May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen. Pongo abelii (taxid: 9601)
>sp|Q9H3U1|UN45A_HUMAN Protein unc-45 homolog A OS=Homo sapiens GN=UNC45A PE=1 SV=1
Acts as co-chaperone for HSP90. Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell. May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.
Homo sapiens (taxid: 9606)
>sp|Q99KD5|UN45A_MOUSE Protein unc-45 homolog A OS=Mus musculus GN=Unc45a PE=1 SV=2
May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.
Mus musculus (taxid: 10090)
>sp|Q32PZ3|UN45A_RAT Protein unc-45 homolog A OS=Rattus norvegicus GN=Unc45a PE=2 SV=1
May act as co-chaperone for HSP90 (Potential). Prevents the stimulation of HSP90AB1 ATPase activity by AHSA1. Positive factor in promoting PGR function in the cell (By similarity). May be necessary for proper folding of myosin (Potential). Necessary for normal cell proliferation. Necessary for normal myotube formation and myosin accumulation during muscle cell development. May play a role in erythropoiesis in stroma cells in the spleen.
Rattus norvegicus (taxid: 10116)
>sp|Q68F64|UN45B_XENLA Protein unc-45 homolog B OS=Xenopus laevis GN=unc45b PE=2 SV=1
Score = 90.9 bits (224), Expect = 2e-18, Method: Compositional matrix adjust.
Identities = 49/117 (41%), Positives = 68/117 (58%), Gaps = 12/117 (10%)
Query: 2 GTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCN 61
GT GK +A+ GLA++ NP++AFPGER EVVRPL+SLL+ E ++ FE L+AL N
Sbjct: 681 GTDVGKTKASHGLAKIAAVSNPDIAFPGERVYEVVRPLVSLLNTERDGVQNFEALLALTN 740
Query: 62 LAAIGEKQRQRILKEKGPLEVGSSIMAKEGILEMVLVMANTEDILQQKVACECIIAV 118
L+ +K RQ+I+KEK E+ + + N E I Q C C +AV
Sbjct: 741 LSGKSDKLRQKIVKEKALPEIEN------------YMFENHEQIRQAATECMCNLAV 785
Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell assembly.
Xenopus laevis (taxid: 8355)
>sp|D7REX8|UN45B_XENTR Protein unc-45 homolog B OS=Xenopus tropicalis GN=unc45b PE=1 SV=1
Score = 89.7 bits (221), Expect = 5e-18, Method: Compositional matrix adjust.
Identities = 48/117 (41%), Positives = 68/117 (58%), Gaps = 12/117 (10%)
Query: 2 GTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCN 61
GT GK +A+ GLA++ NP++AFPGER EVVRPL+SLL+ E ++ FE L+AL N
Sbjct: 681 GTDVGKIKASHGLAKIAAVSNPDIAFPGERVYEVVRPLVSLLNTERDGIQNFEALLALTN 740
Query: 62 LAAIGEKQRQRILKEKGPLEVGSSIMAKEGILEMVLVMANTEDILQQKVACECIIAV 118
L+ +K RQ+I+KEK E+ + + N E I Q C C +A+
Sbjct: 741 LSGKNDKLRQKIIKEKALPEIEN------------YMFENHEQIRQAATECMCNLAL 785
Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain (By similarity). Plays a role in sarcomere formation during muscle cell development.
Xenopus tropicalis (taxid: 8364)
>sp|Q6DGE9|UN45B_DANRE Protein unc-45 homolog B OS=Danio rerio GN=unc45b PE=1 SV=2
Score = 84.3 bits (207), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 42/86 (48%), Positives = 56/86 (65%)
Query: 2 GTVKGKRQAAQGLARLGITLNPEVAFPGERSLEVVRPLLSLLHPEATALETFEGLMALCN 61
GT KGK +A+ LA++ NPE+AFPGER EVVRPL+SLL + +E FE L L N
Sbjct: 688 GTDKGKIKASHALAKIAAVSNPEIAFPGERIYEVVRPLVSLLGTDRDGMENFEALRGLTN 747
Query: 62 LAAIGEKQRQRILKEKGPLEVGSSIM 87
LA + +K R +ILKEK E+ + +
Sbjct: 748 LAGLNDKLRVKILKEKALPEIENYMF 773
Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain (By similarity). Plays a role in sarcomere formation during muscle cell development. Required for myoseptal integrity, myofiber attachment, motility and craniofacial development.
Danio rerio (taxid: 7955)
>sp|Q8CGY6|UN45B_MOUSE Protein unc-45 homolog B OS=Mus musculus GN=Unc45b PE=1 SV=1
Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.
Mus musculus (taxid: 10090)
>sp|Q8IWX7|UN45B_HUMAN Protein unc-45 homolog B OS=Homo sapiens GN=UNC45B PE=2 SV=1
Acts as a co-chaperone for HSP90 and is required for proper folding of the myosin motor domain. Plays a role in sarcomere formation during muscle cell development.
Homo sapiens (taxid: 9606)
Close Homologs in the Non-Redundant Database Detected by BLAST
Score = 38.8 bits (91), Expect = 1e-04
Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
Query: 78 GPLEVGSSIMAKEGILEMVLVMAN-TEDILQQKVACECIIAVASKKDK 124
GP +VG+++ EG LE +L + +E Q A E + A K+
Sbjct: 73 GPPDVGATLFLSEGFLESLLPLVARSERRKLQLAALELLSAACIDKEC 120
The UNC-45 or small muscle protein 1 of C.elegans is expressed in two forms from different genomic positions in mammals, as a general tissue protein UNC-45a and a specific form Unc-45b expressed only in striated and skeletal muscle. All members carry up to three amino-terminal tetratricopeptide repeat (TPR) domains towards their N-terminal, a UCS domain at the C-terminal that contains a number of Arm repeats pfam00514 and this central region of approximately 400 residues. Both the general form and the muscle form of UNC-45 function in myotube formation through cell fusion. Myofibril formation requires both GC and SM UNC-45, consistent with the fact that the cytoskeleton is necessary for the development and maintenance of organised myofibrils. The S. pombe Rng3p, is crucial for cell shape, normal actin cytoskeleton, and contractile ring assembly, and is essential for assembly of the myosin II-containing progenitors of the contractile ring. Widespread defects in the cytoskeleton are found in null mutants of all three fungal proteins. Mammalian Unc45 is found to act as a specific chaperone during the folding of myosin and the assembly of striated muscle by forming a stable complex with the general chaperone Hsp90. The exact function of this central region is not known. Length = 155
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle
Myofibril formation requires both UNC-45 forms, consistent with the fact that the cytoskeleton is necessary for the development and maintenance of organised myofibrils []. Rng3 (Ring assembly protein 3), the homologue in Schizosaccharomyces pombe, is crucial for cell shape, normal actin cytoskeleton, and contractile ring assembly, and is essential for assembly of the myosin II-containing progenitors of the contractile ring. Widespread defects in the cytoskeleton are found in null mutants of all three fungal proteins []. Mammalian Unc45 is found to act as a specific chaperone during the folding of myosin and the assembly of striated muscle by forming a stable complex with the general chaperone Hsp90 []. All members carry up to three amino-terminal tetratricopeptide repeat (TPR) and a UCS domain at the C terminus that contains a number of Arm repeats. ; PDB: 3OPB_A 3NOW_A.
An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.
An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless
Animal Arm-repeat proteins function in various processes, including intracellular signalling and cytoskeletal regulation, and include such proteins as beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumour suppressor protein, and the nuclear transport factor importin-alpha, amongst others []. A subset of these proteins is conserved across eukaryotic kingdoms. In higher plants, some Arm-repeat proteins function in intracellular signalling like their mammalian counterparts, while others have novel functions []. The 3-dimensional fold of an armadillo repeat is known from the crystal structure of beta-catenin, where the 12 repeats form a superhelix of alpha helices with three helices per unit []. The cylindrical structure features a positively charged grove, which presumably interacts with the acidic surfaces of the known interaction partners of beta-catenin.; GO: 0005515 protein binding; PDB: 2Z6G_A 1IQ1_C 3RZX_A 2C1M_A 3BTR_C 3OQS_A 3TPO_A 1IAL_A 1Q1S_C 1PJM_B ....
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells
26S proteasome non-ATPase regulatory subunit 5 is one of a number of chaperones that are involved in the assembly of the proteasome. The chaperones dissociate before 26S proteasome formation is complete [].; GO: 0044183 protein binding involved in protein folding
>smart00185 ARM Armadillo/beta-catenin-like repeats
Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless
Animal Arm-repeat proteins function in various processes, including intracellular signalling and cytoskeletal regulation, and include such proteins as beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumour suppressor protein, and the nuclear transport factor importin-alpha, amongst others []. A subset of these proteins is conserved across eukaryotic kingdoms. In higher plants, some Arm-repeat proteins function in intracellular signalling like their mammalian counterparts, while others have novel functions []. The 3-dimensional fold of an armadillo repeat is known from the crystal structure of beta-catenin, where the 12 repeats form a superhelix of alpha helices with three helices per unit []. The cylindrical structure features a positively charged grove, which presumably interacts with the acidic surfaces of the known interaction partners of beta-catenin.; GO: 0005515 protein binding; PDB: 2Z6G_A 1IQ1_C 3RZX_A 2C1M_A 3BTR_C 3OQS_A 3TPO_A 1IAL_A 1Q1S_C 1PJM_B ....
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}
