITACTQRDKSSLIPCYHLRFASNLAKYLLNSLTSSYTGLPVFAWRGETEEDFWWCIDKCVNSWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query542 2.2.26 [Sep-21-2011]
Q96HN2611 Putative adenosylhomocyst yes N/A 0.485 0.430 0.809 1e-135
Q68FL4613 Putative adenosylhomocyst yes N/A 0.485 0.429 0.809 1e-135
Q80SW1530 Putative adenosylhomocyst no N/A 0.485 0.496 0.809 1e-135
O43865530 Putative adenosylhomocyst no N/A 0.485 0.496 0.809 1e-135
Q5R889508 Putative adenosylhomocyst no N/A 0.485 0.517 0.805 1e-134
P50245492 Putative adenosylhomocyst no N/A 0.501 0.552 0.761 1e-123
Q7NZF7466 Adenosylhomocysteinase OS yes N/A 0.474 0.551 0.590 1e-88
Q63PT2473 Adenosylhomocysteinase OS yes N/A 0.522 0.598 0.540 1e-87
A3NER1473 Adenosylhomocysteinase OS yes N/A 0.522 0.598 0.540 1e-87
Q3JY79473 Adenosylhomocysteinase OS yes N/A 0.522 0.598 0.540 1e-87
>sp|Q96HN2|SAHH3_HUMAN Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1 Back     alignment and function desciption
 Score =  482 bits (1241), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 221/273 (80%), Positives = 249/273 (91%)

Query: 22  IVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVV 81
           + G   +   + AGKL VPAMNVNDSVTK KFDNLY CRESI+D LKR+TD+MFGGKQVV
Sbjct: 337 VTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVV 396

Query: 82  LCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATG 141
           +CGYGEVGKGCC +LK +G ++Y+TEIDPICALQACMDGF +VKLNEVIR VDIV+T TG
Sbjct: 397 VCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTG 456

Query: 142 NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIV 201
           NKNVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+VRSQVDHVIWPDGKRIV
Sbjct: 457 NKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIV 516

Query: 202 LLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASL 261
           LLAEGRL+NLSCS++P+FV+SITA TQALALIEL+NAP GRYK DVYLLPKKMDEYVASL
Sbjct: 517 LLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASL 576

Query: 262 HLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYY 294
           HLPTFDAHLTEL+DEQAKY+GLNK GPFKP+YY
Sbjct: 577 HLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYY 609





Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|Q68FL4|SAHH3_MOUSE Putative adenosylhomocysteinase 3 OS=Mus musculus GN=Ahcyl2 PE=1 SV=1 Back     alignment and function description
>sp|Q80SW1|SAHH2_MOUSE Putative adenosylhomocysteinase 2 OS=Mus musculus GN=Ahcyl1 PE=1 SV=1 Back     alignment and function description
>sp|O43865|SAHH2_HUMAN Putative adenosylhomocysteinase 2 OS=Homo sapiens GN=AHCYL1 PE=1 SV=2 Back     alignment and function description
>sp|Q5R889|SAHH3_PONAB Putative adenosylhomocysteinase 3 OS=Pongo abelii GN=AHCYL2 PE=2 SV=1 Back     alignment and function description
>sp|P50245|SAHH2_DROME Putative adenosylhomocysteinase 2 OS=Drosophila melanogaster GN=Ahcy89E PE=2 SV=2 Back     alignment and function description
>sp|Q7NZF7|SAHH_CHRVO Adenosylhomocysteinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q63PT2|SAHH_BURPS Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain K96243) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|A3NER1|SAHH_BURP6 Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 668) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q3JY79|SAHH_BURP1 Adenosylhomocysteinase OS=Burkholderia pseudomallei (strain 1710b) GN=ahcY PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query542
307182708564 Putative adenosylhomocysteinase 3 [Campo 0.503 0.484 0.869 1e-146
340709195532 PREDICTED: putative adenosylhomocysteina 0.485 0.494 0.897 1e-145
340709197516 PREDICTED: putative adenosylhomocysteina 0.485 0.509 0.897 1e-145
383864821528 PREDICTED: putative adenosylhomocysteina 0.485 0.498 0.893 1e-145
322789035526 hypothetical protein SINV_08970 [Solenop 0.488 0.503 0.887 1e-145
110749750532 PREDICTED: putative adenosylhomocysteina 0.485 0.494 0.893 1e-145
307194517540 Putative adenosylhomocysteinase 3 [Harpe 0.516 0.518 0.879 1e-145
332023183539 Putative adenosylhomocysteinase 3 [Acrom 0.488 0.491 0.890 1e-145
242013664549 adenosylhomocysteinase, putative [Pedicu 0.535 0.528 0.849 1e-145
345486611532 PREDICTED: putative adenosylhomocysteina 0.485 0.494 0.893 1e-144
>gi|307182708|gb|EFN69832.1| Putative adenosylhomocysteinase 3 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 246/283 (86%), Positives = 265/283 (93%)

Query: 22  IVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVV 81
           + G   +   + AGKL+VPAMNVNDSVTKTKFDNLY CRESIIDSLKRSTD+MFGGKQVV
Sbjct: 280 VTGVHRLYQLSKAGKLSVPAMNVNDSVTKTKFDNLYSCRESIIDSLKRSTDIMFGGKQVV 339

Query: 82  LCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATG 141
           +CGYGEVGKGCCQ+LKGLGC++YITEIDPICALQA MDGF V+KLNEVIR VDIV+TATG
Sbjct: 340 ICGYGEVGKGCCQALKGLGCIVYITEIDPICALQASMDGFRVMKLNEVIRNVDIVITATG 399

Query: 142 NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIV 201
           NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRI+
Sbjct: 400 NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRII 459

Query: 202 LLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASL 261
           LLAEGRLVNLSCSS+PSFVVSITA TQALALIELFNAP GRYKSDVYLLPKKMDEYVASL
Sbjct: 460 LLAEGRLVNLSCSSIPSFVVSITAATQALALIELFNAPPGRYKSDVYLLPKKMDEYVASL 519

Query: 262 HLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYYSMDGFSVVKL 304
           HLPTFDAHLTEL+DEQAKYMGLNKAGPFKP+YY +   SV+++
Sbjct: 520 HLPTFDAHLTELTDEQAKYMGLNKAGPFKPNYYRLVSSSVMRV 562




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340709195|ref|XP_003393197.1| PREDICTED: putative adenosylhomocysteinase 3-like isoform 1 [Bombus terrestris] gi|350425225|ref|XP_003494052.1| PREDICTED: putative adenosylhomocysteinase 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709197|ref|XP_003393198.1| PREDICTED: putative adenosylhomocysteinase 3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383864821|ref|XP_003707876.1| PREDICTED: putative adenosylhomocysteinase 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322789035|gb|EFZ14493.1| hypothetical protein SINV_08970 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|110749750|ref|XP_624152.2| PREDICTED: putative adenosylhomocysteinase 3-like [Apis mellifera] gi|380027184|ref|XP_003697310.1| PREDICTED: putative adenosylhomocysteinase 3-like [Apis florea] Back     alignment and taxonomy information
>gi|307194517|gb|EFN76809.1| Putative adenosylhomocysteinase 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332023183|gb|EGI63439.1| Putative adenosylhomocysteinase 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242013664|ref|XP_002427522.1| adenosylhomocysteinase, putative [Pediculus humanus corporis] gi|212511924|gb|EEB14784.1| adenosylhomocysteinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345486611|ref|XP_001605394.2| PREDICTED: putative adenosylhomocysteinase 3-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query542
FB|FBgn0015011492 Ahcy89E "Adenosylhomocysteinas 0.501 0.552 0.761 2.3e-129
FB|FBgn0035371521 CG9977 [Drosophila melanogaste 0.516 0.537 0.839 3.6e-128
UNIPROTKB|F1P7I1524 AHCYL1 "Adenosylhomocysteinase 0.505 0.522 0.810 6.3e-124
ZFIN|ZDB-GENE-070112-1522516 zgc:158222 "zgc:158222" [Danio 0.516 0.542 0.728 1.5e-123
UNIPROTKB|F1MWH2530 AHCYL1 "Adenosylhomocysteinase 0.503 0.515 0.809 1.7e-123
UNIPROTKB|E2REN0517 AHCYL1 "Adenosylhomocysteinase 0.503 0.528 0.809 1.7e-123
UNIPROTKB|O43865530 AHCYL1 "Putative adenosylhomoc 0.503 0.515 0.809 1.7e-123
UNIPROTKB|F1S610494 AHCYL1 "Adenosylhomocysteinase 0.503 0.552 0.809 1.7e-123
MGI|MGI:2385184530 Ahcyl1 "S-adenosylhomocysteine 0.503 0.515 0.809 1.7e-123
RGD|1309768529 Ahcyl1 "adenosylhomocysteinase 0.503 0.516 0.809 1.7e-123
FB|FBgn0015011 Ahcy89E "Adenosylhomocysteinase 89E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1150 (409.9 bits), Expect = 2.3e-129, Sum P(2) = 2.3e-129
 Identities = 208/273 (76%), Positives = 245/273 (89%)

Query:    22 IVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVV 81
             + G   +   +  GKLTVPA+NVNDSVTK KFD  Y CR+SI+DSLKR+TD+MFGGKQVV
Sbjct:   219 VTGVHRLYMLSKGGKLTVPAINVNDSVTKNKFDTFYTCRDSILDSLKRTTDIMFGGKQVV 278

Query:    82 LCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATG 141
             +CGYG+VGKGC QSLKG GC++Y+TE+DPICALQA MDGF VV+LNEVIRTVD+VVTATG
Sbjct:   279 ICGYGDVGKGCAQSLKGQGCIVYVTEVDPICALQAAMDGFRVVRLNEVIRTVDVVVTATG 338

Query:   142 NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIV 201
             NKNV+TR+HM++MKNGC++CNMGHS +EIDVN L TP+LTWE+VRSQVDH+ WPDG+ I+
Sbjct:   339 NKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHTPELTWERVRSQVDHIRWPDGRMII 398

Query:   202 LLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASL 261
             LLAEGRLVNLSCS++ SFVVS+ + TQALALIELF+AP GRYKSDVYLLPKKMDEYVASL
Sbjct:   399 LLAEGRLVNLSCSTISSFVVSVASSTQALALIELFSAP-GRYKSDVYLLPKKMDEYVASL 457

Query:   262 HLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYY 294
             HL TFDAHLTEL+DEQ+K+MGLNKAGPFK +YY
Sbjct:   458 HLATFDAHLTELTDEQSKFMGLNKAGPFKANYY 490


GO:0004013 "adenosylhomocysteinase activity" evidence=ISS;NAS
GO:0006730 "one-carbon metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
FB|FBgn0035371 CG9977 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7I1 AHCYL1 "Adenosylhomocysteinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1522 zgc:158222 "zgc:158222" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWH2 AHCYL1 "Adenosylhomocysteinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2REN0 AHCYL1 "Adenosylhomocysteinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43865 AHCYL1 "Putative adenosylhomocysteinase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S610 AHCYL1 "Adenosylhomocysteinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2385184 Ahcyl1 "S-adenosylhomocysteine hydrolase-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309768 Ahcyl1 "adenosylhomocysteinase-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B9MD45SAHH_ACIET3, ., 3, ., 1, ., 10.53490.50920.5798yesN/A
Q7NZF7SAHH_CHRVO3, ., 3, ., 1, ., 10.59000.47410.5515yesN/A
Q3B0K7SAHH_SYNS93, ., 3, ., 1, ., 10.54040.49440.5630yesN/A
Q7UZN3SAHH_PROMP3, ., 3, ., 1, ., 10.55980.47040.5402yesN/A
Q3A392SAHH_PELCD3, ., 3, ., 1, ., 10.55720.47780.5452yesN/A
Q62G22SAHH_BURMA3, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
A9KD88SAHH_COXBN3, ., 3, ., 1, ., 10.57470.47410.5867yesN/A
Q3JY79SAHH_BURP13, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
Q63PT2SAHH_BURPS3, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
Q2STU0SAHH_BURTA3, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
A6T2Y9SAHH_JANMA3, ., 3, ., 1, ., 10.54400.47410.5365yesN/A
A1V8Z2SAHH_BURMS3, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
Q82WL1SAHH_NITEU3, ., 3, ., 1, ., 10.56480.47230.5355yesN/A
Q7VUL8SAHH_BORPE3, ., 3, ., 1, ., 10.51390.52210.5995yesN/A
Q1CY84SAHH_MYXXD3, ., 3, ., 1, ., 10.51040.50730.5777yesN/A
A2S6W2SAHH_BURM93, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
Q96HN2SAHH3_HUMAN3, ., 3, ., 1, ., 10.80950.48520.4304yesN/A
Q68FL4SAHH3_MOUSE3, ., 3, ., 1, ., 10.80950.48520.4290yesN/A
Q0IDX7SAHH_SYNS33, ., 3, ., 1, ., 10.53670.49440.5630yesN/A
A5GI30SAHH_SYNPW3, ., 3, ., 1, ., 10.55140.49440.5630yesN/A
Q318B6SAHH_PROM93, ., 3, ., 1, ., 10.55980.47040.5402yesN/A
A3MQW7SAHH_BURM73, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
Q7V926SAHH_PROMM3, ., 3, ., 1, ., 10.53670.49440.5630yesN/A
B2T6X2SAHH_BURPP3, ., 3, ., 1, ., 10.56700.47410.5433yesN/A
A3PFB5SAHH_PROM03, ., 3, ., 1, ., 10.55590.47040.5402yesN/A
A4G975SAHH_HERAR3, ., 3, ., 1, ., 10.54780.47410.5365yesN/A
C5CM29SAHH_VARPS3, ., 3, ., 1, ., 10.51040.50730.5741yesN/A
Q13T36SAHH_BURXL3, ., 3, ., 1, ., 10.57080.47410.5433yesN/A
Q83A77SAHH_COXBU3, ., 3, ., 1, ., 10.57080.47410.5867yesN/A
Q60CG8SAHH_METCA3, ., 3, ., 1, ., 10.56610.49440.5677yesN/A
A2SL00SAHH_METPP3, ., 3, ., 1, ., 10.52090.50730.5765yesN/A
A8G7D1SAHH_PROM23, ., 3, ., 1, ., 10.55590.47040.5402yesN/A
Q3ANF4SAHH_SYNSC3, ., 3, ., 1, ., 10.54410.49440.5630yesN/A
A2C620SAHH_PROM33, ., 3, ., 1, ., 10.53670.49440.5630yesN/A
B6J6H1SAHH_COXB13, ., 3, ., 1, ., 10.57470.47410.5867yesN/A
Q7U9Y3SAHH_SYNPX3, ., 3, ., 1, ., 10.54040.49440.5630yesN/A
B6J3R0SAHH_COXB23, ., 3, ., 1, ., 10.57080.47410.5867yesN/A
A3NER1SAHH_BURP63, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
A9BD69SAHH_PROM43, ., 3, ., 1, ., 10.54770.49440.5630yesN/A
B2JIP4SAHH_BURP83, ., 3, ., 1, ., 10.57850.47410.5433yesN/A
A1WXM7SAHH_HALHL3, ., 3, ., 1, ., 10.55880.49440.6232yesN/A
A3P0L8SAHH_BURP03, ., 3, ., 1, ., 10.54000.52210.5983yesN/A
P61617SAHH_GEOSL3, ., 3, ., 1, ., 10.52610.52210.5957yesN/A
A1W3P0SAHH_ACISJ3, ., 3, ., 1, ., 10.53140.50920.5798yesN/A
A9C184SAHH_DELAS3, ., 3, ., 1, ., 10.51390.50730.5777yesN/A
Q0AEV8SAHH_NITEC3, ., 3, ., 1, ., 10.56870.47230.5355yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.3.10.691
3rd Layer3.3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 0.0
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-153
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-137
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 1e-133
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-130
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 1e-118
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 1e-103
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 1e-100
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 2e-98
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 4e-97
smart00996 426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 1e-66
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 3e-62
pfam05221 430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 2e-56
cd00401 402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 6e-56
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-55
PRK05476 425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-52
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 5e-52
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 1e-50
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 4e-46
COG0499 420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 3e-44
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 4e-42
TIGR00936 407 TIGR00936, ahcY, adenosylhomocysteinase 2e-39
PTZ00075 476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-36
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-36
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 2e-32
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 3e-31
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 2e-30
PLN02494 477 PLN02494, PLN02494, adenosylhomocysteinase 3e-27
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 5e-26
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 5e-13
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 1e-11
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 3e-10
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 2e-08
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 9e-08
cd12154 310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 3e-07
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 4e-07
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 1e-06
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 6e-06
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 1e-05
pfam01262150 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, 3e-05
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 5e-05
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 2e-04
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 3e-04
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 3e-04
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 7e-04
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 7e-04
PRK00045423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 8e-04
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 9e-04
cd12177321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 9e-04
pfam02254116 pfam02254, TrkA_N, TrkA-N domain 0.001
cd12157318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 0.001
PLN02928347 PLN02928, PLN02928, oxidoreductase family protein 0.002
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
 Score =  517 bits (1335), Expect = 0.0
 Identities = 164/264 (62%), Positives = 200/264 (75%), Gaps = 3/264 (1%)

Query: 33  AAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGC 92
             GKL  PA+NVNDSVTK+KFDNLY CRES++D +KR+TDVM  GK  V+CGYG+VGKGC
Sbjct: 163 KKGKLLFPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVCGYGDVGKGC 222

Query: 93  CQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMD 152
            QSL+G G  + +TEIDPICALQA MDGF VV + EV    DI VT TGNK+V+TREHM 
Sbjct: 223 AQSLRGQGARVIVTEIDPICALQAAMDGFEVVTMEEVAPQADIFVTTTGNKDVITREHMR 282

Query: 153 KMKNGCVVCNMGHSNTEIDVNSLRT-PDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNL 211
            MK+G +VCN+GH + EIDV SLR  P L WE ++ QVDH+ +PDGKRI+LLAEGRLVNL
Sbjct: 283 AMKDGAIVCNIGHFDNEIDVASLRNNPGLKWENIKPQVDHITFPDGKRIILLAEGRLVNL 342

Query: 212 SCSSL-PSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHL 270
            C++  PSFV+S +   Q LA IELF  P G+YK+ VY+LPKK+DE VA LHL    A L
Sbjct: 343 GCATGHPSFVMSNSFTNQVLAQIELFTKP-GKYKNGVYVLPKKLDEKVARLHLEKLGAKL 401

Query: 271 TELSDEQAKYMGLNKAGPFKPSYY 294
           T+L+ EQA Y+G+   GPFKP +Y
Sbjct: 402 TKLTKEQADYIGVPVEGPFKPDHY 425


Length = 426

>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 542
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
KOG1370|consensus434 100.0
PLN02494477 adenosylhomocysteinase 100.0
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 100.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
KOG1370|consensus 434 100.0
PLN02494477 adenosylhomocysteinase 100.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 100.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 100.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 100.0
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 99.97
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.71
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.67
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.65
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.62
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.62
PRK06487317 glycerate dehydrogenase; Provisional 99.57
PRK06932314 glycerate dehydrogenase; Provisional 99.55
PLN02928347 oxidoreductase family protein 99.55
PLN03139386 formate dehydrogenase; Provisional 99.54
PRK07574385 formate dehydrogenase; Provisional 99.53
PRK13243333 glyoxylate reductase; Reviewed 99.52
PLN02306386 hydroxypyruvate reductase 99.52
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.51
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.51
KOG0068|consensus406 99.49
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.49
KOG0069|consensus336 99.49
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.48
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 99.48
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.4
PRK06436303 glycerate dehydrogenase; Provisional 99.29
PRK12480330 D-lactate dehydrogenase; Provisional 99.29
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.25
PRK08605332 D-lactate dehydrogenase; Validated 99.19
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.18
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.17
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.16
KOG0024|consensus354 99.06
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.01
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.01
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.98
KOG0068|consensus406 98.92
PRK06487317 glycerate dehydrogenase; Provisional 98.92
PRK06932314 glycerate dehydrogenase; Provisional 98.91
PRK13403335 ketol-acid reductoisomerase; Provisional 98.91
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.88
PLN03139386 formate dehydrogenase; Provisional 98.85
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.85
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.84
PRK07574385 formate dehydrogenase; Provisional 98.76
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.73
PLN02928347 oxidoreductase family protein 98.73
PLN02306386 hydroxypyruvate reductase 98.7
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.66
PRK09880343 L-idonate 5-dehydrogenase; Provisional 98.65
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 98.65
PRK13243333 glyoxylate reductase; Reviewed 98.65
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.63
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.62
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.55
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.53
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.5
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.46
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.44
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 98.44
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.43
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 98.43
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.42
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.41
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.39
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 98.37
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 98.36
PLN02178375 cinnamyl-alcohol dehydrogenase 98.36
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.34
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 98.33
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 98.33
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.33
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.31
PRK05479330 ketol-acid reductoisomerase; Provisional 98.31
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 98.3
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.29
PLN02586360 probable cinnamyl alcohol dehydrogenase 98.28
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.28
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.28
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 98.27
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 98.26
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 98.23
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.2
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.19
PRK12480330 D-lactate dehydrogenase; Provisional 98.18
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 98.16
PLN02827378 Alcohol dehydrogenase-like 98.14
PRK05225487 ketol-acid reductoisomerase; Validated 98.14
KOG0022|consensus375 98.13
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.13
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 98.12
PRK06436303 glycerate dehydrogenase; Provisional 98.11
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.11
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 98.11
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.1
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.1
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.1
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 98.09
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.09
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.09
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.09
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.08
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 98.07
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.07
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.06
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.06
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.06
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 98.06
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.05
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 98.04
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 98.04
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
PLN02514357 cinnamyl-alcohol dehydrogenase 98.03
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.03
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.01
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.0
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.0
PLN02740381 Alcohol dehydrogenase-like 98.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.98
KOG0069|consensus336 97.98
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 97.98
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.96
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.95
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.94
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 97.94
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.92
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.92
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.92
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.88
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.86
PRK08605332 D-lactate dehydrogenase; Validated 97.86
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.86
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.84
PRK07417279 arogenate dehydrogenase; Reviewed 97.83
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.82
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.81
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 97.8
KOG0023|consensus360 97.79
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.79
PLN00203519 glutamyl-tRNA reductase 97.79
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 97.77
PLN02712667 arogenate dehydrogenase 97.77
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 97.75
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 97.75
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.74
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.71
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 97.71
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 97.7
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.7
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 97.69
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 97.68
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.65
PLN02256304 arogenate dehydrogenase 97.64
PRK07340304 ornithine cyclodeaminase; Validated 97.63
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.62
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 97.62
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.6
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 97.57
PRK08618325 ornithine cyclodeaminase; Validated 97.57
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.56
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 97.56
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 97.56
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 97.55
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 97.54
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.54
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.53
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.53
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.53
PRK08507275 prephenate dehydrogenase; Validated 97.52
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 97.5
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 97.49
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.49
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 97.48
PRK14982340 acyl-ACP reductase; Provisional 97.47
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 97.47
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.47
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 97.47
PRK06545359 prephenate dehydrogenase; Validated 97.44
PRK13940414 glutamyl-tRNA reductase; Provisional 97.44
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.44
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.43
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 97.43
PLN02688266 pyrroline-5-carboxylate reductase 97.43
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 97.42
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 97.42
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.42
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.39
PRK10083339 putative oxidoreductase; Provisional 97.39
PRK15059292 tartronate semialdehyde reductase; Provisional 97.39
PRK06141314 ornithine cyclodeaminase; Validated 97.38
PRK08655437 prephenate dehydrogenase; Provisional 97.38
PLN02712 667 arogenate dehydrogenase 97.37
PRK14031444 glutamate dehydrogenase; Provisional 97.36
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 97.36
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.35
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 97.34
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 97.33
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.33
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 97.32
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 97.32
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.31
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 97.3
PRK09414445 glutamate dehydrogenase; Provisional 97.29
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.29
PLN02477410 glutamate dehydrogenase 97.28
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.28
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 97.28
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.28
PRK06823315 ornithine cyclodeaminase; Validated 97.27
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.26
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 97.25
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.25
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.24
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.24
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.24
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.24
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 97.23
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 97.2
PLN02858 1378 fructose-bisphosphate aldolase 97.2
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.2
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.19
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.19
PRK14030445 glutamate dehydrogenase; Provisional 97.19
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 97.18
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 97.17
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 97.17
PRK12862763 malic enzyme; Reviewed 97.17
PRK06407301 ornithine cyclodeaminase; Provisional 97.16
PRK12861764 malic enzyme; Reviewed 97.16
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.14
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 97.14
PLN02858 1378 fructose-bisphosphate aldolase 97.14
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.13
PRK06046326 alanine dehydrogenase; Validated 97.13
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.13
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.13
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 97.11
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.11
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 97.1
KOG0067|consensus435 97.1
cd08252336 AL_MDR Arginate lyase and other MDR family members 97.09
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 97.07
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 97.07
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.07
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 97.06
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.06
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.06
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 97.05
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.04
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 97.04
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 97.03
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.03
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 97.02
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 97.02
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.02
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 97.02
PRK07589346 ornithine cyclodeaminase; Validated 97.01
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.01
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 97.01
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 97.01
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 96.98
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.98
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.97
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 96.96
PLN02702364 L-idonate 5-dehydrogenase 96.96
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 96.95
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 96.94
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.93
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 96.93
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 96.93
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 96.92
PRK07680273 late competence protein ComER; Validated 96.92
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 96.92
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 96.91
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 96.91
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.9
PRK07232752 bifunctional malic enzyme oxidoreductase/phosphotr 96.9
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.88
PRK08818370 prephenate dehydrogenase; Provisional 96.86
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.86
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.84
PRK08291330 ectoine utilization protein EutC; Validated 96.83
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 96.82
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 96.81
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.81
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.81
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 96.79
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 96.79
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 96.79
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.77
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 96.77
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.77
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 96.76
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.75
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.75
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.72
KOG0409|consensus327 96.72
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 96.72
PRK06719157 precorrin-2 dehydrogenase; Validated 96.71
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.69
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 96.69
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 96.69
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 96.68
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.68
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.66
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.66
COG0281432 SfcA Malic enzyme [Energy production and conversio 96.65
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.64
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 96.61
PRK13403335 ketol-acid reductoisomerase; Provisional 96.61
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.59
PRK13771334 putative alcohol dehydrogenase; Provisional 96.58
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 96.57
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 96.56
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.56
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 96.55
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.53
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 96.52
COG2130340 Putative NADP-dependent oxidoreductases [General f 96.51
PTZ00354334 alcohol dehydrogenase; Provisional 96.51
PRK06199379 ornithine cyclodeaminase; Validated 96.51
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.49
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.48
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 96.48
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 96.45
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.45
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 96.45
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.43
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 96.43
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.41
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 96.39
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 96.37
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 96.36
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.36
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.35
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.33
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 96.33
PRK03562621 glutathione-regulated potassium-efflux system prot 96.3
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 96.28
PRK10669558 putative cation:proton antiport protein; Provision 96.27
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 96.25
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.25
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 96.22
KOG4230|consensus 935 96.21
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.19
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 96.17
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.16
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.16
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.15
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 96.15
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 96.14
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.13
PRK03659601 glutathione-regulated potassium-efflux system prot 96.13
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.07
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.06
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.05
PRK09496453 trkA potassium transporter peripheral membrane com 96.03
PRK11730715 fadB multifunctional fatty acid oxidation complex 96.01
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 96.0
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 95.99
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.99
PRK04148134 hypothetical protein; Provisional 95.99
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 95.98
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.97
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.96
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 95.96
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 95.95
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.95
PRK12921305 2-dehydropantoate 2-reductase; Provisional 95.95
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.94
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.94
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.93
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 95.91
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 95.9
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 95.89
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 95.86
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 95.85
PTZ00082321 L-lactate dehydrogenase; Provisional 95.81
PRK00048257 dihydrodipicolinate reductase; Provisional 95.79
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 95.78
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 95.76
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.76
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 95.73
PTZ00117319 malate dehydrogenase; Provisional 95.73
PRK11154708 fadJ multifunctional fatty acid oxidation complex 95.73
PRK08324681 short chain dehydrogenase; Validated 95.71
PRK10637457 cysG siroheme synthase; Provisional 95.68
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 95.66
PRK12814652 putative NADPH-dependent glutamate synthase small 95.65
PRK13529563 malate dehydrogenase; Provisional 95.64
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.62
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.62
PLN02353473 probable UDP-glucose 6-dehydrogenase 95.62
KOG1197|consensus336 95.58
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.58
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.57
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 95.57
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 95.57
COG5322351 Predicted dehydrogenase [General function predicti 95.57
KOG2380|consensus480 95.55
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 95.52
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.5
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.47
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.46
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.4
PLN03129581 NADP-dependent malic enzyme; Provisional 95.38
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.36
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.36
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.36
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.36
PRK09496453 trkA potassium transporter peripheral membrane com 95.34
PTZ00317559 NADP-dependent malic enzyme; Provisional 95.32
KOG1201|consensus300 95.3
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.29
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 95.28
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.28
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.27
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 95.18
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.15
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.15
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.06
PRK00779304 ornithine carbamoyltransferase; Provisional 95.05
PRK06223307 malate dehydrogenase; Reviewed 95.04
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.03
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 95.0
PLN02527306 aspartate carbamoyltransferase 94.99
cd08251303 polyketide_synthase polyketide synthase. Polyketid 94.85
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 94.84
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 94.83
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 94.83
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.81
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.79
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 94.77
PRK08265261 short chain dehydrogenase; Provisional 94.76
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 94.74
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 94.73
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.69
PRK13303265 L-aspartate dehydrogenase; Provisional 94.63
PRK06182273 short chain dehydrogenase; Validated 94.61
PLN02602350 lactate dehydrogenase 94.56
PRK05600370 thiamine biosynthesis protein ThiF; Validated 94.53
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.51
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.49
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.49
PRK01713334 ornithine carbamoyltransferase; Provisional 94.48
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 94.45
PRK05993277 short chain dehydrogenase; Provisional 94.42
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.41
CHL00194317 ycf39 Ycf39; Provisional 94.39
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 94.38
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.38
KOG0089|consensus309 94.32
PRK08300302 acetaldehyde dehydrogenase; Validated 94.26
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 94.24
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.23
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.21
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 94.17
PRK06392326 homoserine dehydrogenase; Provisional 94.15
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 94.13
PLN00106323 malate dehydrogenase 94.13
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.11
PRK06349426 homoserine dehydrogenase; Provisional 94.11
PRK12742237 oxidoreductase; Provisional 94.11
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.09
PLN03209576 translocon at the inner envelope of chloroplast su 94.07
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.06
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.01
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 93.99
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 93.95
PRK12779 944 putative bifunctional glutamate synthase subunit b 93.93
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 93.87
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 93.83
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 93.81
PLN02342348 ornithine carbamoyltransferase 93.79
PRK02102331 ornithine carbamoyltransferase; Validated 93.79
PRK07326237 short chain dehydrogenase; Provisional 93.78
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.66
PRK08223287 hypothetical protein; Validated 93.63
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 93.57
PRK05872296 short chain dehydrogenase; Provisional 93.55
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
Probab=100.00  E-value=9e-76  Score=595.67  Aligned_cols=287  Identities=49%  Similarity=0.795  Sum_probs=281.8

Q ss_pred             CccHHHHHHHhCCCCCCCCceeeceecccHHhh-----------------------------------------------
Q psy4626           1 MPGIMALRKRAGDDKPLKNARIVGCTHINAQTA-----------------------------------------------   33 (542)
Q Consensus         1 MP~l~~l~~~~~~~~pl~G~~i~~~lh~~~~tA-----------------------------------------------   33 (542)
                      ||+|++||++|..+|||+|.||++|+|+|+|||                                               
T Consensus        27 MP~L~~iR~~f~~~kPlkG~~i~~~lH~t~kTAvLietL~a~GAeV~~a~cNplSTqD~vaaAl~~~~GipVfA~kGe~~  106 (420)
T COG0499          27 MPVLMAIREEFAEEKPLKGARIAGCLHMTAKTAVLIETLKAGGAEVRWASCNPLSTQDDVAAALAAKEGIPVFAWKGETL  106 (420)
T ss_pred             ChHHHHHHHHHhhcCCCCccEEEEEEeehHHHHHHHHHHHhcCceEEEecCCCCcccHHHHHHHhhccCceEEEEcCCCH
Confidence            999999999999999999999999999999998                                               


Q ss_pred             -----------------------------------------------------------hcccccceeecCchhhhHHHH
Q psy4626          34 -----------------------------------------------------------AGKLTVPAMNVNDSVTKTKFD   54 (542)
Q Consensus        34 -----------------------------------------------------------~~~L~~PV~~vn~s~~K~~fd   54 (542)
                                                                                 +|.|+||+|+||||.+|++||
T Consensus       107 eeY~~~~~~vl~~~p~iiiDDG~D~~~~vh~~~~~l~~~i~G~tEETTTGV~RL~am~~~G~L~fPai~VNDs~tK~~FD  186 (420)
T COG0499         107 EEYYEAIDQVLDWEPNIIIDDGGDLTKLVHLERPELLDAIKGGTEETTTGVHRLRAMEKDGVLKFPAINVNDSVTKSLFD  186 (420)
T ss_pred             HHHHHHHHHHhCcCCCEEEecCcceeeeeecccHHHHHHhcCCCcccchHHHHHHHHHhcCCcccceEeecchhhhcccc
Confidence                                                                       788999999999999999999


Q ss_pred             hHHHHHHHHHHHHHhhcCccccCcEEEEEcCChhHHHHHHHHHhCCCEEEEEeCCchhhhhhhcCCceeeCHHHHhcCCc
Q psy4626          55 NLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVD  134 (542)
Q Consensus        55 ~~~g~~~s~~~ai~r~~~~~l~GktVvViG~G~IG~~vA~~l~~~Ga~Viv~d~dp~r~~~A~~~G~~v~~l~e~l~~aD  134 (542)
                      |+|||+||.|++|+|+|+..++||+|+|+|||+||+++|++|+++||+|+|+|+||.|+.+|.++||++++++++.+.+|
T Consensus       187 NrYGtgqS~~DgI~RaTn~liaGK~vVV~GYG~vGrG~A~~~rg~GA~ViVtEvDPI~AleA~MdGf~V~~m~~Aa~~gD  266 (420)
T COG0499         187 NRYGTGQSLLDGILRATNVLLAGKNVVVAGYGWVGRGIAMRLRGMGARVIVTEVDPIRALEAAMDGFRVMTMEEAAKTGD  266 (420)
T ss_pred             cccccchhHHHHHHhhhceeecCceEEEecccccchHHHHHhhcCCCeEEEEecCchHHHHHhhcCcEEEEhHHhhhcCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCcccCCHHHHhccCCCeEEEeccCCCcccChHhhcCCCcceeeeccceeeEecCCCCEEEEecCCCcccccCC
Q psy4626         135 IVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCS  214 (542)
Q Consensus       135 vVi~atG~~~lI~~e~l~~mk~GailvnvG~g~~eid~~aL~~~~l~v~~~~~~v~~y~~~dg~~I~LLa~GrLvnl~~~  214 (542)
                      |+|+|||++++|+.++|..||+|++++|+|||++|||+..|.....++.++++++++|.++||+.++||++|||+||+++
T Consensus       267 ifiT~TGnkdVi~~eh~~~MkDgaIl~N~GHFd~EI~~~~L~~~~~~~~~vr~~V~ey~l~~Gkri~llaeGRLvNLa~a  346 (420)
T COG0499         267 IFVTATGNKDVIRKEHFEKMKDGAILANAGHFDVEIDVAGLEELAVEKREVRPQVDEYELPDGKRIILLAEGRLVNLAAA  346 (420)
T ss_pred             EEEEccCCcCccCHHHHHhccCCeEEecccccceeccHHHHHHhhhhHhccccCceEEEcCCCCEEEEEecceeeeeccC
Confidence            99999999999999999999999999999999999999999977888999999999999999999999999999999999


Q ss_pred             -CChhHHHhhHHHHHHHHHHHHhcCCCCCCCCccccCChhhHHHHHHhcCCccccccccccHHHHhhcCCCCCCC
Q psy4626         215 -SLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGP  288 (542)
Q Consensus       215 -thp~~vmd~sfa~q~la~~~L~~~~~~~~~~gv~~lp~~~d~~VA~l~L~~lg~~i~~lt~~~a~~lg~~e~~p  288 (542)
                       +||++|||+||++|+|+++|||+++ ++|.++||.||+++|++||+++|++||++||+||++|++||++|+.+|
T Consensus       347 ~GHPs~VMd~SFanQaLa~~~L~~n~-~~~~~~Vy~lP~~lD~~VArl~L~~~G~~i~~Lt~eQ~~Yl~~w~~Gt  420 (420)
T COG0499         347 TGHPSEVMDMSFANQALAQIYLVKNH-GKLEPGVYRLPKELDEEVARLKLEAMGIELDELTEEQAEYLGSWEEGT  420 (420)
T ss_pred             CCCcHHHhhhhHHHHHHHHHHHHhcc-cccCCceeeCcHHHHHHHHHHHHHHhCceeeecCHHHHHHhCCCCCCC
Confidence             4999999999999999999999998 899999999999999999999999999999999999999999999876



>KOG1370|consensus Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>KOG0067|consensus Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 1e-136
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 3e-52
3mtg_A 444 Crystal Structure Of Human S-Adenosyl Homocysteine 6e-47
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 1e-134
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 1e-52
3gvp_A 435 Human Sahh-Like Domain Of Human Adenosylhomocystein 4e-51
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 9e-89
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-27
3d64_A 494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 4e-23
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-80
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 4e-27
3n58_A 464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-23
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 2e-76
3h9u_A 436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 2e-30
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 1e-73
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 8e-22
1v8b_A 479 Crystal Structure Of A Hydrolase Length = 479 3e-17
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 1e-72
1b3r_A 431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 2e-31
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 2e-72
3ond_A 488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 1e-20
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 3e-72
3nj4_A 435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 2e-31
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 3e-72
1d4f_A 431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 2e-31
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 4e-72
1li4_A 432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 2e-31
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 4e-72
1xwf_A 431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 7e-31
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 2e-71
3ce6_A 494 Crystal Structure Of Mycobacterium Tuberculosis S-A 3e-24
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 2e-71
3dhy_A 495 Crystal Structures Of Mycobacterium Tuberculosis S- 3e-24
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 1e-68
1a7a_A 432 Structure Of Human Placental S-adenosylhomocysteine 2e-30
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 2e-68
3g1u_A 437 Crystal Structure Of Leishmania Major S- Adenosylho 2e-30
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure

Iteration: 1

Score = 480 bits (1236), Expect = e-136, Method: Compositional matrix adjust. Identities = 221/273 (80%), Positives = 249/273 (91%) Query: 22 IVGCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVV 81 + G + + AGKL VPAMNVNDSVTK KFDNLY CRESI+D LKR+TDVMFGGKQVV Sbjct: 170 VTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVV 229 Query: 82 LCGYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATG 141 +CGYGEVGKGCC +LK LG ++YITEIDPICALQACMDGF VVKLNEVIR VD+V+T TG Sbjct: 230 VCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTG 289 Query: 142 NKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIV 201 NKNVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+VRSQVDHVIWPDGKR+V Sbjct: 290 NKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVV 349 Query: 202 LLAEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASL 261 LLAEGRL+NLSCS++P+FV+SITA TQALALIEL+NAP GRYK DVYLLPKKMDEYVASL Sbjct: 350 LLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASL 409 Query: 262 HLPTFDAHLTELSDEQAKYMGLNKAGPFKPSYY 294 HLP+FDAHLTEL+D+QAKY+GLNK GPFKP+YY Sbjct: 410 HLPSFDAHLTELADDQAKYLGLNKNGPFKPNYY 442
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 1e-165
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 1e-60
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 2e-59
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 6e-12
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 1e-159
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 2e-53
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 3e-50
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 3e-10
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 1e-159
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 5e-59
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 2e-56
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 1e-11
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 1e-154
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 4e-53
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 4e-51
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 2e-10
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 1e-154
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 2e-54
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 4e-48
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 4e-10
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 1e-152
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 1e-52
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 5e-49
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 2e-10
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 1e-149
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 3e-53
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 3e-49
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 3e-11
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 7e-20
2rir_A300 Dipicolinate synthase, A chain; structural genomic 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 5e-05
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 1e-04
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 2e-04
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 3e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 9e-04
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
 Score =  473 bits (1220), Expect = e-165
 Identities = 219/268 (81%), Positives = 245/268 (91%)

Query: 24  GCTHINAQTAAGKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLC 83
           G   +   + AGKL VPAMNVNDSVTK KFDNLY CRESI+D LKR+TD+MFGGKQVV+C
Sbjct: 167 GVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVC 226

Query: 84  GYGEVGKGCCQSLKGLGCVIYITEIDPICALQACMDGFSVVKLNEVIRTVDIVVTATGNK 143
           GYGEVGKGCC +LK +G ++Y+TEIDPICALQACMDGF +VKLNEVIR VDIV+T TGNK
Sbjct: 227 GYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNK 286

Query: 144 NVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIWPDGKRIVLL 203
           NVVTREH+D+MKN C+VCNMGHSNTEIDV SLRTP+LTWE+VRSQVDHVIWPDGKRIVLL
Sbjct: 287 NVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLL 346

Query: 204 AEGRLVNLSCSSLPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHL 263
           AEGRL+NLSCS++P+FV+SITA TQALALIEL+NAP GRYK DVYLLPKKMDEYVASLHL
Sbjct: 347 AEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHL 406

Query: 264 PTFDAHLTELSDEQAKYMGLNKAGPFKP 291
           PTFDAHLTEL+DEQAKY+GLNK GPFKP
Sbjct: 407 PTFDAHLTELTDEQAKYLGLNKNGPFKP 434


>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query542
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 100.0
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 99.95
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.94
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 99.9
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.58
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.58
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.57
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.55
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.55
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.52
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.5
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.5
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.49
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.49
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.48
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.47
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.47
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.46
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.46
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.46
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.46
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.44
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.43
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.41
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.39
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.39
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.38
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.37
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.36
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.36
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.35
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.33
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.32
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.31
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.31
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.31
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.26
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.26
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.24
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.22
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.07
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.07
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.07
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.06
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 99.02
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.0
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.93
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.88
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.84
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.81
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.8
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.78
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.78
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.73
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 98.71
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.71
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.7
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.7
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 98.68
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.67
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 98.66
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 98.66
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.66
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 98.65
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.65
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 98.65
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.63
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.63
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 98.63
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.62
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.62
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.6
3fbg_A346 Putative arginate lyase; structural genomics, unkn 98.59
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 98.59
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 98.59
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.58
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.58
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.58
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.56
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.56
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 98.56
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 98.56
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.56
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.55
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 98.53
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.52
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.52
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 98.51
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 98.5
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 98.5
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.5
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 98.49
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.49
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 98.48
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.48
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.48
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.48
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.47
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 98.47
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 98.47
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 98.47
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 98.47
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 98.46
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 98.46
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.45
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 98.45
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.44
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 98.43
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.43
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 98.42
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 98.42
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.41
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 98.41
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.41
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 98.41
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.4
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 98.4
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 98.4
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 98.39
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 98.38
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.38
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 98.38
4eye_A342 Probable oxidoreductase; structural genomics, niai 98.38
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.37
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 98.36
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 98.32
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 98.3
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 98.3
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 98.3
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 98.29
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 98.29
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.29
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 98.28
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.28
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.27
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 98.27
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 98.26
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 98.26
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.25
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.25
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.24
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.24
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 98.24
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.24
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.23
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.22
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 98.21
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.21
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.21
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.21
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 98.21
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.21
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.2
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 98.2
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 98.2
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 98.19
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 98.19
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.19
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.18
3l6d_A306 Putative oxidoreductase; structural genomics, prot 98.17
3krt_A456 Crotonyl COA reductase; structural genomics, prote 98.17
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.17
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.17
3qha_A296 Putative oxidoreductase; seattle structural genomi 98.16
3gms_A340 Putative NADPH:quinone reductase; structural genom 98.16
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.15
4ezb_A317 Uncharacterized conserved protein; structural geno 98.15
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 98.15
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.14
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.14
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.14
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.14
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.13
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 98.12
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.12
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 98.12
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.12
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 98.11
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.1
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 98.07
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 98.07
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 98.07
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.06
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 98.06
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.03
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.01
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.0
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.0
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 97.99
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.99
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.98
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.98
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.98
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.97
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.97
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.96
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.96
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.95
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.95
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.94
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.93
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.92
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.92
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.92
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.9
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.9
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.89
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.88
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 97.11
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 97.86
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 97.86
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.84
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.81
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.8
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.79
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.78
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.78
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.77
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.76
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.75
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 97.75
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.74
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.74
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.73
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.72
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.7
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.69
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.68
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.67
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.67
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.66
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.64
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.64
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.63
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.62
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.62
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.6
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 97.58
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.57
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.56
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 97.56
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.56
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.55
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.55
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.54
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.53
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.53
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.52
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.5
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 97.49
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.49
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.48
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.48
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.46
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.46
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.46
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.44
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 97.41
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.38
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.38
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.36
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.35
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.35
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.35
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.35
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.34
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.33
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.31
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.27
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.26
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.25
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 97.23
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 97.22
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.19
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.19
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.18
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.15
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.13
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.12
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 97.1
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 97.08
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.07
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.06
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.04
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.02
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.0
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.99
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.98
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.98
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.97
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 96.94
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 96.94
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 96.94
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.91
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.9
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.9
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.88
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.84
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.83
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.81
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.81
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.8
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 96.8
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.76
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.73
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.71
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.7
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.65
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.64
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.63
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.62
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.61
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.61
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.6
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.6
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.57
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.56
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.53
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.53
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.52
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 96.52
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 96.5
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.49
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 96.48
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.47
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.47
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.43
3tl2_A315 Malate dehydrogenase; center for structural genomi 96.42
3euw_A344 MYO-inositol dehydrogenase; protein structure init 96.41
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.39
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.37
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.37
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.35
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 96.34
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.33
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.32
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.32
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.32
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.31
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 96.3
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.3
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.29
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.24
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.23
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.23
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 96.21
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.19
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 96.18
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.17
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.17
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.16
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.16
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 96.15
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.13
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 96.13
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 96.13
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.09
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.07
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.06
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.05
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.05
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.04
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.04
4eso_A255 Putative oxidoreductase; NADP, structural genomics 96.03
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 95.99
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.97
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.96
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 95.95
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 95.94
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.94
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.93
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.93
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 95.93
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 95.92
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.88
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.88
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 95.87
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 95.86
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.86
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 95.83
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 95.78
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.78
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.77
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 95.75
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 95.73
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.71
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 95.71
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.7
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.67
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.66
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.66
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 95.66
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 95.66
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.66
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 95.65
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.65
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 95.65
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 95.65
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.62
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.62
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.6
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 95.6
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.59
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 95.56
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 95.55
1lnq_A336 MTHK channels, potassium channel related protein; 95.54
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.54
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 95.54
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.54
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 95.51
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 95.51
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 95.5
1xq6_A253 Unknown protein; structural genomics, protein stru 95.5
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.5
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.49
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 95.49
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.48
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 95.47
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 95.45
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.45
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 95.43
1xhl_A297 Short-chain dehydrogenase/reductase family member 95.42
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 95.42
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 95.41
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 95.39
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.36
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.36
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 95.35
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 95.35
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 95.35
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.34
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 95.34
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 95.34
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.34
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 95.32
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.32
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.3
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 95.3
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 95.29
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 95.27
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.27
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.26
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 95.25
1ydw_A362 AX110P-like protein; structural genomics, protein 95.22
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 95.18
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 95.18
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.17
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.15
4had_A350 Probable oxidoreductase protein; structural genomi 95.15
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.14
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.14
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.1
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.09
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 95.07
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 95.06
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.06
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.06
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 95.06
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 95.03
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.02
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 95.01
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 95.01
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 95.01
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 94.99
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 94.99
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 94.98
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 94.98
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 94.96
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 94.95
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 94.94
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 94.92
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.92
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.92
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.91
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.9
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.87
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 94.85
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 94.85
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.85
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.84
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 94.82
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.82
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 94.8
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.79
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 94.79
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.78
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 94.78
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 94.77
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 94.74
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
Probab=100.00  E-value=2.7e-68  Score=565.95  Aligned_cols=259  Identities=56%  Similarity=0.944  Sum_probs=249.2

Q ss_pred             cccccceeecCchhhhHHHHhHHHHHHHHHHHHHhhcCccccCcEEEEEcCChhHHHHHHHHHhCCCEEEEEeCCchhhh
Q psy4626          35 GKLTVPAMNVNDSVTKTKFDNLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICAL  114 (542)
Q Consensus        35 ~~L~~PV~~vn~s~~K~~fd~~~g~~~s~~~ai~r~~~~~l~GktVvViG~G~IG~~vA~~l~~~Ga~Viv~d~dp~r~~  114 (542)
                      |.|.+||++||||++|++|||+|||++|++++++|+++..+.|++|+|+|+|+||+.+|++|+++||+|+++|++|.+..
T Consensus       205 g~L~~PvinVnds~tK~~fDn~yG~~eslvdgI~Ratg~~L~GKTVgVIG~G~IGr~vA~~lrafGa~Viv~d~dp~~a~  284 (464)
T 3n58_A          205 GLLPFPAINVNDSVTKSKFDNKYGCKESLVDGIRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICAL  284 (464)
T ss_dssp             TCCCSCEEECTTSHHHHTTHHHHHHHHHHHHHHHHHHCCCCTTCEEEEECCSHHHHHHHHHHHHTTCEEEEECSSHHHHH
T ss_pred             CCCCCCEEeeccHhhhhhhhhhhcchHHHHHHHHHhcCCcccCCEEEEECcCHHHHHHHHHHHHCCCEEEEEeCCcchhh
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999888


Q ss_pred             hhhcCCceeeCHHHHhcCCcEEEEcCCCcccCCHHHHhccCCCeEEEeccCCCcccChHhhcCCCcceeeeccceeeEec
Q psy4626         115 QACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNSLRTPDLTWEKVRSQVDHVIW  194 (542)
Q Consensus       115 ~A~~~G~~v~~l~e~l~~aDvVi~atG~~~lI~~e~l~~mk~GailvnvG~g~~eid~~aL~~~~l~v~~~~~~v~~y~~  194 (542)
                      ++.+.|+++++++++++.+|+|++++|++++|+.++|+.||+|++++|+||++.|+|.++|..  .++.+++++++.|.+
T Consensus       285 ~A~~~G~~vv~LeElL~~ADIVv~atgt~~lI~~e~l~~MK~GAILINvGRgdvEID~~aL~~--~~~~~ik~~v~~~~~  362 (464)
T 3n58_A          285 QAAMDGFEVVTLDDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRN--LKWTNVKPQVDLIEF  362 (464)
T ss_dssp             HHHHTTCEECCHHHHGGGCSEEEECCSSSSSBCHHHHHHSCTTEEEEECSSSTTTBTCGGGTT--SEEEEEETTEEEEEC
T ss_pred             HHHhcCceeccHHHHHhhCCEEEECCCCccccCHHHHhcCCCCeEEEEcCCCCcccCHHHHHh--CccccccCCeeEEEe
Confidence            888999999999999999999999999999999999999999999999999999999999984  677889999999999


Q ss_pred             CCCCEEEEecCCCcccccCCC-ChhHHHhhHHHHHHHHHHHHhcCCCCCCCCccccCChhhHHHHHHhcCCccccccccc
Q psy4626         195 PDGKRIVLLAEGRLVNLSCSS-LPSFVVSITACTQALALIELFNAPSGRYKSDVYLLPKKMDEYVASLHLPTFDAHLTEL  273 (542)
Q Consensus       195 ~dg~~I~LLa~GrLvnl~~~t-hp~~vmd~sfa~q~la~~~L~~~~~~~~~~gv~~lp~~~d~~VA~l~L~~lg~~i~~l  273 (542)
                      |||+.|+||++|||+||+|++ ||+++||+||++|+|++++||+++ ++|+++||.||+++|++||++||++||++||+|
T Consensus       363 ~~g~~i~lLaeGrlvNL~~a~GhP~~vm~~sf~~Q~la~~~l~~~~-~~~~~~v~~lP~~lDe~VA~l~L~~~g~~l~~l  441 (464)
T 3n58_A          363 PDGKRLILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTRT-DAYKNEVYVLPKHLDEKVARLHLDKLGAKLTVL  441 (464)
T ss_dssp             TTSCEEEEEGGGSBHHHHHSCCSCHHHHHHHHHHHHHHHHHHHHSG-GGCCSSEECCCHHHHHHHHHHHHGGGTCCCCCC
T ss_pred             CCCCEEEEEeCCceecccCCCCChHHHHhHHHHHHHHHHHHHHhCc-cccCCCeeECCHHHHHHHHHHHHHHcCCEeccC
Confidence            999999999999999999995 999999999999999999999998 789999999999999999999999999999999


Q ss_pred             cHHHHhhcCCCCCCCCCCCcccc
Q psy4626         274 SDEQAKYMGLNKAGPFKPSYYSM  296 (542)
Q Consensus       274 t~~~a~~lg~~e~~p~~a~ea~m  296 (542)
                      |++|++|||+|..+|||...+++
T Consensus       442 t~~Q~~yl~~~~~gp~k~~~yry  464 (464)
T 3n58_A          442 SEEQAAYIGVTPQGPFKSEHYRY  464 (464)
T ss_dssp             CHHHHHHHTCCTTSCCSCTTCCC
T ss_pred             CHHHHHHcCCCCCCCCCCccCCC
Confidence            99999999999999999987653



>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 542
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 7e-68
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 6e-32
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 8e-61
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 5e-28
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 1e-39
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 8e-27
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 3e-11
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 6e-10
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 3e-32
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 2e-22
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 3e-11
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 6e-06
d2fy8a1129 c.2.1.9 (A:116-244) Potassium channel-related prot 4e-05
d1id1a_153 c.2.1.9 (A:) Rck domain from putative potassium ch 5e-05
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 2e-04
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 4e-04
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 0.003
d1edza1171 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy 0.004
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Formate/glycerate dehydrogenases, NAD-domain
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]
 Score =  214 bits (546), Expect = 7e-68
 Identities = 85/161 (52%), Positives = 114/161 (70%), Gaps = 1/161 (0%)

Query: 55  NLYMCRESIIDSLKRSTDVMFGGKQVVLCGYGEVGKGCCQSLKGLGCVIYITEIDPICAL 114
           N+Y CR S+ D L R+TD +  GK VV+CGYG+VGKGC  S+KGLG  +YITEIDPICA+
Sbjct: 1   NVYGCRHSLPDGLMRATDFLISGKIVVICGYGDVGKGCASSMKGLGARVYITEIDPICAI 60

Query: 115 QACMDGFSVVKLNEVIRTVDIVVTATGNKNVVTREHMDKMKNGCVVCNMGHSNTEIDVNS 174
           QA M+GF+VV L+E++   D  +T TGN +V+  EH+ KMKN  VV N+GH + EI VN 
Sbjct: 61  QAVMEGFNVVTLDEIVDKGDFFITCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNE 120

Query: 175 LRT-PDLTWEKVRSQVDHVIWPDGKRIVLLAEGRLVNLSCS 214
           L     +  E V+ QVD +  P+G +I++LA GRL+NL C+
Sbjct: 121 LFNYKGIHIENVKPQVDRITLPNGNKIIVLARGRLLNLGCA 161


>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 129 Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query542
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 99.96
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.96
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.53
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.53
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.52
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.5
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.44
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.44
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.42
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.39
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.37
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.37
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.12
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.1
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.04
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.02
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.02
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.0
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.97
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 98.96
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.94
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.93
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.86
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.83
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.8
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.77
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.73
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.73
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.72
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.7
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.69
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.61
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.5
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.49
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.48
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 98.46
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.45
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.42
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.42
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.38
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.32
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.29
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 98.25
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.23
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.18
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.15
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.15
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.14
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 98.14
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 98.13
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.12
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.12
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.1
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.04
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 98.0
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.98
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.98
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.95
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.89
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 97.87
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.84
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.83
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.82
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.82
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.79
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.79
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.75
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.75
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.69
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.61
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.61
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.56
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.54
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.49
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.45
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.42
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.36
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.35
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.2
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.19
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.15
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.14
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.13
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.13
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.11
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 97.05
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.02
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 97.01
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.01
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 97.0
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.95
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.93
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.91
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.9
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.89
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.88
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.82
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.75
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.69
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.64
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.63
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.62
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.58
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.53
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.52
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.51
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.49
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.49
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.48
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.47
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.45
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.43
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.41
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.39
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.37
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.35
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.29
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 96.28
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.25
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.24
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.15
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.08
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.07
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.04
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.04
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.03
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.01
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.01
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.01
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 95.99
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 95.97
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.94
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.9
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.88
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.85
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.84
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 95.84
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.83
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.81
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.8
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.8
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.8
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.79
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 95.77
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.71
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.69
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.68
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 95.65
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.62
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.62
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.61
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 95.61
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.53
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 95.44
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.43
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.38
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.37
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.34
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.32
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.3
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.3
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.25
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.23
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 95.17
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.08
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.08
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.06
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.06
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 95.05
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.04
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.94
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 94.88
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 94.83
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 94.78
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.75
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.72
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.68
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 94.62
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.53
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.46
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.45
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 94.44
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.43
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.37
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.33
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.26
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 94.21
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 94.18
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.14
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.14
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.13
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.12
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 94.11
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.01
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 93.99
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.96
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 93.96
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 93.77
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.77
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.76
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.72
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.69
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 93.66
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.57
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 93.55
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 93.46
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 93.45
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 93.45
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 93.44
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.42
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 93.39
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 93.34
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.31
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 93.26
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 93.18
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.15
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.13
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.1
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.08
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.04
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.03
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 92.97
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.87
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 92.86
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.79
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 92.75
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.59
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 92.55
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.54
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 92.5
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.45
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.28
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 92.14
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 92.14
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.11
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 92.06
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.0
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 91.84
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.75
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.74
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.67
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.66
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.65
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.61
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 91.6
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 91.44
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 91.42
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.4
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 91.37
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 91.29
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.21
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 91.18
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 91.02
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 90.96
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 90.9
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.75
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 90.63
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.54
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 90.37
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 90.36
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 90.25
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.22
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 90.12
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.06
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.03
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.99
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 89.92
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.78
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 89.73
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 89.65
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 89.65
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 89.65
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.47
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 89.46
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 89.22
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.18
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 89.17
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.06
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 89.04
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 88.92
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 88.86
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 88.81
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 88.74
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 88.72
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.72
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 88.67
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.6
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 88.57
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 88.53
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 88.42
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 88.33
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 88.3
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 88.2
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 88.12
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 88.05
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 87.89
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 87.79
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 87.77
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 87.72
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.44
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 87.38
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 87.21
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 87.06
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 86.96
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 86.93
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 86.87
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.85
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 86.39
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.17
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 86.06
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 85.78
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 85.65
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 85.48
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 85.42
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.34
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 85.19
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 85.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 84.98
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 84.88
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 84.82
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 84.79
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 84.7
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 84.56
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 84.25
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 84.17
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 84.06
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.05
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 83.87
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.78
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.74
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 83.52
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 83.47
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 83.36
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 83.32
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 83.02
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 82.97
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 82.8
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 82.75
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 82.74
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 82.16
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 81.89
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 81.59
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.38
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 81.05
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.01
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 80.7
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 80.22
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.2
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.1e-43  Score=345.70  Aligned_cols=106  Identities=49%  Similarity=0.926  Sum_probs=101.6

Q ss_pred             CCCCcEEeecCCCHHHHHHHHHHHhh--cCCCceeecCCCchhhhhhhhccccccccceeccchhhHHHHHHHHHHcCCc
Q psy4626         436 YTGLPVFAWRGETEEDFWWCIDKCVN--SWQPNMILDDGGDATHWMLKKYPTMFKAIKGIVEESLTGVHRLYQLSKAGKL  513 (542)
Q Consensus       436 ~~g~~v~a~~g~~~~ey~~~~~~~~~--~~~p~~i~ddg~d~~~~~h~~~~~~~~~~~g~~eetttgv~~l~~~~~~g~l  513 (542)
                      +.|||||||||||+||||||++++|+  +++||||+||||||+.++|++||+++++|+|+||||||||+|||+|+++|.|
T Consensus        92 ~~Gi~VfA~~g~~~eey~~~~~~~L~~~~~~P~liiDDG~Dl~~~~h~~~~~~~~~i~G~~EETTTGV~RL~am~~~g~L  171 (267)
T d1li4a2          92 KAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGIL  171 (267)
T ss_dssp             HTTCCEEECTTCCHHHHHHHHHTTTEETTEECSEEEESSSHHHHHHHHHCGGGGGGCCEEEECSHHHHHHHHHHHHTTCC
T ss_pred             cCCceEEEecCCCHHHHHHHHHHHHhccCCCCcEEEehhhhHHHhhhhhcccccCccEEecccccHHHHHHHHHHHCCCC
Confidence            36999999999999999999999993  3459999999999999999999999999999999999999999999999999


Q ss_pred             ccceeeeccccccccccccCCCCcccCC
Q psy4626         514 TVPAMNVNDSVTKTKFDNLYMCRESIID  541 (542)
Q Consensus       514 ~~p~i~vnd~~~k~~fdn~yg~~~s~~d  541 (542)
                      +||+||||||+|||+|||+|||+||.+|
T Consensus       172 ~fP~i~VNDa~tK~~F~~~~~~~~Sf~~  199 (267)
T d1li4a2         172 KVPAINVNDSVTKSKFHPSFVMSNSFTN  199 (267)
T ss_dssp             CSEEEECTTSHHHHTTSCHHHHHHHHHH
T ss_pred             CcceEECCCcchhhhcchhHHHHHHHHH
Confidence            9999999999999999999999999875



>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure