Psyllid ID: psy4713
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 332029290 | 205 | Phosphomevalonate kinase [Acromyrmex ech | 0.951 | 0.478 | 0.602 | 4e-27 | |
| 307173929 | 204 | Phosphomevalonate kinase [Camponotus flo | 0.961 | 0.485 | 0.606 | 1e-26 | |
| 110758071 | 202 | PREDICTED: phosphomevalonate kinase-like | 0.961 | 0.490 | 0.565 | 2e-26 | |
| 380022912 | 202 | PREDICTED: phosphomevalonate kinase-like | 0.961 | 0.490 | 0.545 | 1e-25 | |
| 322784419 | 233 | hypothetical protein SINV_14785 [Solenop | 0.961 | 0.424 | 0.585 | 2e-25 | |
| 350416381 | 202 | PREDICTED: phosphomevalonate kinase-like | 0.951 | 0.485 | 0.602 | 2e-25 | |
| 383856028 | 202 | PREDICTED: phosphomevalonate kinase-like | 0.961 | 0.490 | 0.555 | 4e-25 | |
| 385258410 | 202 | phosphomevalonate kinase [Bombus terrest | 0.951 | 0.485 | 0.591 | 1e-24 | |
| 348540273 | 200 | PREDICTED: phosphomevalonate kinase-like | 0.932 | 0.48 | 0.510 | 2e-24 | |
| 432962696 | 197 | PREDICTED: phosphomevalonate kinase-like | 0.902 | 0.472 | 0.537 | 5e-24 |
| >gi|332029290|gb|EGI69273.1| Phosphomevalonate kinase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 125 bits (313), Expect = 4e-27, Method: Compositional matrix adjust.
Identities = 59/98 (60%), Positives = 76/98 (77%)
Query: 3 QPKLILLFSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGAT 62
+P+ ILLFSGKRKSGKD++TD L R+G+Q IIRLS PIK+HW+K GL++++LLG
Sbjct: 21 KPERILLFSGKRKSGKDYITDILYNRLGAQRSTIIRLSGPIKTHWSKSLGLDINQLLGHG 80
Query: 63 KYKEKYRAEMITWSEAERRKDNGCFIRSAIEMAHAMKK 100
+YKEKYR EM+ WSE RRKD G F R+AI+M +A K
Sbjct: 81 EYKEKYRLEMVKWSEDIRRKDYGYFCRAAIDMYNAWDK 118
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307173929|gb|EFN64677.1| Phosphomevalonate kinase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|110758071|ref|XP_001120920.1| PREDICTED: phosphomevalonate kinase-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380022912|ref|XP_003695278.1| PREDICTED: phosphomevalonate kinase-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|322784419|gb|EFZ11390.1| hypothetical protein SINV_14785 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|350416381|ref|XP_003490928.1| PREDICTED: phosphomevalonate kinase-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383856028|ref|XP_003703512.1| PREDICTED: phosphomevalonate kinase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|385258410|gb|AFI55101.1| phosphomevalonate kinase [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|348540273|ref|XP_003457612.1| PREDICTED: phosphomevalonate kinase-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|432962696|ref|XP_004086743.1| PREDICTED: phosphomevalonate kinase-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| ZFIN|ZDB-GENE-070410-91 | 209 | pmvk "phosphomevalonate kinase | 0.912 | 0.449 | 0.531 | 4.2e-24 | |
| RGD|1310812 | 194 | Pmvk "phosphomevalonate kinase | 0.873 | 0.463 | 0.533 | 3.8e-23 | |
| UNIPROTKB|F1RGP9 | 192 | PMVK "Phosphomevalonate kinase | 0.873 | 0.468 | 0.522 | 1e-22 | |
| MGI|MGI:1915853 | 192 | Pmvk "phosphomevalonate kinase | 0.873 | 0.468 | 0.522 | 1e-22 | |
| UNIPROTKB|F1MY26 | 192 | PMVK "Phosphomevalonate kinase | 0.873 | 0.468 | 0.522 | 1.6e-22 | |
| UNIPROTKB|Q2KIU2 | 192 | PMVK "Phosphomevalonate kinase | 0.873 | 0.468 | 0.522 | 1.6e-22 | |
| UNIPROTKB|Q29081 | 130 | PMVK "Phosphomevalonate kinase | 0.873 | 0.692 | 0.511 | 2.6e-22 | |
| UNIPROTKB|Q15126 | 192 | PMVK "Phosphomevalonate kinase | 0.873 | 0.468 | 0.5 | 9e-22 | |
| UNIPROTKB|E2RQI8 | 192 | PMVK "Uncharacterized protein" | 0.873 | 0.468 | 0.488 | 2.1e-20 | |
| FB|FBgn0032811 | 189 | CG10268 [Drosophila melanogast | 0.854 | 0.465 | 0.528 | 4.4e-20 |
| ZFIN|ZDB-GENE-070410-91 pmvk "phosphomevalonate kinase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
Identities = 50/94 (53%), Positives = 74/94 (78%)
Query: 2 TQPKLILLFSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGA 61
TQP +ILLFSGKRKSGKD++TD + +R+ ++ C I+RLSAP+K +AK + L+ ++L+G+
Sbjct: 14 TQPSIILLFSGKRKSGKDYVTDLIQKRLTAEICCILRLSAPLKEQYAKDHNLDYEELMGS 73
Query: 62 TKYKEKYRAEMITWSEAERRKDNGCFIRSAIEMA 95
+YKE YRA+MI W E +R++D+G F R AI+ A
Sbjct: 74 GQYKESYRADMIHWGEMKRQEDSGFFCRLAIKHA 107
|
|
| RGD|1310812 Pmvk "phosphomevalonate kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RGP9 PMVK "Phosphomevalonate kinase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915853 Pmvk "phosphomevalonate kinase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MY26 PMVK "Phosphomevalonate kinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KIU2 PMVK "Phosphomevalonate kinase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29081 PMVK "Phosphomevalonate kinase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q15126 PMVK "Phosphomevalonate kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RQI8 PMVK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032811 CG10268 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| pfam04275 | 115 | pfam04275, P-mevalo_kinase, Phosphomevalonate kina | 4e-41 | |
| TIGR01223 | 182 | TIGR01223, Pmev_kin_anim, phosphomevalonate kinase | 9e-27 |
| >gnl|CDD|218001 pfam04275, P-mevalo_kinase, Phosphomevalonate kinase | Back alignment and domain information |
|---|
Score = 130 bits (330), Expect = 4e-41
Identities = 48/86 (55%), Positives = 67/86 (77%)
Query: 10 FSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGATKYKEKYR 69
FSGKRKSGKD++T+ L +R+GS C+I+R+S PIK WA+++GL++++LLG YKEKYR
Sbjct: 1 FSGKRKSGKDYVTERLQQRLGSDRCSILRISEPIKEEWARKHGLDLEELLGDGPYKEKYR 60
Query: 70 AEMITWSEAERRKDNGCFIRSAIEMA 95
+MI W E +R+KD G F R+A E A
Sbjct: 61 KDMIKWGEEKRQKDPGFFCRAACEEA 86
|
Phosphomevalonate kinase (EC:2.7.4.2) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This family represents the animal type of the enzyme. The other is the ERG8 type, found in plants and fungi, and some bacteria (see pfam00288). Length = 115 |
| >gnl|CDD|130290 TIGR01223, Pmev_kin_anim, phosphomevalonate kinase, animal type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| PF04275 | 116 | P-mevalo_kinase: Phosphomevalonate kinase ; InterP | 100.0 | |
| TIGR01223 | 182 | Pmev_kin_anim phosphomevalonate kinase, animal typ | 100.0 | |
| PHA02575 | 227 | 1 deoxynucleoside monophosphate kinase; Provisiona | 98.49 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 97.68 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.27 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 97.11 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.95 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.94 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 96.89 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.75 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 96.57 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.53 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.5 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.45 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 96.43 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 96.41 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.4 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 96.29 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 96.18 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 96.14 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 96.12 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.03 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 95.98 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.84 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.84 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.82 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 95.77 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.72 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.7 | |
| PF03976 | 228 | PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR | 95.69 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.69 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 95.65 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 95.5 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 95.49 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 95.45 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 95.39 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 95.38 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 95.37 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 95.34 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.32 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 95.31 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.29 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 95.26 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 95.23 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.2 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 95.17 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 95.16 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 95.14 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 95.13 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 95.09 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.06 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.04 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 95.04 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 95.04 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 95.03 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 95.01 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 95.0 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 94.98 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 94.93 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 94.86 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 94.84 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 94.84 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.77 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 94.74 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 94.73 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 94.7 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 94.67 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 94.66 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 94.6 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 94.45 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.43 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 94.33 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.32 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 94.31 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.22 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.21 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.15 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 93.95 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 93.86 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 93.85 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 93.82 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 93.81 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.66 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 93.62 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 93.57 | |
| PLN02459 | 261 | probable adenylate kinase | 93.55 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 93.54 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 93.51 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.47 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 93.45 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.44 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 93.41 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.39 | |
| PLN02348 | 395 | phosphoribulokinase | 93.36 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 93.33 | |
| PLN02422 | 232 | dephospho-CoA kinase | 93.28 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 93.12 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 93.03 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 93.03 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 92.99 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 92.76 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 92.61 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.59 | |
| PLN02674 | 244 | adenylate kinase | 92.53 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.51 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.51 | |
| PRK08116 | 268 | hypothetical protein; Validated | 92.5 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 92.43 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.41 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 92.39 | |
| PRK12377 | 248 | putative replication protein; Provisional | 92.39 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.32 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 92.32 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 92.3 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 92.28 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.27 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 92.19 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 92.19 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 92.18 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 92.01 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 92.0 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 91.96 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 91.9 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 91.86 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 91.85 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.78 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 91.57 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 91.48 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 91.42 | |
| PRK03839 | 180 | putative kinase; Provisional | 91.37 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 91.35 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 91.16 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 91.12 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 91.12 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 91.11 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 91.01 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 91.0 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 90.91 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 90.9 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.67 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 90.66 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 90.5 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 90.44 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 90.38 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 90.34 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 90.33 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.32 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 90.23 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 90.14 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 90.12 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 90.04 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 89.97 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 89.96 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 89.84 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 89.81 | |
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 89.77 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 89.67 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 89.65 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 89.63 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 89.4 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 89.39 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 89.35 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 89.31 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 89.19 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 89.17 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 89.05 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 89.03 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 89.02 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 88.95 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 88.95 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 88.88 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 88.84 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 88.73 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 88.54 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 88.54 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 88.48 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 88.33 | |
| PRK08181 | 269 | transposase; Validated | 88.24 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 88.12 | |
| PRK06217 | 183 | hypothetical protein; Validated | 88.12 | |
| KOG2170|consensus | 344 | 88.1 | ||
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 88.07 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 88.03 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 87.93 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 87.89 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 87.79 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 87.76 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 87.45 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 87.44 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 87.4 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 87.39 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 87.38 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 87.35 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 87.35 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 87.31 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 87.3 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 87.24 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 87.24 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 87.19 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 87.11 | |
| KOG3347|consensus | 176 | 87.11 | ||
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 87.09 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 87.05 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 87.02 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 86.91 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 86.88 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 86.87 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 86.85 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 86.55 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 86.49 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 86.45 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 86.43 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 86.42 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 86.31 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 86.09 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 86.02 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 85.95 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 85.94 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 85.88 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 85.77 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 85.76 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 85.54 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 85.41 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 85.4 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 85.29 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 84.98 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 84.87 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 84.84 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 84.78 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 84.75 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 84.57 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 84.31 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 84.26 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 84.22 | |
| PRK08727 | 233 | hypothetical protein; Validated | 84.22 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 84.19 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 84.12 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 84.06 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 84.0 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 83.85 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 83.81 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 83.63 | |
| KOG0635|consensus | 207 | 83.51 | ||
| PF05729 | 166 | NACHT: NACHT domain | 83.45 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 83.36 | |
| PLN02772 | 398 | guanylate kinase | 83.03 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 83.02 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 82.96 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 82.94 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 82.78 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 82.72 | |
| COG2326 | 270 | Uncharacterized conserved protein [Function unknow | 82.63 | |
| PRK06526 | 254 | transposase; Provisional | 82.57 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 82.47 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 82.47 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 82.46 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 82.26 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 82.2 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 82.14 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 82.03 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 82.0 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 82.0 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 81.95 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 81.83 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 81.73 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 81.72 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 81.72 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 81.69 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 81.69 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 81.5 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 81.49 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 81.45 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 81.38 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 81.33 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 81.33 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 81.25 | |
| PRK13695 | 174 | putative NTPase; Provisional | 81.2 | |
| TIGR01613 | 304 | primase_Cterm phage/plasmid primase, P4 family, C- | 81.18 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 81.15 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 81.13 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 81.03 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 81.0 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 80.99 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 80.96 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 80.9 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 80.62 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 80.5 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 80.42 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 80.4 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 80.19 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 80.11 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 80.04 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 80.02 |
| >PF04275 P-mevalo_kinase: Phosphomevalonate kinase ; InterPro: IPR005919 Phosphomevalonate kinase (2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-50 Score=290.70 Aligned_cols=86 Identities=50% Similarity=0.953 Sum_probs=67.1
Q ss_pred EecCcCCchhHHHHHHHHHhcccceEEEecchhhHHHHHHHcCccHHHhcCCCCcHHHhHHHHHHHHHHHhccChhhhHH
Q psy4713 10 FSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGATKYKEKYRAEMITWSEAERRKDNGCFIR 89 (103)
Q Consensus 10 ~sGKrksGKDy~a~~l~~~l~~~~~~iv~iS~piK~~yA~~~glDl~~LL~d~~YKE~~R~~mi~wge~~R~~D~g~Fcr 89 (103)
|||||||||||||++|+++|++..+.|||||+|||++||++|||||++||+|++|||+||++||+|||++|++|||||||
T Consensus 1 ~sGkrksGKDy~a~~l~~~l~~~~~~iv~iS~p~K~~yA~~~glDl~~LL~d~~YKE~~R~~mi~w~e~~r~~dp~~Fcr 80 (116)
T PF04275_consen 1 FSGKRKSGKDYCADILASRLGEDNCRIVSISDPIKREYAEAHGLDLDRLLSDRAYKEQYRPDMIAWGEEQRNQDPGFFCR 80 (116)
T ss_dssp EEE-TTSSHHHHHHHHHHHH-TTTEEEE-THHHHHHHHHHTTT-------------SSHHHHHHHHHHHHHHH-TTTTHH
T ss_pred CCCCcCCCchHHHHHHHHHHhhccCcEEEechHHHHHHHHHhCcCHHHHhcCcchHHHHHHHHHHHHHHHHhhCcchHHH
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHH
Q psy4713 90 SAIEMA 95 (103)
Q Consensus 90 ~~~~~~ 95 (103)
++++++
T Consensus 81 ~a~~~~ 86 (116)
T PF04275_consen 81 AAVEEA 86 (116)
T ss_dssp HHSBT-
T ss_pred HHHHhh
Confidence 999887
|
7.4.2 from EC) catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the higher eukaryotic form and the ERG8 type. This model represents the form of the enzyme found in animals. ; GO: 0004631 phosphomevalonate kinase activity, 0006695 cholesterol biosynthetic process, 0005737 cytoplasm; PDB: 3CH4_B. |
| >TIGR01223 Pmev_kin_anim phosphomevalonate kinase, animal type | Back alignment and domain information |
|---|
| >PHA02575 1 deoxynucleoside monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2170|consensus | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >KOG0635|consensus | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG2326 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 103 | ||||
| 3ch4_B | 202 | The Crystal Structure Of Human Phosphomavelonate Ki | 2e-23 |
| >pdb|3CH4|B Chain B, The Crystal Structure Of Human Phosphomavelonate Kinase At 1.8 A Resolution Length = 202 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 2e-34 |
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
Score = 116 bits (291), Expect = 2e-34
Identities = 45/93 (48%), Positives = 65/93 (69%)
Query: 4 PKLILLFSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGATK 63
P+L+LLFSGKRKSGKDF+T+ L R+G+ CA++RLS P+K +A+++GL +LL +
Sbjct: 10 PRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTST 69
Query: 64 YKEKYRAEMITWSEAERRKDNGCFIRSAIEMAH 96
YKE +R +MI W E +R+ D G F R +E
Sbjct: 70 YKEAFRKDMIRWGEEKRQADPGFFCRKIVEGIS 102
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 100.0 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 99.4 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.02 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.82 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.8 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 96.66 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.45 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.36 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.29 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.2 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.19 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.17 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.02 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 95.92 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 95.91 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 95.85 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.78 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 95.77 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 95.76 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 95.74 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 95.73 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.69 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.68 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 95.66 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 95.56 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 95.51 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.47 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 95.46 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 95.38 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 95.37 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 95.36 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.36 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 95.27 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 95.27 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 95.26 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.25 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 95.18 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 95.18 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.17 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 95.16 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 95.12 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 94.92 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 94.92 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 94.91 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.89 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 94.88 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 94.87 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 94.76 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 94.74 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 94.71 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 94.65 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 94.62 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 94.55 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.52 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 94.5 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 94.5 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.5 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 94.4 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 94.38 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.26 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.16 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 94.09 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.09 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 94.09 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 93.97 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.94 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 93.93 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 93.86 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.83 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.78 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 93.68 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.67 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.66 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.65 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 93.58 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 93.57 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 93.54 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 93.53 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 93.47 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 93.45 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 93.28 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 93.14 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 93.11 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.04 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 92.92 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.7 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 92.65 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.6 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.59 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 92.41 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.33 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 92.33 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.25 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 92.15 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 92.06 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 92.02 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 91.97 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 91.86 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.85 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.84 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.84 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 91.81 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 91.7 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 91.68 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 91.67 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.61 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 91.55 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.4 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 91.39 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 91.26 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 91.24 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 91.23 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 91.22 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 91.21 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 91.2 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 91.13 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 91.11 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 91.1 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 91.09 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 91.04 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 90.99 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 90.97 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 90.97 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 90.9 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 90.51 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.45 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 90.43 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 90.43 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 90.42 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 90.38 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 90.33 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 90.16 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 90.09 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 90.06 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 90.04 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 89.97 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 89.92 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 89.85 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 89.81 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 89.79 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 89.73 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 89.68 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.64 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 89.59 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.53 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 89.5 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 89.48 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 89.38 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 89.26 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.25 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 89.21 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 89.18 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 89.15 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 89.07 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.06 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 88.94 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 88.8 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 88.77 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 88.72 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 88.71 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 88.61 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 88.55 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 88.45 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 88.38 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 88.34 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 88.3 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.27 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 88.2 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.14 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 88.07 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 88.0 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 87.99 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 87.89 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 87.52 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 87.51 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 87.48 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 87.42 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 87.3 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 87.19 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 87.1 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 86.91 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 86.83 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 86.82 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 86.73 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 86.67 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 86.66 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 86.5 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 86.45 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 86.45 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 86.18 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 86.08 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 85.93 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 85.87 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 85.85 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 85.82 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 85.79 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 85.68 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 85.44 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 85.37 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 85.18 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 85.18 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 85.16 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 85.04 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 84.97 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 84.91 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 84.78 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 84.72 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 84.67 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 84.6 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 84.56 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 84.25 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 84.19 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 84.18 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 84.03 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 83.82 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 83.8 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 83.54 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 83.36 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 83.25 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 83.12 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 83.01 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 82.96 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 82.84 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 82.84 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 82.69 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 82.67 | |
| 2p6w_A | 213 | VP54, putative glycosyltransferase (mannosyltransf | 82.48 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 82.4 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 82.32 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 82.3 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 82.09 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 81.92 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 81.8 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 81.6 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 81.54 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 81.53 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 81.22 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 81.08 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 81.01 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 80.99 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 80.9 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 80.68 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 80.3 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 80.21 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 80.09 |
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.4e-35 Score=221.12 Aligned_cols=94 Identities=48% Similarity=0.918 Sum_probs=82.5
Q ss_pred CCCCeEEEEEecCcCCchhHHHHHHHHHhcccceEEEecchhhHHHHHHHcCccHHHhcCCCCcHHHhHHHHHHHHHHHh
Q psy4713 1 MTQPKLILLFSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGLEMDKLLGATKYKEKYRAEMITWSEAER 80 (103)
Q Consensus 1 ~~~pklIiL~sGKrksGKDy~a~~l~~~l~~~~~~iv~iS~piK~~yA~~~glDl~~LL~d~~YKE~~R~~mi~wge~~R 80 (103)
|..|++||+||||+||||||||++|.++++...+.+++||+|||++||+++|||+++||+|++|||+||++|+.||++.|
T Consensus 7 ~~~~~~II~itGk~~SGKd~va~~l~~~~g~~~~~vv~msD~iK~~~a~~~gl~~~~~l~~~~ykE~~R~~m~~~g~~~R 86 (202)
T 3ch4_B 7 GGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKR 86 (202)
T ss_dssp BCCCSEEEEEEECTTSSHHHHHHHHHHHHCTTTEEEECTHHHHHHHHHHTTTCCCC-------CCSSHHHHHHHHHHHHH
T ss_pred ccCCCEEEEEECCCCCChHHHHHHHHHHcCCCCceEEEccHHHHHHHHHHcCCCchhhcchhhhHHHHHHHHHHHHHHHH
Confidence 45799999999999999999999999999876799999999999999999999999999999999999999999999999
Q ss_pred ccChhhhHHHHHHH
Q psy4713 81 RKDNGCFIRSAIEM 94 (103)
Q Consensus 81 ~~D~g~Fcr~~~~~ 94 (103)
++||++||+.+++.
T Consensus 87 ~~d~~~~~~~~~~~ 100 (202)
T 3ch4_B 87 QADPGFFCRKIVEG 100 (202)
T ss_dssp HHCTTTTHHHHSBT
T ss_pred hcCchHHHHHHHHh
Confidence 99999999988753
|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2p6w_A VP54, putative glycosyltransferase (mannosyltransferase in glycosylating the PBCV-1 major...; HET: FLC; 1.60A {Paramecium bursaria chlorella virus 1} PDB: 2p72_A* 2p73_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 97.73 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.31 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.24 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.14 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.08 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.8 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.68 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.56 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.47 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.47 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.47 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.39 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.33 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.27 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.08 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.88 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 95.82 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.81 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.76 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.54 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.52 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.52 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.47 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.39 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 95.36 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.22 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.12 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.11 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.11 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.07 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.07 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.04 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 94.83 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 94.81 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.71 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.66 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.58 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 94.46 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.31 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 94.15 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 94.12 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.96 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 93.93 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 93.8 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.8 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.78 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 93.68 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.67 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 93.51 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 93.46 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.19 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.05 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.05 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.94 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 92.92 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 92.9 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.65 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.64 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 92.47 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.29 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 92.28 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 92.21 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 91.97 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.85 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 91.54 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.38 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 90.83 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 90.73 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.23 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.16 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.79 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 89.78 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 89.56 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 88.47 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 88.37 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.11 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 88.07 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 87.9 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 87.81 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 86.86 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 86.7 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 86.24 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 85.74 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 85.35 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 85.25 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 85.01 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 84.8 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 84.44 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 83.71 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 83.61 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 83.48 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 83.35 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 82.75 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 82.72 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 82.64 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.3 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 82.29 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 81.46 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 81.39 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 81.08 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 81.08 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 80.62 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 80.08 |
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: Deoxynucleoside monophosphate kinase species: Bacteriophage T4 [TaxId: 10665]
Probab=97.73 E-value=2.6e-05 Score=54.14 Aligned_cols=45 Identities=29% Similarity=0.541 Sum_probs=38.9
Q ss_pred EEEEEecCcCCchhHHHHHHHHHhcccceEEEecchhhHHHHHHHcCc
Q psy4713 6 LILLFSGKRKSGKDFLTDYLLERIGSQHCAIIRLSAPIKSHWAKQNGL 53 (103)
Q Consensus 6 lIiL~sGKrksGKDy~a~~l~~~l~~~~~~iv~iS~piK~~yA~~~gl 53 (103)
.||-|||.-|||||-+|+.|++.+| +.+++++++++++-....+.
T Consensus 2 ~iIgiTG~igSGKsTva~~l~e~~g---~~~i~~aD~i~~~l~~~~~~ 46 (241)
T d1deka_ 2 KLIFLSGVKRSGKDTTADFIMSNYS---AVKYQLAGPIKDALAYAWGV 46 (241)
T ss_dssp EEEEEECCTTSSHHHHHHHHHHHSC---EEECCTTHHHHHHHHHHHHH
T ss_pred EEEEEECCCCCCHHHHHHHHHHhCC---CeEEcccHHHHHHHHhcCch
Confidence 4799999999999999999988764 88999999999998775443
|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|