Psyllid ID: psy4644

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCEEK
cccEEEEEccccEEEEcHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccEEEEcHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHccccccc
ccEEEEEEccccEEEEcHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHcc
mpniklqssdgeifnvDFEIAKSSVTIKTMVEdlglededeeivplpnvnsAILRKVIQWAtyhkddppppeddenkekrtddisswdadFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANmikgktpeEIRKTFNIKNDFTQAEEEQVRKENEWCTLFELILAANYldikglededeeivplpnvnsailrkssdgeifnvDFEIAKSSVTIKTMVEdlglededeeivplpnvnsAILRKVIQWAtyhkddppppeddenkekrtddisswdadFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANmikgktpeEIRKTFNIKNDFTQAEEEQVRKENEWCEEK
mpniklqssdgeifnVDFEIAKSSVTIKTMVEDLglededeeivplpnvnSAILRKVIQWAtyhkddppppeddenkeKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANmikgktpeeirktfnIKNDFTQAEEEQVRKENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVdfeiakssvtIKTMVEDLglededeeivplpnvnSAILRKVIQWAtyhkddppppeddenkeKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANmikgktpeeirktfnikndftqAEEEqvrkenewceek
MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVedlglededeeIVPLPNVNSAILRKVIQWATYHkddppppeddenkekRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVedlglededeeIVPLPNVNSAILRKVIQWATYHkddppppeddenkekRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCEEK
************************************************VNSAILRKVIQWATY**********************SWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFT******VRKENEWCTLFELILAANYLDI***************************EIFNVDFEIAKSSVTIK********************VNSAILRKVIQWATY**********************SWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTP*EIRKTFNI**********************
MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQ*********NEWCTLFEL***************************AILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAE*E*VRKENEWC*E*
********SDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDD***************DISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQ********ENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDD***************DISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQ****************
*PNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKD**************TDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKD**************TDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCEEK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCTLFELILAANYLDIKGLEDEDEEIVPLPNVNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWCEEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
Q71U00163 S-phase kinase-associated N/A N/A 0.452 0.975 0.856 1e-66
Q5R512163 S-phase kinase-associated no N/A 0.452 0.975 0.856 1e-66
Q4R5B9163 S-phase kinase-associated N/A N/A 0.452 0.975 0.856 1e-66
P63208163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
Q5ZKF5163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
P63209163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
Q3ZCF3163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
Q6PEC4163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
Q9WTX5163 S-phase kinase-associated yes N/A 0.452 0.975 0.856 1e-66
P52285162 SCF ubiquitin ligase comp yes N/A 0.444 0.962 0.654 2e-52
>sp|Q71U00|SKP1_XENLA S-phase kinase-associated protein 1 OS=Xenopus laevis GN=skp1 PE=1 SV=3 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/160 (85%), Positives = 149/160 (93%), Gaps = 1/160 (0%)

Query: 1   MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDE-DEEIVPLPNVNSAILRKVIQ 59
           MP+IKLQSSDGEIF VD EIAK SVTIKTM+EDLG++DE D++ VPLPNVN+AIL+KVIQ
Sbjct: 1   MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ 60

Query: 60  WATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTC 119
           W T+HKDDPPPPEDDENKEKRTDDI  WD +FLKVDQGTLFELILAANYLDIKGLLDVTC
Sbjct: 61  WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC 120

Query: 120 KTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWC 159
           KTVANMIKGKTPEEIRKTFNIKNDFT+ EE QVRKEN+WC
Sbjct: 121 KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC 160
Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1.
Xenopus laevis (taxid: 8355)
>sp|Q5R512|SKP1_PONAB S-phase kinase-associated protein 1 OS=Pongo abelii GN=SKP1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R5B9|SKP1_MACFA S-phase kinase-associated protein 1 OS=Macaca fascicularis GN=SKP1 PE=2 SV=1 Back     alignment and function description
>sp|P63208|SKP1_HUMAN S-phase kinase-associated protein 1 OS=Homo sapiens GN=SKP1 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKF5|SKP1_CHICK S-phase kinase-associated protein 1 OS=Gallus gallus GN=SKP1 PE=2 SV=1 Back     alignment and function description
>sp|P63209|SKP1_CAVPO S-phase kinase-associated protein 1 OS=Cavia porcellus GN=SKP1 PE=2 SV=2 Back     alignment and function description
>sp|Q3ZCF3|SKP1_BOVIN S-phase kinase-associated protein 1 OS=Bos taurus GN=SKP1 PE=2 SV=1 Back     alignment and function description
>sp|Q6PEC4|SKP1_RAT S-phase kinase-associated protein 1 OS=Rattus norvegicus GN=Skp1 PE=2 SV=3 Back     alignment and function description
>sp|Q9WTX5|SKP1_MOUSE S-phase kinase-associated protein 1 OS=Mus musculus GN=Skp1 PE=1 SV=3 Back     alignment and function description
>sp|P52285|SKP1A_DICDI SCF ubiquitin ligase complex protein SKP1a OS=Dictyostelium discoideum GN=fpaA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
357607274162 S-phase kinase-associated protein [Danau 0.441 0.956 0.918 6e-79
225710386162 S-phase kinase-associated protein 1 [Cal 0.441 0.956 0.911 3e-78
389608869162 skpA protein [Papilio xuthus] 0.452 0.981 0.911 5e-78
114052370162 S-phase kinase-associated protein [Bomby 0.441 0.956 0.905 7e-78
225710922162 S-phase kinase-associated protein 1 [Cal 0.441 0.956 0.905 9e-78
290462007162 S-phase kinase-associated protein 1 [Lep 0.441 0.956 0.905 3e-77
444709942328 S-phase kinase-associated protein 1 [Tup 0.792 0.847 0.519 4e-77
225711132162 S-phase kinase-associated protein 1 [Cal 0.441 0.956 0.905 4e-77
157120868162 skp1 [Aedes aegypti] gi|157120870|ref|XP 0.441 0.956 0.880 3e-76
58386527162 AGAP008719-PA [Anopheles gambiae str. PE 0.452 0.981 0.867 3e-74
>gi|357607274|gb|EHJ65429.1| S-phase kinase-associated protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 146/159 (91%), Positives = 154/159 (96%)

Query: 1   MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQW 60
           MPNIKLQSSD EIF+VD EIAK SVTIKTM+EDLG++D++EE+VPLPNVNSAIL+KVIQW
Sbjct: 1   MPNIKLQSSDNEIFDVDVEIAKCSVTIKTMLEDLGMDDDEEEVVPLPNVNSAILKKVIQW 60

Query: 61  ATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK 120
           ATYHKDDPP PEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
Sbjct: 61  ATYHKDDPPLPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK 120

Query: 121 TVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWC 159
           TVANMIKGKTPEEIRKTFNIKNDFT AEEEQVRKENEWC
Sbjct: 121 TVANMIKGKTPEEIRKTFNIKNDFTAAEEEQVRKENEWC 159

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|225710386|gb|ACO11039.1| S-phase kinase-associated protein 1 [Caligus rogercresseyi] gi|225710690|gb|ACO11191.1| S-phase kinase-associated protein 1 [Caligus rogercresseyi] gi|225714348|gb|ACO13020.1| S-phase kinase-associated protein 1 [Lepeophtheirus salmonis] gi|225719430|gb|ACO15561.1| S-phase kinase-associated protein 1 [Caligus clemensi] gi|290561056|gb|ADD37930.1| S-phase kinase-associated protein 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|389608869|dbj|BAM18046.1| skpA protein [Papilio xuthus] Back     alignment and taxonomy information
>gi|114052370|ref|NP_001040518.1| S-phase kinase-associated protein [Bombyx mori] gi|95102716|gb|ABF51299.1| S-phase kinase-associated protein [Bombyx mori] Back     alignment and taxonomy information
>gi|225710922|gb|ACO11307.1| S-phase kinase-associated protein 1 [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|290462007|gb|ADD24051.1| S-phase kinase-associated protein 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|444709942|gb|ELW50937.1| S-phase kinase-associated protein 1 [Tupaia chinensis] Back     alignment and taxonomy information
>gi|225711132|gb|ACO11412.1| S-phase kinase-associated protein 1 [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|157120868|ref|XP_001653700.1| skp1 [Aedes aegypti] gi|157120870|ref|XP_001653701.1| skp1 [Aedes aegypti] gi|170048269|ref|XP_001851731.1| S-phase kinase-associated protein 1A [Culex quinquefasciatus] gi|108874781|gb|EAT39006.1| AAEL009160-PB [Aedes aegypti] gi|108874782|gb|EAT39007.1| AAEL009160-PA [Aedes aegypti] gi|167870384|gb|EDS33767.1| S-phase kinase-associated protein 1A [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|58386527|ref|XP_314827.2| AGAP008719-PA [Anopheles gambiae str. PEST] gi|55239915|gb|EAA10209.2| AGAP008719-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
FB|FBgn0025637162 skpA "skpA" [Drosophila melano 0.452 0.981 0.716 6.1e-55
UNIPROTKB|Q5ZKF5163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|Q3ZCF3163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|P63208163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|P63209163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|Q4R5B9163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|Q5R512163 SKP1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
UNIPROTKB|Q71U00163 skp1 "S-phase kinase-associate 0.452 0.975 0.718 1.3e-54
MGI|MGI:103575163 Skp1a "S-phase kinase-associat 0.452 0.975 0.718 1.6e-54
RGD|1359648163 Skp1 "S-phase kinase-associate 0.452 0.975 0.718 1.6e-54
FB|FBgn0025637 skpA "skpA" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
 Identities = 114/159 (71%), Positives = 122/159 (76%)

Query:     1 MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVXXXXXXXXXXXIVPLPNVNSAILRKVIQW 60
             MP+IKLQSSD EIF+ D +IAK S TIKTM+           IVPLPNVNS ILRKV+ W
Sbjct:     1 MPSIKLQSSDEEIFDTDIQIAKCSGTIKTMLEDCGMEDDENAIVPLPNVNSTILRKVLTW 60

Query:    61 ATYHXXXXXXXXXXXXXXXRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK 120
             A YH               RTDDI SWDADFLKVDQGTLFELILAANYLDIKGLL++TCK
Sbjct:    61 AHYHKDDPQPTEDDESKEKRTDDIISWDADFLKVDQGTLFELILAANYLDIKGLLELTCK 120

Query:   121 TVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWC 159
             TVANMIKGKTPEEIRKTFNIK DF+ AEEEQVRKENEWC
Sbjct:   121 TVANMIKGKTPEEIRKTFNIKKDFSPAEEEQVRKENEWC 159
GO:0045931 "positive regulation of mitotic cell cycle" evidence=IMP
GO:0051298 "centrosome duplication" evidence=IMP
GO:0030261 "chromosome condensation" evidence=IMP
GO:0042023 "DNA endoreduplication" evidence=IMP
GO:0019005 "SCF ubiquitin ligase complex" evidence=IDA;NAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0005819 "spindle" evidence=IDA
GO:0005813 "centrosome" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0010824 "regulation of centrosome duplication" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0031647 "regulation of protein stability" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZKF5 SKP1 "S-phase kinase-associated protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCF3 SKP1 "S-phase kinase-associated protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P63208 SKP1 "S-phase kinase-associated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P63209 SKP1 "S-phase kinase-associated protein 1" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R5B9 SKP1 "S-phase kinase-associated protein 1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R512 SKP1 "S-phase kinase-associated protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q71U00 skp1 "S-phase kinase-associated protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:103575 Skp1a "S-phase kinase-associated protein 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359648 Skp1 "S-phase kinase-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52285SKP1A_DICDINo assigned EC number0.65400.44440.9629yesN/A
Q5KU00SKP1_ASPORNo assigned EC number0.60750.44150.9627yesN/A
Q9WTX5SKP1_MOUSENo assigned EC number0.85620.45290.9754yesN/A
Q6PEC4SKP1_RATNo assigned EC number0.85620.45290.9754yesN/A
Q557E4SKP1B_DICDINo assigned EC number0.65400.44440.9629yesN/A
Q9Y709SKP1_SCHPONo assigned EC number0.57140.44440.9689yesN/A
Q39255SKP1A_ARATHNo assigned EC number0.59110.43870.9625yesN/A
Q5ZKF5SKP1_CHICKNo assigned EC number0.85620.45290.9754yesN/A
Q3ZCF3SKP1_BOVINNo assigned EC number0.85620.45290.9754yesN/A
Q4WTT8SKP1_ASPFUNo assigned EC number0.60370.44440.9873yesN/A
Q5BAX8SKP1_EMENINo assigned EC number0.54710.44440.9689yesN/A
P63209SKP1_CAVPONo assigned EC number0.85620.45290.9754yesN/A
P63208SKP1_HUMANNo assigned EC number0.85620.45290.9754yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
COG5201158 COG5201, SKP1, SCF ubiquitin ligase, SKP1 componen 6e-48
COG5201158 COG5201, SKP1, SCF ubiquitin ligase, SKP1 componen 2e-46
pfam0146678 pfam01466, Skp1, Skp1 family, dimerisation domain 2e-42
pfam0146678 pfam01466, Skp1, Skp1 family, dimerisation domain 2e-41
smart00512104 smart00512, Skp1, Found in Skp1 protein family 5e-40
smart00512104 smart00512, Skp1, Found in Skp1 protein family 1e-37
pfam0393161 pfam03931, Skp1_POZ, Skp1 family, tetramerisation 1e-19
pfam0393161 pfam03931, Skp1_POZ, Skp1 family, tetramerisation 3e-17
pfam0146678 pfam01466, Skp1, Skp1 family, dimerisation domain 0.003
>gnl|CDD|227528 COG5201, SKP1, SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  158 bits (402), Expect = 6e-48
 Identities = 79/158 (50%), Positives = 101/158 (63%), Gaps = 4/158 (2%)

Query: 1   MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQW 60
           M  I+L+S DGEIF VD  IA+ S+ IK M+ D          +P PNV S++L KV +W
Sbjct: 1   MSMIELESIDGEIFRVDENIAERSILIKNMLCDST---ACNYPIPAPNVRSSVLMKVQEW 57

Query: 61  ATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK 120
             +H       E+D    K       WD  F++VDQ  L E+ LAANYL+IK LLD+ CK
Sbjct: 58  MEHHTSSLSEDENDLEIRKSKP-SDFWDRFFMEVDQEMLLEICLAANYLEIKPLLDLGCK 116

Query: 121 TVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEW 158
            VA MI+GK+PEEIR+TFNI+NDFT  EE ++RKENEW
Sbjct: 117 IVAEMIRGKSPEEIRETFNIENDFTPEEERRIRKENEW 154

Length = 158
>gnl|CDD|227528 COG5201, SKP1, SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|201810 pfam01466, Skp1, Skp1 family, dimerisation domain Back     alignment and domain information
>gnl|CDD|201810 pfam01466, Skp1, Skp1 family, dimerisation domain Back     alignment and domain information
>gnl|CDD|214704 smart00512, Skp1, Found in Skp1 protein family Back     alignment and domain information
>gnl|CDD|214704 smart00512, Skp1, Found in Skp1 protein family Back     alignment and domain information
>gnl|CDD|217800 pfam03931, Skp1_POZ, Skp1 family, tetramerisation domain Back     alignment and domain information
>gnl|CDD|217800 pfam03931, Skp1_POZ, Skp1 family, tetramerisation domain Back     alignment and domain information
>gnl|CDD|201810 pfam01466, Skp1, Skp1 family, dimerisation domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
KOG1724|consensus162 100.0
KOG1724|consensus162 100.0
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 100.0
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 100.0
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 99.95
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 99.94
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 99.94
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 99.93
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 99.74
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 99.72
KOG3473|consensus112 99.62
KOG3473|consensus112 99.57
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 98.45
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 98.43
PHA02713 557 hypothetical protein; Provisional 98.28
PHA02713 557 hypothetical protein; Provisional 98.25
PHA02790 480 Kelch-like protein; Provisional 97.96
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 97.89
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 97.87
PHA03098 534 kelch-like protein; Provisional 97.8
PHA03098 534 kelch-like protein; Provisional 97.76
PHA02790 480 Kelch-like protein; Provisional 97.75
KOG4441|consensus 571 97.68
KOG4441|consensus 571 97.56
KOG4682|consensus 488 93.42
KOG4682|consensus488 93.2
KOG4350|consensus 620 92.86
KOG4350|consensus 620 92.74
KOG2716|consensus230 92.46
KOG3433|consensus203 91.23
KOG2716|consensus230 90.27
KOG3433|consensus203 89.64
COG5124209 Protein predicted to be involved in meiotic recomb 87.5
COG5124209 Protein predicted to be involved in meiotic recomb 85.15
KOG0783|consensus 1267 82.89
KOG0783|consensus 1267 81.35
>KOG1724|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.5e-45  Score=312.16  Aligned_cols=160  Identities=62%  Similarity=0.953  Sum_probs=142.3

Q ss_pred             CCccEEEEcCCCCEEEeCHHHHHHhHHHHHHHHhcCCCCCCCCcccCCCCCHHHHHHHHHHHHhcCCCCCCCCCcccccc
Q psy4644         189 VNSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLEDEDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENKEK  268 (351)
Q Consensus       189 ~~~~i~L~S~DG~~f~v~~~~a~~S~~l~~~l~~~~~~~~~~~~Ipl~~v~~~iL~kVi~yc~~h~~~~~~~~~~~~~~~  268 (351)
                      +.++|+|+|+||++|.|+.++|++|.+|++++.+.|..... .+||||+|+|.||++||+||+||++++....+... ..
T Consensus         3 ~~~~ikL~SsDG~~f~ve~~~a~~s~~i~~~~~~~~~~~~~-~~IPl~nV~~~iL~kVIewC~~Hk~d~~~~~~~~~-~~   80 (162)
T KOG1724|consen    3 SKKKIKLESSDGEIFEVEEEVARQSQTISAHMIEDGCADEN-DPIPLPNVTSKILKKVIEWCKKHKDDDPANPEDKE-LP   80 (162)
T ss_pred             CCCeEEEEccCCceeehhHHHHHHhHHHHHHHHHcCCCccC-CccccCccCHHHHHHHHHHHHHccccccccccccc-cc
Confidence            56899999999999999999999999999999988764222 59999999999999999999999987654322100 11


Q ss_pred             ccccccchhhhhhcCChHHHHHHHHhhhccCchhHHHHHHHHHHHHhhCCCHHHHHHHcCCCCCCCHHHHHHHHHhcccc
Q psy4644         269 RTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWC  348 (351)
Q Consensus       269 ~~~~~~~wD~~F~~~~~~~l~~Ll~AA~~L~I~~L~~l~~~~vA~~i~gks~eEir~~f~i~~d~t~eee~~i~~e~~W~  348 (351)
                      ...+++.||++|++++.++||+|+.|||||+|++|+++||++||+|++||||+|||.+|||++|+||||+++++++|.|+
T Consensus        81 ~~~~i~~WD~~Flk~d~~tLfdli~AAnyLdi~gLl~~~ck~va~mikgktpeEir~~f~I~~d~t~eE~~~~~~e~~~~  160 (162)
T KOG1724|consen   81 EETDIPEWDAEFLKVDQGTLFDLILAANYLDIKGLLDLTCKTVANMIKGKTPEEIREIFNIENDETPEEEEAIRKENEWA  160 (162)
T ss_pred             ccCCccHHHHHHHhcCHHHHHHHHHHhhhcccHHHHHHHHHHHHHHHccCCHHHHHHHcCCCCCCChhHHHHHhhccccc
Confidence            23459999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cc
Q psy4644         349 EE  350 (351)
Q Consensus       349 ~~  350 (351)
                      |+
T Consensus       161 ~~  162 (162)
T KOG1724|consen  161 FE  162 (162)
T ss_pred             cC
Confidence            85

>KOG1724|consensus Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG3433|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG3433|consensus Back     alignment and domain information
>COG5124 Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>COG5124 Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
2e31_B166 Structural Basis For Selection Of Glycosylated Subs 2e-59
2e31_B166 Structural Basis For Selection Of Glycosylated Subs 2e-57
2ast_A159 Crystal Structure Of The Skp1-Skp2-Cks1 Complex Len 9e-58
2ast_A159 Crystal Structure Of The Skp1-Skp2-Cks1 Complex Len 5e-56
1fqv_B149 Insights Into Scf Ubiquitin Ligases From The Struct 2e-57
1fqv_B149 Insights Into Scf Ubiquitin Ligases From The Struct 2e-55
1p22_B145 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 7e-57
1p22_B145 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 7e-55
3l2o_A149 Structure-Based Mechanism Of Dimerization-Dependent 2e-56
3l2o_A149 Structure-Based Mechanism Of Dimerization-Dependent 1e-55
1fs1_B141 Insights Into Scf Ubiquitin Ligases From The Struct 8e-53
1fs1_B141 Insights Into Scf Ubiquitin Ligases From The Struct 3e-49
1ldk_D133 Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiqu 2e-48
1ldk_D133 Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiqu 2e-45
2p1m_A160 Tir1-ask1 Complex Structure Length = 160 6e-37
3mks_A169 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-35
1nex_A169 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 2e-34
>pdb|2E31|B Chain B, Structural Basis For Selection Of Glycosylated Substrate By Scffbs1 Ubiquitin Ligase Length = 166 Back     alignment and structure 
Iteration: 1

 Score =  226 bits (575), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/160 (71%), Positives = 123/160 (76%), Gaps = 1/160 (0%)
Query: 1   MPNIKLQSSDGEIFNVDFEIAKSSVTIKTMVXX-XXXXXXXXXIVPLPNVNSAILRKVIQ 59
           MP+IKLQSSDGEIF VD EIAK SVTIKTM+             VPLPNVN+AIL+KVIQ
Sbjct: 4   MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ 63
Query: 60  WATYHXXXXXXXXXXXXXXXRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTC 119
           W T+H               RTDDI  WD +FLKVDQGTLFELILAANYLDIKGLLDVTC
Sbjct: 64  WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC 123
Query: 120 KTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENEWC 159
           KTVANMIKGKTPEEIRKTFNIKNDFT+ EE QVRKEN+WC
Sbjct: 124 KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWC 163
>pdb|2E31|B Chain B, Structural Basis For Selection Of Glycosylated Substrate By Scffbs1 Ubiquitin Ligase Length = 166 Back     alignment and structure
>pdb|1FQV|B Chain B, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 149 Back     alignment and structure
>pdb|1FQV|B Chain B, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 149 Back     alignment and structure
>pdb|1P22|B Chain B, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 145 Back     alignment and structure
>pdb|1P22|B Chain B, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 145 Back     alignment and structure
>pdb|3L2O|A Chain A, Structure-Based Mechanism Of Dimerization-Dependent Ubiquitination By The Scffbx4 Ubiquitin Ligase Length = 149 Back     alignment and structure
>pdb|3L2O|A Chain A, Structure-Based Mechanism Of Dimerization-Dependent Ubiquitination By The Scffbx4 Ubiquitin Ligase Length = 149 Back     alignment and structure
>pdb|1FS1|B Chain B, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 141 Back     alignment and structure
>pdb|1FS1|B Chain B, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 141 Back     alignment and structure
>pdb|1LDK|D Chain D, Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiquitin Ligase Complex Length = 133 Back     alignment and structure
>pdb|1LDK|D Chain D, Structure Of The Cul1-Rbx1-Skp1-F Boxskp2 Scf Ubiquitin Ligase Complex Length = 133 Back     alignment and structure
>pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure Length = 160 Back     alignment and structure
>pdb|3MKS|A Chain A, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 169 Back     alignment and structure
>pdb|1NEX|A Chain A, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 2e-57
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 4e-55
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 1e-56
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 3e-52
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 7e-55
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 6e-54
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 7e-52
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 1e-50
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 2e-31
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 4e-29
2fnj_C96 Transcription elongation factor B polypeptide 1; b 1e-27
2fnj_C96 Transcription elongation factor B polypeptide 1; b 2e-25
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 3e-27
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 4e-25
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Length = 141 Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Length = 141 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Length = 169 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Length = 169 Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Length = 160 Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Length = 160 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Length = 99 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Length = 99 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Length = 96 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Length = 96 Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Length = 112 Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Length = 112 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 100.0
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 100.0
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 100.0
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 100.0
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 100.0
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 100.0
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 100.0
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 100.0
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 99.92
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 99.91
2fnj_C96 Transcription elongation factor B polypeptide 1; b 99.91
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 99.91
2fnj_C96 Transcription elongation factor B polypeptide 1; b 99.91
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 99.9
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.88
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.86
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 98.7
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 98.67
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 98.67
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 98.65
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 98.59
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 98.58
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 98.58
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 98.55
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 98.53
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 98.5
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 98.5
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 98.48
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 98.46
2vpk_A116 Myoneurin; transcription regulation, transcription 98.46
3b84_A119 Zinc finger and BTB domain-containing protein 48; 98.45
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 98.45
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 98.42
2vpk_A116 Myoneurin; transcription regulation, transcription 98.41
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 98.4
3b84_A119 Zinc finger and BTB domain-containing protein 48; 98.39
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 98.39
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 98.37
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 98.35
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 98.32
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 98.31
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 98.3
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 98.24
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 98.23
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 98.23
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 98.22
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 98.21
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 98.2
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 98.12
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 98.12
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 98.1
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 98.06
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 98.02
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 98.0
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 97.98
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 97.97
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 82.16
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-50  Score=348.10  Aligned_cols=161  Identities=52%  Similarity=0.930  Sum_probs=133.8

Q ss_pred             CccEEEEcCCCCEEEeCHHHHHHhHHHHHHHHhcCCCC---CCCCcccCCCCCHHHHHHHHHHHHhcCCCCCCCCCcccc
Q psy4644         190 NSAILRKSSDGEIFNVDFEIAKSSVTIKTMVEDLGLED---EDEEIVPLPNVNSAILRKVIQWATYHKDDPPPPEDDENK  266 (351)
Q Consensus       190 ~~~i~L~S~DG~~f~v~~~~a~~S~~l~~~l~~~~~~~---~~~~~Ipl~~v~~~iL~kVi~yc~~h~~~~~~~~~~~~~  266 (351)
                      +++|+|+|+||++|.|++.+|++|++|++|+++.|.+.   ....+||||+|+|.+|++|++||+||+.++.+.... ..
T Consensus         6 ~~~i~L~SsDG~~F~V~~~vA~~S~tIk~ml~~~~~~~~~~~~~~~IplpnV~s~iL~kVieyc~~h~~~~~~~~~~-~~   84 (169)
T 3v7d_A            6 TSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDD-DD   84 (169)
T ss_dssp             CCEEEEECTTCCEEEEEHHHHTTSHHHHHHHHC-----------CEEECTTCCHHHHHHHHHHHHHTTTCCCCC------
T ss_pred             CCeEEEEeCCCCEEEecHHHHHHhHHHHHHHHhcCcccccccCCCceeeCCCCHHHHHHHHHHHHHcccCCCccccc-cc
Confidence            48999999999999999999999999999999866421   123789999999999999999999999887543211 12


Q ss_pred             ccccccccchhhhhhcCChHHHHHHHHhhhccCchhHHHHHHHHHHHHhhCCCHHHHHHHcCCCCCCCHHHHHHHHHhcc
Q psy4644         267 EKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVRKENE  346 (351)
Q Consensus       267 ~~~~~~~~~wD~~F~~~~~~~l~~Ll~AA~~L~I~~L~~l~~~~vA~~i~gks~eEir~~f~i~~d~t~eee~~i~~e~~  346 (351)
                      ......+++||++|++++...||+||.|||||+|++|+++||++||++|+||||||||++|||++|||||||++||+||+
T Consensus        85 ~~~~~~i~~wD~~Fl~vd~~~LfeLi~AAnyLdIk~Lldl~c~~vA~~ikgktpeeiR~~f~I~nd~t~eEe~~ir~en~  164 (169)
T 3v7d_A           85 SRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENE  164 (169)
T ss_dssp             ---CCCCCHHHHHHTCSCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCHHHHHHHHTCCCCCCHHHHHHHHTTC-
T ss_pred             ccccccccHHHHHHHcCCHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHcCCCHHHHHHHcCCCCCCCHHHHHHHHHhcc
Confidence            23456789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccC
Q psy4644         347 WCEEK  351 (351)
Q Consensus       347 W~~~~  351 (351)
                      |+||.
T Consensus       165 W~~~~  169 (169)
T 3v7d_A          165 WAEDR  169 (169)
T ss_dssp             -----
T ss_pred             ccccC
Confidence            99973
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d1nexa170 a.157.1.1 (A:116-185) Centromere DNA-binding prote 1e-35
d1nexa170 a.157.1.1 (A:116-185) Centromere DNA-binding prote 1e-35
d1nexa170 a.157.1.1 (A:116-185) Centromere DNA-binding prote 0.001
d1fs1b155 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, 5e-30
d1fs1b155 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, 5e-30
d1fs1b155 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, 2e-04
d1hv2a_99 d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomy 5e-29
d1hv2a_99 d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomy 7e-27
d2c9wc196 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens 2e-28
d2c9wc196 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens 3e-26
d1nexa272 d.42.1.1 (A:4-103) Centromere DNA-binding protein 2e-26
d1nexa272 d.42.1.1 (A:4-103) Centromere DNA-binding protein 3e-24
d1fs1b261 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Sk 3e-23
d1fs1b261 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Sk 7e-20
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 70 Back     information, alignment and structure

class: All alpha proteins
fold: Skp1 dimerisation domain-like
superfamily: Skp1 dimerisation domain-like
family: Skp1 dimerisation domain-like
domain: Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  122 bits (308), Expect = 1e-35
 Identities = 46/70 (65%), Positives = 56/70 (80%)

Query: 84  ISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKND 143
           + SWD +FLKVDQ  L+E+ILAANYL+IK LLD  CK VA MI+G++PEEIR+TFNI ND
Sbjct: 1   VDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVND 60

Query: 144 FTQAEEEQVR 153
           FT  EE  +R
Sbjct: 61  FTPEEEAAIR 70
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 70 Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 70 Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 99 Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 99 Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 99.94
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 99.94
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 99.9
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 99.9
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 99.86
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 99.86
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 99.8
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 99.8
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 99.79
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 99.78
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 98.68
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 98.66
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 98.55
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 98.52
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Skp1 dimerisation domain-like
superfamily: Skp1 dimerisation domain-like
family: Skp1 dimerisation domain-like
domain: Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.94  E-value=2.7e-28  Score=176.00  Aligned_cols=70  Identities=66%  Similarity=1.101  Sum_probs=67.6

Q ss_pred             ccchhhhhhcCChHHHHHHHHhhhccCchhHHHHHHHHHHHHhhCCCHHHHHHHcCCCCCCCHHHHHHHH
Q psy4644         273 ISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTQAEEEQVR  342 (351)
Q Consensus       273 ~~~wD~~F~~~~~~~l~~Ll~AA~~L~I~~L~~l~~~~vA~~i~gks~eEir~~f~i~~d~t~eee~~i~  342 (351)
                      +++||++|++++.+.||+|+.|||||+|++|+++||++||++|+||||+|||++|||++||||||+++||
T Consensus         1 i~~wD~~F~~~d~~~L~~li~AAnyL~I~~Ll~l~c~~vA~~ikgkt~eeiR~~f~I~~D~t~eEe~~ir   70 (70)
T d1nexa1           1 VDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIR   70 (70)
T ss_dssp             CCHHHHHHTCSCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHTTCCHHHHHHHHTCCCCCCHHHHHTCC
T ss_pred             CcHHHHHHHhcCHHHHHHHHHHHHHcCcHHHHHHHHHHHHHHHccCCHHHHHHHhCCCCCCCHHHHHhcC
Confidence            4689999999999999999999999999999999999999999999999999999999999999999875
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure