Psyllid ID: psy4771


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQAKAGPR
cccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEcccccccccEEEEccccEEEEccccEEEEEEcccEEEEEEcccccccEEEccccccccEEEEcccccEEEEEccccEEEEEcccccEEEEEccccccccccccccccEEEEcccccccccEEEEEEEccccccccccccEEEcccccEEEEEcccccccccccccccccccEEEEccccccEEEEEcccccccEEEEcccccEEEEEEccccEEEEEEEEcccccccEEEEcccccccccEEEcccccEEEEEEcccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEccccEEEEccccEEEEEccccEEEEEEcccccccccccccccccccEEEcccccEEEEEccccEEEEcccccEEEEEEcccccccccccEEcccccccccEEEccHcHEEEEHccccccccEEccccEEccccEEEEEccccccccccEEEEEccccEEEEEcccccEEEEEEcccEccccEEEcccccEEEEEEccHHHEEEEEEcccccccEEEEEcccccccccccccccccEEEEEEcccccHccccHHHHHHHHHHHHcccc
MAFFRNFFISVVVGIVAItfypglepeidftafevapprplegkLALNEKLNNAEKLFeneihgpeavvkhkgdlymgvdgghilklsggklvpvvklgkdcygfkyeqqcgrplgikfdkngalhvADAYFGLYKVNVTTGQTEQLISMdteidgakpqipnsvtvdsdgqtgqteQLISMdteidgakpqipnsvtvdsdgmvywsdsstkyksglfegltsgsgrliqynpktkknKVLIANLHFangvelsadESFVIVAETMSSRVHRyylkgpkqgksevfidglpglpdnvkrdskgnFLVSLvcpveqpseqagnirdpagaqakagpr
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIpnsvtvdsdgqTGQTEQLISMdteidgakpqipnsvtvdsdGMVYWSDSSTKYKSGLfegltsgsgrliqynpkTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYlkgpkqgksEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVeqpseqagnirdpagaqakagpr
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQAKAGPR
**FFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLI*****************************************************DGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLP*******KGNFLVSLVCP************************
*AFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQAKAGP*
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRD***********
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQAKAGPR
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFFRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQAKAGPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q5ZIF1415 Adipocyte plasma membrane yes N/A 0.830 0.674 0.360 9e-47
Q7TP48376 Adipocyte plasma membrane yes N/A 0.756 0.678 0.348 3e-43
Q9D7N9415 Adipocyte plasma membrane yes N/A 0.813 0.660 0.345 3e-43
B5X3B2416 Adipocyte plasma membrane N/A N/A 0.747 0.605 0.335 1e-41
Q803F5415 Adipocyte plasma membrane yes N/A 0.747 0.607 0.333 3e-41
Q3T0E5412 Adipocyte plasma membrane yes N/A 0.771 0.631 0.338 8e-40
Q9HDC9416 Adipocyte plasma membrane yes N/A 0.753 0.610 0.348 1e-39
P68175344 Strictosidine synthase OS N/A N/A 0.531 0.520 0.324 4e-21
P68174342 Strictosidine synthase (F N/A N/A 0.531 0.523 0.324 5e-21
P18417352 Strictosidine synthase OS N/A N/A 0.483 0.463 0.326 4e-19
>sp|Q5ZIF1|APMAP_CHICK Adipocyte plasma membrane-associated protein OS=Gallus gallus GN=APMAP PE=2 SV=1 Back     alignment and function desciption
 Score =  187 bits (475), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 173/319 (54%), Gaps = 39/319 (12%)

Query: 4   FRNFFISVVVGIVAITFYPGLEPEIDFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIH 63
           F     S+ V ++  T    L+  ID     +  P  L G L  N KL  AE+L+EN++ 
Sbjct: 42  FLTLAASLAVPLLGATVL--LDCPIDPQPISLKEPPLLTGVLEPNNKLQKAERLWENQLV 99

Query: 64  GPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGK-DCYGFKYEQQCGRPLGIKFDKN 122
           GPE++V     L+ G   G ILK+  G++  V ++G   C   + E  CGRPLGI+   N
Sbjct: 100 GPESIVNIGDVLFTGTADGKILKIEDGEVQTVARIGHGPCGTPEDEPTCGRPLGIRVGPN 159

Query: 123 GALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISM 182
             L VADAY+GLY+VN  TG+T+ L+S  T I+G K    N +TV  DG+          
Sbjct: 160 NTLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTVTQDGRK--------- 210

Query: 183 DTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLT---SGSGRLIQYNPKTKKN 239
                                 +Y++DSS+K++   F  L    +  GRL++Y+  TK+ 
Sbjct: 211 ----------------------IYFTDSSSKWQRRDFLFLVMEGTDDGRLLEYDTVTKEV 248

Query: 240 KVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVK 299
           KVL+  L F NGV+LS  E FV+V ET  +R+ RYY+ G  +G +++F++ +PGLPDN++
Sbjct: 249 KVLMVGLRFPNGVQLSPAEDFVLVLETAMARIRRYYVSGLMKGGADMFVENMPGLPDNIR 308

Query: 300 RDSKGNFLVSLVCPVEQPS 318
             S G + V++  PV +P+
Sbjct: 309 LSSSGGYWVAM--PVVRPN 325





Gallus gallus (taxid: 9031)
>sp|Q7TP48|APMAP_RAT Adipocyte plasma membrane-associated protein OS=Rattus norvegicus GN=Apmap PE=2 SV=2 Back     alignment and function description
>sp|Q9D7N9|APMAP_MOUSE Adipocyte plasma membrane-associated protein OS=Mus musculus GN=Apmap PE=1 SV=1 Back     alignment and function description
>sp|B5X3B2|APMAP_SALSA Adipocyte plasma membrane-associated protein OS=Salmo salar GN=apmap PE=2 SV=1 Back     alignment and function description
>sp|Q803F5|APMAP_DANRE Adipocyte plasma membrane-associated protein OS=Danio rerio GN=apmap PE=2 SV=1 Back     alignment and function description
>sp|Q3T0E5|APMAP_BOVIN Adipocyte plasma membrane-associated protein OS=Bos taurus GN=APMAP PE=2 SV=1 Back     alignment and function description
>sp|Q9HDC9|APMAP_HUMAN Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2 Back     alignment and function description
>sp|P68175|STSY_RAUSE Strictosidine synthase OS=Rauvolfia serpentina GN=STR1 PE=1 SV=1 Back     alignment and function description
>sp|P68174|STSY_RAUMA Strictosidine synthase (Fragment) OS=Rauvolfia mannii GN=STR1 PE=3 SV=1 Back     alignment and function description
>sp|P18417|STSY_CATRO Strictosidine synthase OS=Catharanthus roseus GN=STR1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
270011245 486 hypothetical protein TcasGA2_TC030782, p 0.875 0.606 0.466 4e-79
91087333 503 PREDICTED: similar to hemomucin [Triboli 0.875 0.586 0.466 5e-79
156551049 544 PREDICTED: adipocyte plasma membrane-ass 0.830 0.514 0.473 1e-77
328714072412 PREDICTED: LOW QUALITY PROTEIN: adipocyt 0.753 0.616 0.484 7e-74
332027099 578 Adipocyte plasma membrane-associated pro 0.804 0.468 0.426 8e-70
215541377423 putative hemomucin [Schistocerca gregari 0.804 0.640 0.447 1e-68
307210789 587 Adipocyte plasma membrane-associated pro 0.824 0.473 0.407 5e-66
307176769 568 Adipocyte plasma membrane-associated pro 0.839 0.498 0.409 1e-65
383859542 572 PREDICTED: adipocyte plasma membrane-ass 0.810 0.477 0.423 6e-65
380024889 592 PREDICTED: adipocyte plasma membrane-ass 0.795 0.452 0.385 2e-58
>gi|270011245|gb|EFA07693.1| hypothetical protein TcasGA2_TC030782, partial [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 154/330 (46%), Positives = 209/330 (63%), Gaps = 35/330 (10%)

Query: 1   MAFFRNFFISVVVGIVAITFYPGLEPEIDFTA-FEVAPPRPLEGKLALNEKLNNAEKLFE 59
           + FF      +++  + + F P + PE  F   ++VAPPRP EG L LNEKLN+AE   +
Sbjct: 7   VKFFTRRTFELLIIALLLVFLPKIPPEAKFEKPYKVAPPRPFEGALKLNEKLNDAEIWHK 66

Query: 60  NEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDCYGFKYEQQCGRPLGIKF 119
            ++HGPEA V + G+LY  + GG ++KL+G  + PVVK GK C G   E+ CGRPLG+ F
Sbjct: 67  GDLHGPEAFVDYNGELYTSLHGGDVVKLTGNHITPVVKFGKPCKGIYEERICGRPLGMAF 126

Query: 120 DKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQL 179
           DKNG L VAD+Y+G++KV+V TG+ E+L++ D +IDG    +PNSV V S+G        
Sbjct: 127 DKNGVLFVADSYYGVFKVDVKTGKKERLVAFDEQIDGRNVTLPNSVAVASNGD------- 179

Query: 180 ISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKY--KSGLFEGLTSGSGRLIQYNPKTK 237
                                    ++W+DSST++  + G+F+ L  GSGRLI Y+ KTK
Sbjct: 180 -------------------------IFWTDSSTEFDLQDGVFDLLADGSGRLIHYDSKTK 214

Query: 238 KNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDN 297
           KNKVLI++LHFANGV LS DE FV+V ET+ SR+HRYYLKGPK+G  ++FI+GLPGL DN
Sbjct: 215 KNKVLISDLHFANGVVLSDDEEFVLVGETVRSRIHRYYLKGPKKGTHDIFIEGLPGLVDN 274

Query: 298 VKRDSKGNFLVSLVCPVEQPSEQAGNIRDP 327
           +K D KG F+V LV  V+        I  P
Sbjct: 275 LKHDGKGGFIVPLVVAVDNEHPLLTQIMGP 304




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91087333|ref|XP_975599.1| PREDICTED: similar to hemomucin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156551049|ref|XP_001605615.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328714072|ref|XP_001947674.2| PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332027099|gb|EGI67195.1| Adipocyte plasma membrane-associated protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|215541377|emb|CAT00690.1| putative hemomucin [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|307210789|gb|EFN87172.1| Adipocyte plasma membrane-associated protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307176769|gb|EFN66169.1| Adipocyte plasma membrane-associated protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383859542|ref|XP_003705253.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024889|ref|XP_003696221.1| PREDICTED: adipocyte plasma membrane-associated protein-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
FB|FBgn0041780411 Ssl2 "Strictosidine synthase-l 0.353 0.289 0.408 2.5e-42
UNIPROTKB|Q5ZIF1415 APMAP "Adipocyte plasma membra 0.427 0.346 0.42 1.5e-26
UNIPROTKB|G1K318414 C3H20orf3 "Uncharacterized pro 0.427 0.347 0.402 1.1e-25
FB|FBgn0015737 582 Hmu "Hemomucin" [Drosophila me 0.525 0.304 0.349 3.6e-25
UNIPROTKB|Q3T0E5412 APMAP "Adipocyte plasma membra 0.397 0.325 0.401 8.2e-24
UNIPROTKB|E2RPE9415 APMAP "Uncharacterized protein 0.397 0.322 0.380 8.8e-24
UNIPROTKB|F1LLW3386 RGD1308874 "Protein RGD1308874 0.495 0.432 0.379 1.4e-23
TAIR|locus:2097488403 LAP3 "LESS ADHERENT POLLEN 3" 0.400 0.334 0.357 1.6e-23
RGD|1308874376 Apmap "adipocyte plasma membra 0.403 0.361 0.381 2.3e-23
MGI|MGI:1919131415 Apmap "adipocyte plasma membra 0.409 0.332 0.387 3.5e-23
FB|FBgn0041780 Ssl2 "Strictosidine synthase-like 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 249 (92.7 bits), Expect = 2.5e-42, Sum P(2) = 2.5e-42
 Identities = 51/125 (40%), Positives = 80/125 (64%)

Query:   195 NSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVEL 254
             NS+ +   G ++W+DS ++    +F    + SGR   Y+   K N+VL+  L FANG+ L
Sbjct:   174 NSLVISRQGDIFWTDSFSE--DFVFAAFANPSGR---YDRVKKTNEVLLDELSFANGLAL 228

Query:   255 SADESFVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFL-VSLVCP 313
             S  E F+I+AET + R+ RYYLKG + G+SEVF++GLPG PDN+  D +G ++ +S+   
Sbjct:   229 SPSEDFIILAETTAMRLRRYYLKGSRAGESEVFVEGLPGCPDNLTADEEGIWVPLSVASD 288

Query:   314 VEQPS 318
              + P+
Sbjct:   289 SQNPN 293


GO:0016844 "strictosidine synthase activity" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
UNIPROTKB|Q5ZIF1 APMAP "Adipocyte plasma membrane-associated protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K318 C3H20orf3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0015737 Hmu "Hemomucin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0E5 APMAP "Adipocyte plasma membrane-associated protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPE9 APMAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LLW3 RGD1308874 "Protein RGD1308874" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2097488 LAP3 "LESS ADHERENT POLLEN 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1308874 Apmap "adipocyte plasma membrane associated protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919131 Apmap "adipocyte plasma membrane associated protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7TP48APMAP_RATNo assigned EC number0.34820.75660.6781yesN/A
Q3T0E5APMAP_BOVINNo assigned EC number0.33880.77150.6310yesN/A
Q9D7N9APMAP_MOUSENo assigned EC number0.34500.81300.6602yesN/A
Q9HDC9APMAP_HUMANNo assigned EC number0.34810.75370.6105yesN/A
Q803F5APMAP_DANRENo assigned EC number0.33330.74770.6072yesN/A
Q5ZIF1APMAP_CHICKNo assigned EC number0.36050.83080.6746yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
pfam0308889 pfam03088, Str_synth, Strictosidine synthase 6e-25
COG3386307 COG3386, COG3386, Gluconolactonase [Carbohydrate t 1e-17
pfam08450245 pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like re 2e-05
pfam0173186 pfam01731, Arylesterase, Arylesterase 0.004
>gnl|CDD|111929 pfam03088, Str_synth, Strictosidine synthase Back     alignment and domain information
 Score = 95.9 bits (239), Expect = 6e-25
 Identities = 37/89 (41%), Positives = 62/89 (69%), Gaps = 4/89 (4%)

Query: 195 NSVTVDSD-GMVYWSDSSTKY-KSGLFEGLTSG--SGRLIQYNPKTKKNKVLIANLHFAN 250
           N++ VD + G++Y++DSS++Y +  +   +  G  +GRL++Y+P TK  KVL+ +L+F N
Sbjct: 1   NALDVDPETGVLYFTDSSSRYDRRQVIFAMLEGDKTGRLMKYDPSTKVTKVLLKDLYFPN 60

Query: 251 GVELSADESFVIVAETMSSRVHRYYLKGP 279
           G+ LS D SFV+  ET   R+ +Y++KGP
Sbjct: 61  GIALSPDGSFVLFCETPMKRISKYWIKGP 89


Strictosidine synthase (E.C. 4.3.3.2) is a key enzyme in alkaloid biosynthesis. It catalyzes the condensation of tryptamine with secologanin to form strictosidine. Length = 89

>gnl|CDD|225921 COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|219847 pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region Back     alignment and domain information
>gnl|CDD|190082 pfam01731, Arylesterase, Arylesterase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG1520|consensus376 100.0
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.94
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 99.79
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.77
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.71
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.7
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.64
KOG4499|consensus310 99.56
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.55
KOG4659|consensus 1899 99.48
PRK11028330 6-phosphogluconolactonase; Provisional 99.48
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.43
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.39
PRK11028330 6-phosphogluconolactonase; Provisional 99.38
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.38
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.37
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.34
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.34
COG3391381 Uncharacterized conserved protein [Function unknow 99.28
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.13
COG3391 381 Uncharacterized conserved protein [Function unknow 99.11
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.1
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.09
KOG1214|consensus1289 99.09
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.02
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.99
KOG4659|consensus 1899 98.92
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.84
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.84
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 98.81
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.78
KOG1214|consensus1289 98.74
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.73
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.68
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 98.64
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 98.63
KOG1520|consensus376 98.59
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.57
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 98.56
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.55
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.55
PRK02888 635 nitrous-oxide reductase; Validated 98.47
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.3
PRK04792448 tolB translocation protein TolB; Provisional 98.3
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.29
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.29
PRK05137435 tolB translocation protein TolB; Provisional 98.26
KOG4499|consensus310 98.2
KOG0291|consensus 893 98.19
PRK04922433 tolB translocation protein TolB; Provisional 98.14
KOG0318|consensus603 98.12
PRK02889427 tolB translocation protein TolB; Provisional 98.1
PRK03629429 tolB translocation protein TolB; Provisional 98.09
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 98.08
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.04
PRK05137435 tolB translocation protein TolB; Provisional 98.04
PRK00178430 tolB translocation protein TolB; Provisional 98.02
PRK04043419 tolB translocation protein TolB; Provisional 98.02
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.0
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.95
PRK03629429 tolB translocation protein TolB; Provisional 97.93
PRK01742429 tolB translocation protein TolB; Provisional 97.87
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.83
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 97.79
PRK04792448 tolB translocation protein TolB; Provisional 97.78
PRK02889427 tolB translocation protein TolB; Provisional 97.72
PRK00178430 tolB translocation protein TolB; Provisional 97.72
PRK01029428 tolB translocation protein TolB; Provisional 97.68
PRK04922433 tolB translocation protein TolB; Provisional 97.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.67
PRK04043419 tolB translocation protein TolB; Provisional 97.66
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.61
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 97.6
PRK01742429 tolB translocation protein TolB; Provisional 97.59
KOG0315|consensus311 97.58
PRK02888 635 nitrous-oxide reductase; Validated 97.57
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.57
PRK01029428 tolB translocation protein TolB; Provisional 97.54
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.51
COG3823262 Glutamine cyclotransferase [Posttranslational modi 97.51
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.45
COG3211616 PhoX Predicted phosphatase [General function predi 97.41
TIGR03118 336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 97.39
KOG0318|consensus 603 97.38
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.34
COG4946 668 Uncharacterized protein related to the periplasmic 97.33
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 97.33
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.33
KOG0266|consensus456 97.26
COG3292 671 Predicted periplasmic ligand-binding sensor domain 97.2
KOG1446|consensus311 97.2
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 97.18
COG3292 671 Predicted periplasmic ligand-binding sensor domain 97.1
KOG0291|consensus 893 97.1
PF13449326 Phytase-like: Esterase-like activity of phytase 97.08
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.05
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.02
KOG0279|consensus315 96.98
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.96
KOG2055|consensus514 96.96
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.95
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 96.93
KOG1446|consensus311 96.91
PF13449326 Phytase-like: Esterase-like activity of phytase 96.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.84
KOG0282|consensus503 96.79
KOG0266|consensus456 96.75
PTZ00421 493 coronin; Provisional 96.73
KOG0315|consensus311 96.7
COG3211616 PhoX Predicted phosphatase [General function predi 96.7
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.69
KOG0272|consensus459 96.64
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.62
KOG0263|consensus707 96.61
KOG0286|consensus343 96.59
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 96.59
KOG2055|consensus514 96.57
KOG0303|consensus 472 96.48
KOG1539|consensus 910 96.48
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.44
KOG2139|consensus445 96.37
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 96.35
PTZ00420 568 coronin; Provisional 96.35
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.33
COG4946668 Uncharacterized protein related to the periplasmic 96.33
KOG1215|consensus 877 96.31
PTZ00421 493 coronin; Provisional 96.24
KOG0279|consensus315 96.18
PRK13616591 lipoprotein LpqB; Provisional 96.13
KOG2106|consensus626 96.07
KOG0289|consensus506 96.05
KOG0278|consensus334 95.95
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.94
KOG0289|consensus506 95.81
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 95.7
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.62
KOG1273|consensus 405 95.5
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.48
KOG1274|consensus 933 95.41
PF02333 381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 95.41
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.36
PRK13684334 Ycf48-like protein; Provisional 95.28
KOG0263|consensus707 95.22
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.21
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 95.2
KOG0271|consensus480 95.19
PTZ00420 568 coronin; Provisional 95.16
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.13
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 95.12
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 95.04
COG1520370 FOG: WD40-like repeat [Function unknown] 94.85
PLN00181793 protein SPA1-RELATED; Provisional 94.48
KOG2048|consensus 691 94.46
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 94.38
KOG0271|consensus480 94.34
KOG0299|consensus479 94.28
KOG0288|consensus459 94.22
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.21
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 94.14
KOG0278|consensus334 94.04
KOG0646|consensus 476 93.86
KOG0282|consensus503 93.83
KOG0286|consensus343 93.79
KOG1215|consensus 877 93.59
KOG1407|consensus313 93.47
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.38
KOG0296|consensus399 93.29
KOG1539|consensus 910 93.28
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 93.22
KOG4441|consensus571 93.09
COG1520370 FOG: WD40-like repeat [Function unknown] 92.88
KOG0643|consensus327 92.87
COG5276370 Uncharacterized conserved protein [Function unknow 92.79
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.76
KOG0272|consensus459 92.66
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 92.64
PLN00181793 protein SPA1-RELATED; Provisional 92.04
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 91.96
KOG2111|consensus346 91.9
KOG0293|consensus519 91.8
KOG0294|consensus 362 91.63
smart00284255 OLF Olfactomedin-like domains. 91.62
KOG0645|consensus312 91.5
KOG0973|consensus 942 91.34
KOG0293|consensus519 91.28
KOG1274|consensus 933 91.18
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 90.84
KOG2096|consensus420 90.77
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 90.64
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.61
KOG0316|consensus307 90.6
COG0823425 TolB Periplasmic component of the Tol biopolymer t 90.46
KOG2110|consensus391 90.45
KOG0283|consensus712 90.35
PHA02713557 hypothetical protein; Provisional 90.34
PHA02713557 hypothetical protein; Provisional 90.13
KOG0771|consensus398 90.12
KOG2048|consensus 691 90.06
KOG4378|consensus 673 89.85
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.61
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 89.41
KOG0319|consensus 775 89.26
KOG0292|consensus 1202 89.19
PRK13684334 Ycf48-like protein; Provisional 88.82
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.81
PF14517229 Tachylectin: Tachylectin; PDB: 1TL2_A. 88.73
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 88.7
PF0673938 SBBP: Beta-propeller repeat; InterPro: IPR010620 T 88.65
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.62
KOG0973|consensus 942 88.41
KOG2139|consensus 445 88.34
KOG2110|consensus391 88.16
KOG2919|consensus406 87.94
PHA02790480 Kelch-like protein; Provisional 87.88
KOG3881|consensus412 87.86
KOG0772|consensus641 87.58
KOG4441|consensus571 87.57
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 87.53
KOG0772|consensus 641 87.47
PF14339236 DUF4394: Domain of unknown function (DUF4394) 87.34
KOG0313|consensus423 87.24
KOG3914|consensus 390 86.98
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 86.84
KOG0265|consensus 338 86.41
KOG0275|consensus508 86.17
KOG3881|consensus412 86.15
KOG0268|consensus 433 86.12
PF0749424 Reg_prop: Two component regulator propeller; Inter 86.11
KOG0273|consensus 524 85.5
KOG0265|consensus338 85.2
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.03
KOG1009|consensus 434 84.77
KOG0319|consensus 775 84.73
KOG0299|consensus479 84.7
KOG2321|consensus 703 83.95
KOG1407|consensus313 83.76
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 83.47
KOG0639|consensus705 83.04
KOG2321|consensus 703 82.76
KOG4649|consensus354 82.69
PHA03098534 kelch-like protein; Provisional 82.44
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 82.3
KOG1963|consensus 792 81.76
KOG0306|consensus 888 81.58
KOG0281|consensus499 81.49
KOG1009|consensus434 81.29
KOG0310|consensus 487 80.42
KOG0646|consensus 476 80.33
KOG1273|consensus405 80.23
KOG0643|consensus327 80.21
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 80.08
PHA03098534 kelch-like protein; Provisional 80.03
>KOG1520|consensus Back     alignment and domain information
Probab=100.00  E-value=2.3e-42  Score=311.23  Aligned_cols=259  Identities=41%  Similarity=0.667  Sum_probs=215.7

Q ss_pred             CceeeeeCCCCCCcCcchhccccccCceeccCcccCccEEEeeCCe--EEEEecCcEEEEEeCCceeEEEecCcccc---
Q psy4771          29 DFTAFEVAPPRPLEGKLALNEKLNNAEKLFENEIHGPEAVVKHKGD--LYMGVDGGHILKLSGGKLVPVVKLGKDCY---  103 (337)
Q Consensus        29 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~g~~~~P~~i~~~~g~--ly~d~~~g~I~~~~~~~~~~~~~~g~~~~---  103 (337)
                      .+..+...++.+..+.+.+++.+...|.+..+.+..|+.+.+.+|.  +|+....|++-+.+....    .....|.   
T Consensus        31 ~~~~~~~~~~~~~~~~l~~~~~~~g~E~~~fd~~~~gp~~~v~dg~il~~~g~~~Gwv~~~~~~~s----~~~~~~~~~~  106 (376)
T KOG1520|consen   31 GSPDDRLFSKLPLLGKLIPNNHLTGPESLLFDPQGGGPYTGVVDGRILKYTGNDDGWVKFADTKDS----TNRSQCCDPG  106 (376)
T ss_pred             CCchhcccCCCCcccccccccccCChhhheecccCCCceEEEECCceEEEeccCceEEEEEecccc----ccccccCCCc
Confidence            3345555666667888889998888998888777777777774444  668888998888765311    1123333   


Q ss_pred             CccccCccCCcceEEECCCC-cEEEEECCCcEEEEEcCCCeEEEEeccccccCCCCCCCCCceeeCCCCCcccccceeee
Q psy4771         104 GFKYEQQCGRPLGIKFDKNG-ALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISM  182 (337)
Q Consensus       104 ~~~~~~~~~~P~Gl~~d~~G-~lyVad~~~gv~~vd~~~g~~~~l~~~~~~~~g~~~~~P~~v~~~~~g~~~~~~~v~~~  182 (337)
                      ....++.|+||.||+++..| +|||||++.|++.|++++++.+.+.+   +.+|+                         
T Consensus       107 ~~~~e~~CGRPLGl~f~~~ggdL~VaDAYlGL~~V~p~g~~a~~l~~---~~~G~-------------------------  158 (376)
T KOG1520|consen  107 SFETEPLCGRPLGIRFDKKGGDLYVADAYLGLLKVGPEGGLAELLAD---EAEGK-------------------------  158 (376)
T ss_pred             ceecccccCCcceEEeccCCCeEEEEecceeeEEECCCCCcceeccc---cccCe-------------------------
Confidence            34557899999999999998 99999999999999999988777665   44443                         


Q ss_pred             ccccCCCCCCCCccEEEcCCCcEEEEcCCCCc--cCceeeee-ecCCccEEEEcCCCCeeEEEeccccceeeEEEccCCC
Q psy4771         183 DTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKY--KSGLFEGL-TSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADES  259 (337)
Q Consensus       183 ~~~~~~~~~~~pn~v~vd~~G~lyvtd~~~~~--~~~~~~~~-~~~~G~v~~~d~~~~~~~~~~~~~~~p~gia~~~dg~  259 (337)
                             ++.+.|++.|+++|.+||||++++|  ++.+..++ .+++||+++||+.++.++++.+++.+|||+++|+|++
T Consensus       159 -------~~kf~N~ldI~~~g~vyFTDSSsk~~~rd~~~a~l~g~~~GRl~~YD~~tK~~~VLld~L~F~NGlaLS~d~s  231 (376)
T KOG1520|consen  159 -------PFKFLNDLDIDPEGVVYFTDSSSKYDRRDFVFAALEGDPTGRLFRYDPSTKVTKVLLDGLYFPNGLALSPDGS  231 (376)
T ss_pred             -------eeeecCceeEcCCCeEEEeccccccchhheEEeeecCCCccceEEecCcccchhhhhhcccccccccCCCCCC
Confidence                   7889999999999999999999987  56666654 6799999999999999999999999999999999999


Q ss_pred             EEEEEeCCCCEEEEEEeeCCCCCceeeeecCCCCCCCceeECCCCCEEEEecCC--------CCCchhhccccCC
Q psy4771         260 FVIVAETMSSRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCP--------VEQPSEQAGNIRD  326 (337)
Q Consensus       260 ~lyva~~~~~~I~~~~~~g~~~~~~~~~~~~~~g~Pdgi~~d~dG~l~va~~~~--------~~~p~~~~~~~~~  326 (337)
                      ++.+||+...||.||+++|.+.|+.++|++++||+||||+.+++|++|||..+.        ..|||+++++.+.
T Consensus       232 fvl~~Et~~~ri~rywi~g~k~gt~EvFa~~LPG~PDNIR~~~~G~fWVal~~~~~~~~~~~~~~p~vr~~~~~~  306 (376)
T KOG1520|consen  232 FVLVAETTTARIKRYWIKGPKAGTSEVFAEGLPGYPDNIRRDSTGHFWVALHSKRSTLWRLLMKYPWVRKFIAKL  306 (376)
T ss_pred             EEEEEeeccceeeeeEecCCccCchhhHhhcCCCCCcceeECCCCCEEEEEecccchHHHhhhcChHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999887        4566666665555



>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PF14339 DUF4394: Domain of unknown function (DUF4394) Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF07494 Reg_prop: Two component regulator propeller; InterPro: IPR011110 A large group of two component regulator proteins appear to have the same N-terminal structure of 14 tandem repeats Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
2fp8_A322 Structure Of Strictosidine Synthase, The Biosynthet 4e-22
2v91_A302 Structure Of Strictosidine Synthase In Complex With 4e-22
2fpb_A322 Structure Of Strictosidine Synthase, The Biosynthet 2e-20
2dso_A333 Crystal Structure Of D138n Mutant Of Drp35, A 35kda 9e-06
2dg1_A333 Crystal Structure Of Drp35, A 35kda Drug Responsive 2e-05
2dg0_A333 Crystal Structure Of Drp35, A 35kda Drug Responsive 5e-05
>pdb|2FP8|A Chain A, Structure Of Strictosidine Synthase, The Biosynthetic Entry To The Monoterpenoid Indole Alkaloid Family Length = 322 Back     alignment and structure

Iteration: 1

Score = 102 bits (253), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 74/228 (32%), Positives = 111/228 (48%), Gaps = 49/228 (21%) Query: 111 CGRPLGIKFD-KNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDS 169 CGR I ++ +N L++ D Y+ L V G QL T +DG + +VTVD Sbjct: 79 CGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLA---TSVDGVPFKWLYAVTVDQ 135 Query: 170 DGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTSGS--- 226 G+VY++D ST Y + + S Sbjct: 136 -------------------------------RTGIVYFTDVSTLYDDRGVQQIMDTSDKT 164 Query: 227 GRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEV 286 GRLI+Y+P TK+ +L+ LH G E+SAD SFV+VAE +S ++ +Y+L+GPK+G +EV Sbjct: 165 GRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEV 224 Query: 287 FIDGLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIR---DPAGAQ 331 + +P P N+KR++ G+F VS E GN+ DP G + Sbjct: 225 LVK-IPN-PGNIKRNADGHFWVS------SSEELDGNMHGRVDPKGIK 264
>pdb|2V91|A Chain A, Structure Of Strictosidine Synthase In Complex With Strictosidine Length = 302 Back     alignment and structure
>pdb|2FPB|A Chain A, Structure Of Strictosidine Synthase, The Biosynthetic Entry To The Monoterpenoid Indole Alkaloid Family Length = 322 Back     alignment and structure
>pdb|2DSO|A Chain A, Crystal Structure Of D138n Mutant Of Drp35, A 35kda Drug Responsive Protein From Staphylococcus Aureus Length = 333 Back     alignment and structure
>pdb|2DG1|A Chain A, Crystal Structure Of Drp35, A 35kda Drug Responsive Protein From Staphylococcus Aureus, Complexed With Ca2+ Length = 333 Back     alignment and structure
>pdb|2DG0|A Chain A, Crystal Structure Of Drp35, A 35kda Drug Responsive Protein From Staphylococcus Aureus Length = 333 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
2fp8_A322 Strictosidine synthase; six bladed beta propeller 6e-55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 3e-19
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 7e-17
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 4e-14
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 4e-13
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 5e-11
2p4o_A306 Hypothetical protein; putative lactonase, structur 1e-10
2p4o_A 306 Hypothetical protein; putative lactonase, structur 7e-04
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 1e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 7e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 7e-06
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-09
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 3e-09
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 2e-06
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 1e-07
3v9f_A 781 Two-component system sensor histidine kinase/RESP 9e-05
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Length = 322 Back     alignment and structure
 Score =  181 bits (460), Expect = 6e-55
 Identities = 80/286 (27%), Positives = 125/286 (43%), Gaps = 53/286 (18%)

Query: 45  LALNEKLNNAEKLFENEIHGPEAVVKHK--GDLYMGVDGGHILKLSGGKLVPVV------ 96
           LAL+  +   E L E   + P +          Y  V  G ++K  G     V       
Sbjct: 2   LALSSPIL-KEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASP 60

Query: 97  ----KLGKDCYGFKYEQQCGRPLGIKFD-KNGALHVADAYFGLYKVNVTTGQTEQLISMD 151
                  ++    +    CGR   I ++ +N  L++ D Y+ L  V    G   QL    
Sbjct: 61  YWNKAFCENSTDAEKRPLCGRTYDISYNLQNNQLYIVDCYYHLSVVGSEGGHATQLA--- 117

Query: 152 TEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSS 211
           T +DG   +   +VTVD                                  G+VY++D S
Sbjct: 118 TSVDGVPFKWLYAVTVD-------------------------------QRTGIVYFTDVS 146

Query: 212 TKYK---SGLFEGLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMS 268
           T Y           +  +GRLI+Y+P TK+  +L+  LH   G E+SAD SFV+VAE +S
Sbjct: 147 TLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLS 206

Query: 269 SRVHRYYLKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVCPV 314
            ++ +Y+L+GPK+G +EV +  +P  P N+KR++ G+F VS    +
Sbjct: 207 HQIVKYWLEGPKKGTAEVLVK-IPN-PGNIKRNADGHFWVSSSEEL 250


>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Length = 355 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Length = 314 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Length = 333 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Length = 296 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Length = 305 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Length = 781 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.94
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.92
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.91
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.89
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.88
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.87
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.84
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.83
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.83
3v65_B386 Low-density lipoprotein receptor-related protein; 99.83
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.82
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.81
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.81
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.81
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.81
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.8
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.8
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.8
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.8
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.8
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 99.78
2qe8_A343 Uncharacterized protein; structural genomics, join 99.78
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.78
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.77
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.77
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.76
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.76
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.75
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.75
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.74
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.74
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.73
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.72
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.72
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.71
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.71
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.71
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.7
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.7
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.69
3kya_A496 Putative phosphatase; structural genomics, joint c 99.68
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.68
3v65_B386 Low-density lipoprotein receptor-related protein; 99.67
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.67
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.66
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.66
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.66
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.65
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.64
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.63
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.62
2qe8_A343 Uncharacterized protein; structural genomics, join 99.59
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.58
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.58
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.57
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.53
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.53
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.52
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.52
3kya_A496 Putative phosphatase; structural genomics, joint c 99.52
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.5
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.48
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.48
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.48
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.47
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.47
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.46
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.43
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 99.39
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.39
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.37
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.37
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.36
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.36
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.36
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.36
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.35
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.34
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.33
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 99.31
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.3
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.29
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.28
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.27
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 99.27
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.25
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.25
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.24
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.23
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.22
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.21
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.21
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.2
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.19
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 99.18
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.18
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.17
2ece_A462 462AA long hypothetical selenium-binding protein; 99.16
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.15
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.14
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.13
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.12
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.08
2ece_A462 462AA long hypothetical selenium-binding protein; 99.08
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.08
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.07
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.07
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.07
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.07
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.07
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.06
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.04
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.04
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.02
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.95
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.94
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.94
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.94
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.93
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.87
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.85
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.84
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.82
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 98.8
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.72
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.68
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.68
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 98.59
3ott_A 758 Two-component system sensor histidine kinase; beta 98.59
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.56
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.51
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.5
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.46
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.45
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.44
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.44
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.38
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.38
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 98.37
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.37
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.36
3ott_A 758 Two-component system sensor histidine kinase; beta 98.34
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.31
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.3
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.24
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.23
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.23
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.21
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 98.2
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 98.2
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.19
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.18
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.15
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.15
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.14
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.13
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.11
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 98.11
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.11
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.11
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 98.1
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.05
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.04
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.03
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.99
3jrp_A379 Fusion protein of protein transport protein SEC13 97.99
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.98
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.95
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.94
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.94
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.93
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.93
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.92
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.88
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.87
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.85
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.84
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.83
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.83
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.83
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.83
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.82
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.8
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.79
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.79
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.79
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.78
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 97.78
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.78
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.78
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.74
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.69
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.68
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.67
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.67
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.66
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.66
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.66
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.65
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.65
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.65
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 97.65
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.65
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.63
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.62
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.62
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.61
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.59
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 97.59
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.59
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.58
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.58
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.58
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.58
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 97.55
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.53
3jro_A 753 Fusion protein of protein transport protein SEC13 97.53
2pm7_B297 Protein transport protein SEC13, protein transport 97.52
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.51
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.5
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.49
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.49
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.48
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.47
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.47
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.46
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.46
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.45
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.44
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.44
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.44
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.42
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.38
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.38
3jrp_A379 Fusion protein of protein transport protein SEC13 97.37
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.36
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.36
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.3
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.26
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.26
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.25
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 97.24
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.24
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.23
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.22
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.22
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.21
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.16
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.15
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.11
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 97.11
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.06
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.04
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 96.98
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.98
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.98
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 96.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.96
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.89
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.85
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.84
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.78
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.75
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 96.62
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.59
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.58
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.52
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.52
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.47
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.42
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.42
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.29
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.22
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.21
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.19
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.1
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.99
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.99
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.98
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 95.94
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 95.91
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.85
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.82
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 95.82
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 95.71
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.68
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.66
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 95.58
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 95.57
2pm7_B 297 Protein transport protein SEC13, protein transport 95.55
3jro_A 753 Fusion protein of protein transport protein SEC13 95.52
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 95.42
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.29
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.15
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 95.15
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.02
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.0
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.93
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 94.87
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.47
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.46
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 94.23
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.11
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 93.72
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.59
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 93.11
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 92.49
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 91.84
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 91.71
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 91.55
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 90.98
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 90.07
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 87.57
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 85.49
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 85.11
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 82.88
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 82.47
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 81.56
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 80.43
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
Probab=99.94  E-value=2.1e-26  Score=211.28  Aligned_cols=222  Identities=34%  Similarity=0.601  Sum_probs=166.1

Q ss_pred             Ccee-ccCcccCccEEEe-eCCe-EEEEecCcEEEEEeCC--ceeEEEecCc-----cccCc---cccCccCCcceEEEC
Q psy4771          54 AEKL-FENEIHGPEAVVK-HKGD-LYMGVDGGHILKLSGG--KLVPVVKLGK-----DCYGF---KYEQQCGRPLGIKFD  120 (337)
Q Consensus        54 ~~~~-~~g~~~~P~~i~~-~~g~-ly~d~~~g~I~~~~~~--~~~~~~~~g~-----~~~~~---~~~~~~~~P~Gl~~d  120 (337)
                      .+++ ..|.+..|+++++ .++. +|++..+++|++++..  ....+.....     .|.+.   .....+.+|.||+++
T Consensus         9 ~~~i~~~g~~~~p~~i~~d~~g~~l~v~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~p~gi~~~   88 (322)
T 2fp8_A            9 LKEILIEAPSYAPNSFTFDSTNKGFYTSVQDGRVIKYEGPNSGFVDFAYASPYWNKAFCENSTDAEKRPLCGRTYDISYN   88 (322)
T ss_dssp             -CEEEEECSSSCCCCEECCTTCSSEEEECTTSEEEEECCTTTCEEEEEESCTTCCHHHHTTCCCGGGHHHHCCEEEEEEE
T ss_pred             cceeecCCccCCceEEEEcCCCCEEEEEcCCCeEEEECCCCCceEEEecccccccccccccccchhccccCCCCceEEEc
Confidence            4444 3566789999999 5665 8899999999999873  3433322110     11110   011235689999999


Q ss_pred             C-CCcEEEEECCCcEEEEEcCCCeEEEEeccccccCCCCCCCCCceeeCCCCCcccccceeeeccccCCCCCCCCccEEE
Q psy4771         121 K-NGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTV  199 (337)
Q Consensus       121 ~-~G~lyVad~~~gv~~vd~~~g~~~~l~~~~~~~~g~~~~~P~~v~~~~~g~~~~~~~v~~~~~~~~~~~~~~pn~v~v  199 (337)
                      + +|+|||+|..++++++|+++++++.+...   ..+.                                ++..||++++
T Consensus        89 ~~~g~l~v~d~~~~i~~~d~~~g~~~~~~~~---~~~~--------------------------------~~~~p~~i~~  133 (322)
T 2fp8_A           89 LQNNQLYIVDCYYHLSVVGSEGGHATQLATS---VDGV--------------------------------PFKWLYAVTV  133 (322)
T ss_dssp             TTTTEEEEEETTTEEEEECTTCEECEEEESE---ETTE--------------------------------ECSCEEEEEE
T ss_pred             CCCCcEEEEECCCCEEEEeCCCCEEEEeccc---CCCC--------------------------------cccccceEEE
Confidence            7 89999999888899999987777666541   1221                                4678999999


Q ss_pred             cC-CCcEEEEcCCCCc--cCceeee-eecCCccEEEEcCCCCeeEEEeccccceeeEEEccCCCEEEEEeCCCCEEEEEE
Q psy4771         200 DS-DGMVYWSDSSTKY--KSGLFEG-LTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYY  275 (337)
Q Consensus       200 d~-~G~lyvtd~~~~~--~~~~~~~-~~~~~G~v~~~d~~~~~~~~~~~~~~~p~gia~~~dg~~lyva~~~~~~I~~~~  275 (337)
                      |+ +|++||+|....+  .+....+ .....|+|+++|+++++.+.+...+..|+||++++||++|||+++..++|++|+
T Consensus       134 d~~~G~l~v~d~~~~~~~~~~~~~~~~~~~~g~v~~~d~~~~~~~~~~~~~~~p~gia~~~dg~~lyv~d~~~~~I~~~~  213 (322)
T 2fp8_A          134 DQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYW  213 (322)
T ss_dssp             CTTTCCEEEEESCSSCCTTCHHHHHHHTCCCEEEEEEETTTTEEEEEEEEESCCCEEEECTTSSEEEEEEGGGTEEEEEE
T ss_pred             ecCCCEEEEECCcccccccccceehcccCCCceEEEEeCCCCEEEEeccCCccCcceEECCCCCEEEEEeCCCCeEEEEE
Confidence            99 9999999986432  1110011 123458999999998988877788899999999999999999999999999999


Q ss_pred             eeCCCCCceeeeecCCCCCCCceeECCCCCEEEEecC
Q psy4771         276 LKGPKQGKSEVFIDGLPGLPDNVKRDSKGNFLVSLVC  312 (337)
Q Consensus       276 ~~g~~~~~~~~~~~~~~g~Pdgi~~d~dG~l~va~~~  312 (337)
                      +++...++.+.+.+ +++ |+||++|++|++||+...
T Consensus       214 ~~~~~~~~~~~~~~-~~g-P~gi~~d~~G~l~va~~~  248 (322)
T 2fp8_A          214 LEGPKKGTAEVLVK-IPN-PGNIKRNADGHFWVSSSE  248 (322)
T ss_dssp             SSSTTTTCEEEEEE-CSS-EEEEEECTTSCEEEEEEE
T ss_pred             CCCCcCCccceEEe-CCC-CCCeEECCCCCEEEEecC
Confidence            98766667777775 678 999999999999999976



>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1v04a_340 b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PO 8e-20
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 2e-05
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 0.002
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: Serum paraoxonase/arylesterase 1, PON1
domain: Serum paraoxonase/arylesterase 1, PON1
species: Rabit (Oryctolagus cuniculus) [TaxId: 9986]
 Score = 86.7 bits (214), Expect = 8e-20
 Identities = 37/282 (13%), Positives = 81/282 (28%), Gaps = 27/282 (9%)

Query: 56  KLFENEIHGPEAVVKHKGDLYMGVDGGHILKLSGGKLVPVVKLGKDC----YGFKYEQQC 111
            L +   +G E       DL +  +G   +  SG K   ++    D           ++ 
Sbjct: 28  NLVKGIDNGSE-------DLEILPNGLAFI-SSGLKYPGIMSFDPDKSGKILLMDLNEKE 79

Query: 112 GRPLGIKFDKNGALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDG 171
                ++   N       + F  + ++        +  +     G+   +      + + 
Sbjct: 80  PAVSELEIIGNTLD---ISSFNPHGISTFIDDDNTVYLLVVNHPGSSSTVEVFKFQEEEK 136

Query: 172 QTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGMVYWSDSSTKYKSGLFEGLTS--GSGRL 229
                   +     I        N +        Y ++    +     +      G    
Sbjct: 137 S-------LLHLKTIRHKLLPSVNDIVAVGPEHFYATNDHY-FIDPYLKSWEMHLGLAWS 188

Query: 230 IQYNPKTKKNKVLIANLHFANGVELSADESFVIVAETMSSRVHRYYLKGPKQGKSEVFID 289
                     +V+     FANG+ +S D  +V +AE ++ ++H Y             + 
Sbjct: 189 FVTYYSPNDVRVVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLRVLS 248

Query: 290 GLPGLPDNVKRDSKGNFLVSLVCPVEQPSEQAGNIRDPAGAQ 331
               L DN+  D     L  + C          +  +P G++
Sbjct: 249 -FDTLVDNISVDPVTGDLW-VGCHPNGMRIFFYDAENPPGSE 288


>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.94
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.93
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.9
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.89
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 99.82
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.81
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.78
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.73
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.73
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.68
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.62
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.57
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.5
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.42
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.35
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.26
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.26
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.16
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.14
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.05
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.95
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.86
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.77
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.76
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.75
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.69
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.65
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.65
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.64
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.6
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.6
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.58
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.57
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.49
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 98.47
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.42
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.33
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 98.3
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.23
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.2
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.06
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.0
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.99
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.94
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.92
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.68
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.6
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.52
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.46
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.42
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.38
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.19
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.09
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.06
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 96.65
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.43
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.43
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.35
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 96.33
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.3
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.3
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.22
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.01
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.71
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 95.68
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.3
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.11
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.1
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 94.99
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.57
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 94.46
d1tl2a_235 Tachylectin-2 {Japanese horseshoe crab (Tachypleus 94.17
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 93.81
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 93.71
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.1
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.08
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 92.83
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 92.62
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.56
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 90.89
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 90.72
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 90.5
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 84.84
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 83.26
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.85
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: SGL-like
domain: Diisopropylfluorophosphatase (phosphotriesterase, DFP)
species: Squid (Loligo vulgaris) [TaxId: 6622]
Probab=99.94  E-value=5.6e-26  Score=206.30  Aligned_cols=216  Identities=24%  Similarity=0.341  Sum_probs=156.4

Q ss_pred             ceeccCcccCccEEEe-eCCeEE-EEec-------CcEEEEEeCCc-eeEEEecCccccCccccCccCCcceEEECCCC-
Q psy4771          55 EKLFENEIHGPEAVVK-HKGDLY-MGVD-------GGHILKLSGGK-LVPVVKLGKDCYGFKYEQQCGRPLGIKFDKNG-  123 (337)
Q Consensus        55 ~~~~~g~~~~P~~i~~-~~g~ly-~d~~-------~g~I~~~~~~~-~~~~~~~g~~~~~~~~~~~~~~P~Gl~~d~~G-  123 (337)
                      +++.++ +.+||++++ .+|.+| ++..       +|+|+|+++.+ ...+......      ....+.|.||+++++| 
T Consensus        11 ~~v~~~-~~g~EGpa~d~dG~ly~~~~~~~~~~~~~g~I~r~d~~~~~~~~~~~~~~------~~~~g~P~Gl~~~~dg~   83 (314)
T d1pjxa_          11 TKVTED-IPGAEGPVFDKNGDFYIVAPEVEVNGKPAGEILRIDLKTGKKTVICKPEV------NGYGGIPAGCQCDRDAN   83 (314)
T ss_dssp             EEEECC-CTTCEEEEECTTSCEEEEETTCEETTEECCEEEEECTTTCCEEEEECCEE------TTEECCEEEEEECSSSS
T ss_pred             EEeecC-CCCCeEeEEeCCCCEEEEECccccccccCCEEEEEECCCCcEEEEECCcc------ccCCCcceeEEEeCCCC
Confidence            334444 678999999 688999 5433       57899999732 2222111111      1334679999999998 


Q ss_pred             cEEEEECCCcEEEEEcCCCeEEEEeccccccCCCCCCCCCceeeCCCCCcccccceeeeccccCCCCCCCCccEEEcCCC
Q psy4771         124 ALHVADAYFGLYKVNVTTGQTEQLISMDTEIDGAKPQIPNSVTVDSDGQTGQTEQLISMDTEIDGAKPQIPNSVTVDSDG  203 (337)
Q Consensus       124 ~lyVad~~~gv~~vd~~~g~~~~l~~~~~~~~g~~~~~P~~v~~~~~g~~~~~~~v~~~~~~~~~~~~~~pn~v~vd~~G  203 (337)
                      .|||+|..+++++++++++....+..   ..+|                                .+++.||++++|++|
T Consensus        84 ~l~vad~~~~i~~~~~~g~~~~~~~~---~~~g--------------------------------~~~~~pndl~~d~~G  128 (314)
T d1pjxa_          84 QLFVADMRLGLLVVQTDGTFEEIAKK---DSEG--------------------------------RRMQGCNDCAFDYEG  128 (314)
T ss_dssp             EEEEEETTTEEEEEETTSCEEECCSB---CTTS--------------------------------CBCBCCCEEEECTTS
T ss_pred             EEEEEECCCeEEEEeCCCcEEEEEec---cccc--------------------------------cccCCCcEEEECCCC
Confidence            68999988889999998665444332   2222                                267889999999999


Q ss_pred             cEEEEcCCCCccCceee-eeecCCccEEEEcCCCCeeEEEeccccceeeEEEccCCC----EEEEEeCCCCEEEEEEeeC
Q psy4771         204 MVYWSDSSTKYKSGLFE-GLTSGSGRLIQYNPKTKKNKVLIANLHFANGVELSADES----FVIVAETMSSRVHRYYLKG  278 (337)
Q Consensus       204 ~lyvtd~~~~~~~~~~~-~~~~~~G~v~~~d~~~~~~~~~~~~~~~p~gia~~~dg~----~lyva~~~~~~I~~~~~~g  278 (337)
                      ++||||+.......... ......|+||+++++ ++...+..++..||||+++++++    +|||+++..++|++|++++
T Consensus       129 ~lyvtd~~~~~~~~~~~~~~~~~~G~v~~~~~d-g~~~~~~~~~~~pNGi~~~~d~d~~~~~lyv~d~~~~~i~~~d~~~  207 (314)
T d1pjxa_         129 NLWITAPAGEVAPADYTRSMQEKFGSIYCFTTD-GQMIQVDTAFQFPNGIAVRHMNDGRPYQLIVAETPTKKLWSYDIKG  207 (314)
T ss_dssp             CEEEEECBCBCTTSCCCBTTSSSCEEEEEECTT-SCEEEEEEEESSEEEEEEEECTTSCEEEEEEEETTTTEEEEEEEEE
T ss_pred             CEEEecCccCcccccccceeccCCceEEEEeec-CceeEeeCCcceeeeeEECCCCCcceeEEEEEeecccceEEeeccC
Confidence            99999987543111111 124567899999986 56667778899999999998875    7999999999999999874


Q ss_pred             C-CCCceeeeec---CCCCCCCceeECCCCCEEEEecCC
Q psy4771         279 P-KQGKSEVFID---GLPGLPDNVKRDSKGNFLVSLVCP  313 (337)
Q Consensus       279 ~-~~~~~~~~~~---~~~g~Pdgi~~d~dG~l~va~~~~  313 (337)
                      . .....+++.+   ...+.||||++|++|+||||.+..
T Consensus       208 ~g~~~~~~~~~~~~~~~~~~pdGiavD~~GnlyVa~~~~  246 (314)
T d1pjxa_         208 PAKIENKKVWGHIPGTHEGGADGMDFDEDNNLLVANWGS  246 (314)
T ss_dssp             TTEEEEEEEEEECCCCSSCEEEEEEEBTTCCEEEEEETT
T ss_pred             ccccceeeEEEEccccccccceeeEEecCCcEEEEEcCC
Confidence            3 3445556554   123469999999999999999766



>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure