Psyllid ID: psy4803

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MDHTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
cccHHHHHHHHHHcccccHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHcHHHHHcccccccccccccccHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccHHHHHHHHHHHcccccccccccccccccc
cccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHcEHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHcHHcccccccHHHHHHHHHHHccccccccccEEEEcccc
MDHTVDSLLIDTYIKDqeermtapgitrSVCSLWFEARRgelmlgtdestfnailctrSYPQLAEVFSQYYTLTGHELDEAIGREfsgdikegliaispltnykpgfgliMCGLHCEFACLMFKhlvnkpseeRIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGcskhyfaenpfdfmenislegktnfferkvgeyqkssvmadqdnqvfrldeqf
MDHTVDSLLIDTYIkdqeermtapgitrsVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYqkssvmadqdnqvfrldeqf
MDHTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
******SLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKV***********************
*DHTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
MDHTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
**HTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHTVDSLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
P79733386 Ribonucleoside-diphosphat yes N/A 0.855 0.520 0.489 2e-49
Q4R7Q7389 Ribonucleoside-diphosphat N/A N/A 0.868 0.524 0.483 2e-49
P31350389 Ribonucleoside-diphosphat no N/A 0.868 0.524 0.478 3e-49
Q4R741351 Ribonucleoside-diphosphat N/A N/A 0.523 0.350 0.739 3e-49
Q7LG56351 Ribonucleoside-diphosphat no N/A 0.523 0.350 0.739 3e-49
Q5R9G0351 Ribonucleoside-diphosphat no N/A 0.523 0.350 0.739 3e-49
Q4KLN6390 Ribonucleoside-diphosphat yes N/A 0.868 0.523 0.470 9e-49
P11157390 Ribonucleoside-diphosphat yes N/A 0.868 0.523 0.466 2e-48
Q6PEE3351 Ribonucleoside-diphosphat no N/A 0.523 0.350 0.723 1e-47
Q60561386 Ribonucleoside-diphosphat N/A N/A 0.851 0.518 0.470 3e-47
>sp|P79733|RIR2_DANRE Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio GN=rrm2 PE=1 SV=1 Back     alignment and function desciption
 Score =  196 bits (497), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/241 (48%), Positives = 145/241 (60%), Gaps = 40/241 (16%)

Query: 7   SLLIDTYIKDQEERM-------TAPGITRSV--CSLWF---EARRGELMLGTDESTFNAI 54
           SLLIDTYIKD +ER        T P + +       W     AR GE ++    +    I
Sbjct: 174 SLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAF--AAVEGI 231

Query: 55  LCTRSYPQLAEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGL 114
             + S       F+  + L    L    G  FS +    LI+                GL
Sbjct: 232 FFSGS-------FASIFWLKKRGL--MPGLTFSNE----LISRDE-------------GL 265

Query: 115 HCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVA 174
           HC+FACLMFKHL+NKPSEE +K I+++AV +EQEFLT+ALPVKLIGMNCDLMKQYIE+VA
Sbjct: 266 HCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVA 325

Query: 175 DRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQ 234
           DRLL++LG  K Y  ENPFDFMENISLEGKTNFFE++VGEYQ+  VM+   +  F LD  
Sbjct: 326 DRLLLELGFDKVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSGTTDNTFTLDAD 385

Query: 235 F 235
           F
Sbjct: 386 F 386
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 1EC: 7EC: .EC: 4EC: .EC: 1
>sp|Q4R7Q7|RIR2_MACFA Ribonucleoside-diphosphate reductase subunit M2 OS=Macaca fascicularis GN=RRM2 PE=2 SV=1 Back     alignment and function description
>sp|P31350|RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens GN=RRM2 PE=1 SV=1 Back     alignment and function description
>sp|Q4R741|RIR2B_MACFA Ribonucleoside-diphosphate reductase subunit M2 B OS=Macaca fascicularis GN=RRM2B PE=2 SV=1 Back     alignment and function description
>sp|Q7LG56|RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens GN=RRM2B PE=1 SV=1 Back     alignment and function description
>sp|Q5R9G0|RIR2B_PONAB Ribonucleoside-diphosphate reductase subunit M2 B OS=Pongo abelii GN=RRM2B PE=2 SV=1 Back     alignment and function description
>sp|Q4KLN6|RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus GN=Rrm2 PE=2 SV=1 Back     alignment and function description
>sp|P11157|RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus GN=Rrm2 PE=1 SV=1 Back     alignment and function description
>sp|Q6PEE3|RIR2B_MOUSE Ribonucleoside-diphosphate reductase subunit M2 B OS=Mus musculus GN=Rrm2b PE=1 SV=1 Back     alignment and function description
>sp|Q60561|RIR2_MESAU Ribonucleoside-diphosphate reductase subunit M2 OS=Mesocricetus auratus GN=RRM2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
442754007 376 Putative ribonucleotide reductase beta s 0.893 0.558 0.487 4e-49
346465789 395 hypothetical protein [Amblyomma maculatu 0.893 0.531 0.5 5e-49
224048725 390 PREDICTED: ribonucleoside-diphosphate re 0.868 0.523 0.483 6e-49
300676950 390 ribonucleotide reductase M2 [Zonotrichia 0.868 0.523 0.478 6e-49
395509266 438 PREDICTED: ribonucleoside-diphosphate re 0.868 0.465 0.487 9e-49
397531939 386 ribonucleotide reductase small subunit R 0.523 0.318 0.739 9e-49
156387375 384 predicted protein [Nematostella vectensi 0.523 0.320 0.731 2e-48
363732458 384 PREDICTED: ribonucleoside-diphosphate re 0.868 0.531 0.478 2e-48
241166485 376 ribonucleotide reductase, beta subunit, 0.868 0.542 0.487 2e-48
145580571332 Chain A, Crystal Structure Of Human Ribo 0.872 0.617 0.476 3e-48
>gi|442754007|gb|JAA69163.1| Putative ribonucleotide reductase beta subunit [Ixodes ricinus] Back     alignment and taxonomy information
 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/232 (48%), Positives = 147/232 (63%), Gaps = 22/232 (9%)

Query: 7   SLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQ---L 63
           SLLIDTYIKD  ER        ++  +  +A      +G   +TF   +   +  +    
Sbjct: 164 SLLIDTYIKDPSERDRLFNAVETMPCIKRKADWALNWIGNRSATFGERIVAFAAVEGIFF 223

Query: 64  AEVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMCGLHCEFACLMF 123
           +  F+  + L    L    G  FS +    LI+                GLH +FACLMF
Sbjct: 224 SGSFASIFWLKKRGL--MPGLTFSNE----LISRDE-------------GLHTDFACLMF 264

Query: 124 KHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGC 183
            HL NKPS+ER++ I+ DAV++EQEFLT+ALPV LIGMNC+LMK+YIE+VADRLLV+LGC
Sbjct: 265 SHLXNKPSQERVRQIICDAVVIEQEFLTDALPVALIGMNCELMKRYIEFVADRLLVELGC 324

Query: 184 SKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF 235
            K Y +ENPFDFME+ISLEGKTNFFE++VGEYQK+ VMA+++ QVF LD  F
Sbjct: 325 EKVYNSENPFDFMEHISLEGKTNFFEKRVGEYQKAGVMANKEEQVFTLDADF 376

Source: Ixodes ricinus

Species: Ixodes ricinus

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|346465789|gb|AEO32739.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|224048725|ref|XP_002196356.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|300676950|gb|ADK26821.1| ribonucleotide reductase M2 [Zonotrichia albicollis] Back     alignment and taxonomy information
>gi|395509266|ref|XP_003758922.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|397531939|gb|AFO54479.1| ribonucleotide reductase small subunit R2ii [Carassius carassius] Back     alignment and taxonomy information
>gi|156387375|ref|XP_001634179.1| predicted protein [Nematostella vectensis] gi|156221259|gb|EDO42116.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|363732458|ref|XP_001231545.2| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 isoform 1 [Gallus gallus] Back     alignment and taxonomy information
>gi|241166485|ref|XP_002409876.1| ribonucleotide reductase, beta subunit, putative [Ixodes scapularis] gi|215494664|gb|EEC04305.1| ribonucleotide reductase, beta subunit, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit R2 Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
UNIPROTKB|E1BXP4388 RRM2 "Uncharacterized protein" 0.523 0.317 0.723 6.8e-51
ZFIN|ZDB-GENE-990415-25386 rrm2 "ribonucleotide reductase 0.523 0.318 0.723 6.8e-51
UNIPROTKB|Q4R7Q7389 RRM2 "Ribonucleoside-diphospha 0.523 0.316 0.723 4.7e-50
UNIPROTKB|P31350389 RRM2 "Ribonucleoside-diphospha 0.523 0.316 0.715 6e-50
UNIPROTKB|H0YAV1408 RRM2B "Ribonucleoside-diphosph 0.523 0.301 0.739 9.8e-50
UNIPROTKB|Q7LG56351 RRM2B "Ribonucleoside-diphosph 0.523 0.350 0.739 9.8e-50
UNIPROTKB|E1BI58390 RRM2 "Uncharacterized protein" 0.523 0.315 0.707 1.3e-49
RGD|2323655390 LOC100359539 "ribonucleotide r 0.523 0.315 0.707 1.3e-49
RGD|1598310390 Rrm2 "ribonucleotide reductase 0.523 0.315 0.699 2.6e-49
UNIPROTKB|F1P0T9326 RRM2B "Uncharacterized protein 0.523 0.377 0.715 3.3e-49
UNIPROTKB|E1BXP4 RRM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 486 (176.1 bits), Expect = 6.8e-51, Sum P(2) = 6.8e-51
 Identities = 89/123 (72%), Positives = 106/123 (86%)

Query:   113 GLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEY 172
             GLHC+FACLMFKHL+ KPSEER+K I+++AVL+EQEFLTEALPVKLIGMNC LMKQYIE+
Sbjct:   266 GLHCDFACLMFKHLIRKPSEERVKEIIMNAVLIEQEFLTEALPVKLIGMNCTLMKQYIEF 325

Query:   173 VADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLD 232
             VADRL+++LG  K Y  ENPFDFMENISLEGKTNFFE++VGEYQ+  VM+   +  F LD
Sbjct:   326 VADRLMLELGFRKIYKVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSKPTDNSFTLD 385

Query:   233 EQF 235
              +F
Sbjct:   386 AEF 388
GO:0005971 "ribonucleoside-diphosphate reductase complex" evidence=IEA
GO:0009186 "deoxyribonucleoside diphosphate metabolic process" evidence=IEA
GO:0046914 "transition metal ion binding" evidence=IEA
GO:0004748 "ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor" evidence=IEA
GO:0009263 "deoxyribonucleotide biosynthetic process" evidence=IEA
GO:0051290 "protein heterotetramerization" evidence=IEA
ZFIN|ZDB-GENE-990415-25 rrm2 "ribonucleotide reductase M2 polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7Q7 RRM2 "Ribonucleoside-diphosphate reductase subunit M2" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P31350 RRM2 "Ribonucleoside-diphosphate reductase subunit M2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YAV1 RRM2B "Ribonucleoside-diphosphate reductase subunit M2 B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7LG56 RRM2B "Ribonucleoside-diphosphate reductase subunit M2 B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BI58 RRM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2323655 LOC100359539 "ribonucleotide reductase M2 polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1598310 Rrm2 "ribonucleotide reductase M2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0T9 RRM2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42521RIR2_DICDI1, ., 1, 7, ., 4, ., 10.53700.45950.3195yesN/A
Q9LSD0RIR2C_ARATH1, ., 1, 7, ., 4, ., 10.62010.52340.3704yesN/A
Q6Y657RIR2B_ARATH1, ., 1, 7, ., 4, ., 10.58460.52340.3693yesN/A
Q8SRR2RIR2_ENCCU1, ., 1, 7, ., 4, ., 10.41810.88510.64yesN/A
P42170RIR2_CAEEL1, ., 1, 7, ., 4, ., 10.60160.52340.3228yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.17.4.10.824
3rd Layer1.17.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
PLN02492324 PLN02492, PLN02492, ribonucleoside-diphosphate red 6e-69
PTZ00211330 PTZ00211, PTZ00211, ribonucleoside-diphosphate red 2e-65
pfam00268281 pfam00268, Ribonuc_red_sm, Ribonucleotide reductas 5e-32
cd01049288 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta 7e-30
COG0208348 COG0208, NrdF, Ribonucleotide reductase, beta subu 4e-24
pfam0019166 pfam00191, Annexin, Annexin 5e-17
PRK07209369 PRK07209, PRK07209, ribonucleotide-diphosphate red 7e-16
smart0033553 smart00335, ANX, Annexin repeats 6e-15
PRK09614324 PRK09614, nrdF, ribonucleotide-diphosphate reducta 8e-08
PRK12759410 PRK12759, PRK12759, bifunctional gluaredoxin/ribon 5e-07
>gnl|CDD|215272 PLN02492, PLN02492, ribonucleoside-diphosphate reductase Back     alignment and domain information 
 Score =  214 bits (546), Expect = 6e-69
 Identities = 80/128 (62%), Positives = 97/128 (75%), Gaps = 5/128 (3%)

Query: 113 GLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEY 172
           GLHC+FACL++  L NK SEER+K IV +AV +E+EF+ +ALP  L+GMN DLM QYIE+
Sbjct: 197 GLHCDFACLLYSLLKNKLSEERVKEIVCEAVEIEKEFVCDALPCALVGMNADLMSQYIEF 256

Query: 173 VADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMA-----DQDNQ 227
           VADRLLV LG  K Y   NPFD+ME ISL+GKTNFFE++VGEYQK+ VM+       DN 
Sbjct: 257 VADRLLVALGYEKVYNVVNPFDWMELISLQGKTNFFEKRVGEYQKAGVMSSLNGGGADNH 316

Query: 228 VFRLDEQF 235
           VF LDE F
Sbjct: 317 VFSLDEDF 324

Length = 324
>gnl|CDD|240315 PTZ00211, PTZ00211, ribonucleoside-diphosphate reductase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|144013 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, small chain Back     alignment and domain information
>gnl|CDD|153108 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information
>gnl|CDD|223286 COG0208, NrdF, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information
>gnl|CDD|235968 PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information
>gnl|CDD|236591 PRK09614, nrdF, ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|139206 PRK12759, PRK12759, bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
KOG1567|consensus344 100.0
PTZ00211330 ribonucleoside-diphosphate reductase small subunit 100.0
PLN02492324 ribonucleoside-diphosphate reductase 100.0
PRK09101376 nrdB ribonucleotide-diphosphate reductase subunit 100.0
PRK07209369 ribonucleotide-diphosphate reductase subunit beta; 100.0
COG0208348 NrdF Ribonucleotide reductase, beta subunit [Nucle 100.0
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphat 100.0
PRK09614324 nrdF ribonucleotide-diphosphate reductase subunit 100.0
PRK13966324 nrdF2 ribonucleotide-diphosphate reductase subunit 99.98
PRK13965335 ribonucleotide-diphosphate reductase subunit beta; 99.97
PRK13967322 nrdF1 ribonucleotide-diphosphate reductase subunit 99.96
cd01049288 RNRR2 Ribonucleotide Reductase, R2/beta subunit, f 99.95
PF00268281 Ribonuc_red_sm: Ribonucleotide reductase, small ch 99.94
KOG0819|consensus321 99.7
KOG0819|consensus321 99.69
PRK08326311 ribonucleotide-diphosphate reductase subunit beta; 99.67
cd07911280 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like 99.67
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.63
smart0033553 ANX Annexin repeats. 99.27
>KOG1567|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-54  Score=357.07  Aligned_cols=205  Identities=56%  Similarity=0.867  Sum_probs=199.1

Q ss_pred             hh-hhHHHHHHHhcCcccccccc-cccCChH----HHHHHHHhhhccCCCcHHHHHHHHhCCCHHHHHHHHHHHHHhhCC
Q psy4803           3 HT-VDSLLIDTYIKDQEERMTAP-GITRSVC----SLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGH   76 (235)
Q Consensus         3 h~-~ys~~~~~~~~~~~~~~~i~-~~~~~~~----~d~~~l~~a~~~~g~de~~~~~iL~~rs~~~l~~i~~~y~~~~g~   76 (235)
                      || +||++||+|++||.+|+.+| +|.+.|+    +||.     ++|++...+.+.+.|+     .+.++          
T Consensus       127 HSEmYSlLidtyIrD~ker~~LFnAI~t~p~vk~KAdWa-----lrWI~d~~s~faeRlv-----AFAav----------  186 (344)
T KOG1567|consen  127 HSEMYSLLIDTYIRDPKEREFLFNAIETIPEVKKKADWA-----LRWISDKDSLFAERLV-----AFAAV----------  186 (344)
T ss_pred             HHHHHHHHHHHHhcChhhhhHHHHHHHhhHHHHHHHHHH-----HHHhcCCCccHHHHHH-----HHHHH----------
Confidence            77 99999999999999999999 9999999    8888     9999998999999999     88888          


Q ss_pred             cHHHHhhccchhhH-------HHHHHhhccccccccchhhhcccchhhHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHH
Q psy4803          77 ELDEAIGREFSGDI-------KEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEF  149 (235)
Q Consensus        77 ~l~~~i~~~~sg~f-------~~~ll~l~~~~~~a~~li~~de~~ht~~~~ll~~~L~~~~~~~~i~~i~~~av~iE~~f  149 (235)
                           +|+.|||+|       +++||   ||+.+++.||+||+|+||+|+|+++.+|+.+|..+.|.+|+.+||+||++|
T Consensus       187 -----EGIFFSgsFasIFWLKKRGlM---PGLTfSNELIsrdeglh~dFacll~~~l~~kp~~~ri~eII~eAV~IEqef  258 (344)
T KOG1567|consen  187 -----EGIFFSGSFASIFWLKKRGLM---PGLTFSNELISRDEGLHCDFACLLFSHLKKKPNEERIEEIITEAVEIEQEF  258 (344)
T ss_pred             -----hhhhcccchhhhhhhhhcCCC---CccccchhhhhhccCCcccHHHHHHHHHhhCCCHHHHHHHHHHHHHHHHHH
Confidence                 999999999       78999   999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCchHHHhhhhcCCCCccccccchhhccccccCCCCCce
Q psy4803         150 LTEALPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVF  229 (235)
Q Consensus       150 ~~~~~~~~~~gl~~~~~~~yi~~~an~~l~~lG~~~~y~~~np~~w~~~~~~~~~~nffe~~~~~Y~~~~~~~~~~~~~~  229 (235)
                      ...++|..++|||+.+|.+||+|+||++|..||+++.|+++||++||+.++..++|||||+||++||+.+++.+..+++|
T Consensus       259 ~~eaLPv~liGMN~~lM~qYIEFVADrLL~~lG~~K~Yn~~NPFdfMEnISl~GKTNFFEKrVseYQk~~vMs~~~~~~F  338 (344)
T KOG1567|consen  259 LTEALPVNLIGMNCDLMSQYIEFVADRLLVELGNEKYYNAENPFDFMENISLAGKTNFFEKRVSEYQKAGVMSNEPENVF  338 (344)
T ss_pred             HHhccchhhhccCHHHHHHHHHHHHHHHHHHhCccceecCCCchHHHHHhhhccccchHHhhhHHhhhchhccCCcccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998777899


Q ss_pred             eccCCC
Q psy4803         230 RLDEQF  235 (235)
Q Consensus       230 ~~~~~~  235 (235)
                      ++|+||
T Consensus       339 ~ld~dF  344 (344)
T KOG1567|consen  339 TLDADF  344 (344)
T ss_pred             ccccCC
Confidence            999998

>PTZ00211 ribonucleoside-diphosphate reductase small subunit; Provisional Back     alignment and domain information
>PLN02492 ribonucleoside-diphosphate reductase Back     alignment and domain information
>PRK09101 nrdB ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>PRK07209 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>COG0208 NrdF Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK09614 nrdF ribonucleotide-diphosphate reductase subunit beta; Reviewed Back     alignment and domain information
>PRK13966 nrdF2 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13965 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PRK13967 nrdF1 ribonucleotide-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd01049 RNRR2 Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain Back     alignment and domain information
>PF00268 Ribonuc_red_sm: Ribonucleotide reductase, small chain; InterPro: IPR000358 Ribonucleotide reductase (1 Back     alignment and domain information
>KOG0819|consensus Back     alignment and domain information
>KOG0819|consensus Back     alignment and domain information
>PRK08326 ribonucleotide-diphosphate reductase subunit beta; Validated Back     alignment and domain information
>cd07911 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like protein, Mn/Fe-binding domain Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2uw2_A332 Crystal Structure Of Human Ribonucleotide Reductase 4e-51
3hf1_A351 Crystal Structure Of Human P53r2 Length = 351 2e-50
1h0n_A390 Cobalt Substitution Of Mouse R2 Ribonucleotide Redu 2e-49
2vux_A326 Human Ribonucleotide Reductase, Subunit M2 B Length 5e-41
1smq_A399 Structure Of The Ribonucleotide Reductase Rnr2 Homo 4e-38
4djn_A311 Crystal Structure Of A Ribonucleotide Reductase M2 4e-38
1jk0_A419 Ribonucleotide Reductase Y2y4 Heterodimer Length = 5e-38
3olj_A286 Crystal Structure Of Human Ribonucleotide Reductase 9e-36
2p1i_A349 Plasmodium Yoelii Ribonucleotide Reductase Subunit 1e-34
1jk0_B345 Ribonucleotide Reductase Y2y4 Heterodimer Length = 1e-25
2o1z_A311 Plasmodium Vivax Ribonucleotide Reductase Subunit R 3e-20
1dm5_A315 Annexin Xii E105k Homohexamer Crystal Structure Len 1e-13
1aei_A315 Crystal Structure Of The Annexin Xii Hexamer Length 2e-13
1ain_A314 Crystal Structure Of Human Annexin I At 2.5 Angstro 8e-11
1ala_A321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 2e-10
1yii_A320 Crystal Structures Of Chicken Annexin V In Complex 2e-10
4d8f_A366 Chlamydia Trachomatis Nrdb With A MnFE COFACTOR (PR 9e-10
1syy_A346 Crystal Structure Of The R2 Subunit Of Ribonucleoti 1e-09
2ani_A346 Crystal Structure Of The F127y Mutant Of Ribonucleo 1e-09
1avc_A673 Bovine Annexin Vi (Calcium-Bound) Length = 673 6e-09
1m9i_A672 Crystal Structure Of Phosphorylation-Mimicking Muta 7e-09
1bcy_A319 Recombinant Rat Annexin V, T72k Mutant Length = 319 9e-09
1bcz_A319 Recombinant Rat Annexin V, T72s Mutant Length = 319 9e-09
1bcw_A319 Recombinant Rat Annexin V, T72a Mutant Length = 319 9e-09
1g5n_A318 Annexin V Complex With Heparin Oligosaccharides Len 1e-08
1a8a_A319 Rat Annexin V Complexed With Glycerophosphoserine L 1e-08
1n44_A319 Crystal Structure Of Annexin V R23e Mutant Length = 1e-08
1n42_A319 Crystal Structure Of Annexin V R149e Mutant Length 1e-08
1n41_A319 Crystal Structure Of Annexin V K27e Mutant Length = 1e-08
2ran_A316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 1e-08
1bc0_A319 Recombinant Rat Annexin V, W185a Mutant Length = 31 1e-08
2h0l_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 1e-08
2h0k_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 1e-08
2h0m_A318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 2e-08
1avh_A320 Crystal And Molecular Structure Of Human Annexin V 2e-08
1hve_A319 Structural And Electrophysiological Analysis Of Ann 2e-08
1anw_A319 The Effect Of Metal Binding On The Structure Of Ann 2e-08
1hvf_A319 Structural And Electrophysiological Analysis Of Ann 2e-08
1hvd_A319 Structural And Electrophysiological Analysis Of Ann 3e-08
1bc1_A319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 3e-08
1bc3_A319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 3e-08
2xo2_A320 Human Annexin V With Incorporated Methionine Analog 3e-08
1sav_A320 Human Annexin V With Proline Substitution By Thiopr 4e-08
1hm6_A346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 1e-07
1aii_A323 Annexin Iii Length = 323 3e-07
1axn_A323 The High Resolution Structure Of Annexin Iii Shows 3e-07
2zhi_A322 Crystal Structure Analysis Of The Sodium-Bound Anne 1e-06
1w3w_A327 The 2.1 Angstroem Resolution Structure Of Annexin A 2e-05
1w45_A327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 2e-05
2zoc_A319 Crystal Structure Of Recombinant Human Annexin Iv L 2e-05
1aow_A309 Annexin Iv Length = 309 3e-05
1i4a_A318 Crystal Structure Of Phosphorylation-Mimicking Muta 3e-05
1ann_A318 Annexin Iv Length = 318 3e-05
2rcc_A346 Crystal Structure Of Putative Class I Ribonucleotid 1e-04
>pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit R2 Length = 332 Back     alignment and structure 
Iteration: 1

 Score =  197 bits (501), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 113/237 (47%), Positives = 144/237 (60%), Gaps = 32/237 (13%)
Query: 7   SLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEV 66
           SLLIDTYIKD +ER        ++  +  +A      +G  E+T+   +   ++  +  +
Sbjct: 120 SLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVV--AFAAVEGI 177
Query: 67  FSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMC--------GLHCEF 118
           F                  FSG       +I  L    P  GL           GLHC+F
Sbjct: 178 F------------------FSG----SFASIFWLKKRGPMPGLTFSNELISRDEGLHCDF 215
Query: 119 ACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLL 178
           ACLMFKHLV+KPSEER++ I+++AV +EQEFLTEALPVKLIGMNC LMKQYIE+VADRL+
Sbjct: 216 ACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLM 275
Query: 179 VDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF 235
           ++LG SK +  ENPFDFMENISLEGKTNFFE++VGEYQ+  VM+      F LD  F
Sbjct: 276 LELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF 332
>pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2 Length = 351 Back     alignment and structure
>pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase To Model The Reactive Diferrous State Length = 390 Back     alignment and structure
>pdb|2VUX|A Chain A, Human Ribonucleotide Reductase, Subunit M2 B Length = 326 Back     alignment and structure
>pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer From Saccharomyces Cerevisiae Length = 399 Back     alignment and structure
>pdb|4DJN|A Chain A, Crystal Structure Of A Ribonucleotide Reductase M2 B (Rnrr2) From Homo Sapiens At 2.20 A Resolution Length = 311 Back     alignment and structure
>pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer Length = 419 Back     alignment and structure
>pdb|3OLJ|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase Subunit M2 (Hrrm2) Length = 286 Back     alignment and structure
>pdb|2P1I|A Chain A, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2 (Py03671) Length = 349 Back     alignment and structure
>pdb|1JK0|B Chain B, Ribonucleotide Reductase Y2y4 Heterodimer Length = 345 Back     alignment and structure
>pdb|2O1Z|A Chain A, Plasmodium Vivax Ribonucleotide Reductase Subunit R2 (Pv086155) Length = 311 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|4D8F|A Chain A, Chlamydia Trachomatis Nrdb With A MnFE COFACTOR (PROCEDURE 1 - High Mn) Length = 366 Back     alignment and structure
>pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide Reductase From Chlamydia Trachomatis Length = 346 Back     alignment and structure
>pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide Reductase R2 From Chlamydia Trachomatis Length = 346 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|2RCC|A Chain A, Crystal Structure Of Putative Class I Ribonucleotide Reductase (Np_241368.1) From Bacillus Halodurans At 1.90 A Resolution Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2p1i_A349 Ribonucleotide reductase, small chain; F222 twinni 2e-65
1h0o_A390 Ribonucleoside-diphosphate reductase; oxidoreducta 1e-64
1jk0_A419 RNR Y2, ribonucleoside-diphosphate reductase small 3e-64
1jk0_B345 RNR Y4, ribonucleoside-diphosphate reductase small 3e-60
1syy_A346 Ribonucleoside-diphosphate reductase beta chain; D 3e-54
4a58_A324 Ribonucleoside-diphosphate reductase small chain; 1e-51
2o1z_A311 Ribonucleotide reductase subunit R2; small subunit 2e-44
3olj_A286 Ribonucleoside-diphosphate reductase subunit M2; m 5e-43
4dr0_A350 Ribonucleoside-diphosphate reductase subunit beta; 2e-41
1mxr_A375 Ribonucleotide reductase R2; radical protein, DI i 2e-31
3n37_A319 Ribonucleoside-diphosphate reductase 2 subunit BE; 1e-30
2rcc_A346 Ribonucleoside-diphosphate reductase subunit beta; 4e-30
3dhz_A329 Ribonucleotide reductase subunit R2F; metal free, 8e-28
3ee4_A323 Probable ribonucleoside-diphosphate reductase; man 3e-20
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 6e-16
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 8e-08
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 2e-05
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 8e-15
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 9e-14
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-07
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 3e-07
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-07
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-06
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-05
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 6e-05
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 8e-15
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 1e-05
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 8e-04
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 3e-14
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 6e-08
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 5e-07
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 4e-06
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 5e-14
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-08
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-06
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 2e-05
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 6e-14
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 7e-08
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 1e-07
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 1e-05
3mjo_A296 Ribonucleotide reductase subunit R2F; Mn ribonucle 6e-14
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 8e-14
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-07
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 3e-07
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 4e-05
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 2e-13
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 6e-08
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 7e-08
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 3e-05
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 6e-13
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-08
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-07
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 9e-06
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-12
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-08
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 4e-07
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 9e-05
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 3e-12
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 1e-08
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 2e-07
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 9e-06
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 3e-11
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 3e-06
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 1e-05
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, S genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii} Length = 349 Back     alignment and structure
 Score =  205 bits (523), Expect = 2e-65
 Identities = 86/237 (36%), Positives = 121/237 (51%), Gaps = 33/237 (13%)

Query: 7   SLLIDTYIKDQEERMTAPGITRSVCSLWFEARRGELMLGTDESTFNAIL--CTRSYPQLA 64
           SLLID YIKD++ER+       ++ ++  +A      +    S    I+          +
Sbjct: 138 SLLIDNYIKDEKERLNLFHAIENIPAIKNKALWAAKWINDTNSFAERIVANACVEGILFS 197

Query: 65  EVFSQYYTLTGHELDEAIGREFSGDIKEGLIAISPLTNYKPGFGLIMC------GLHCEF 118
             F   +                              N   G            GLH +F
Sbjct: 198 GSFCAIFWFKKQ-------------------------NKLHGLTFSNELISRDEGLHTDF 232

Query: 119 ACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEYVADRLL 178
            CL++  L NK  E  +++IV +AV VE+ F+ E+LP  LIGMN  LM QYIE+VADRLL
Sbjct: 233 NCLIYSLLENKLPENVVQNIVKEAVEVERSFICESLPCDLIGMNSRLMSQYIEFVADRLL 292

Query: 179 VDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF 235
             LGCSK + ++NPF++M+ ISL+GKTNFFE++V +YQKS VMA +  QVF L+  F
Sbjct: 293 ECLGCSKVFHSKNPFNWMDLISLQGKTNFFEKRVADYQKSGVMAQRKEQVFSLNTDF 349
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Length = 390 Back     alignment and structure
>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Length = 419 Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Length = 345 Back     alignment and structure
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune EVAS replication, oxidoreductase; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 4d8g_A 4d8f_A 2ani_A Length = 346 Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Length = 311 Back     alignment and structure
>3olj_A Ribonucleoside-diphosphate reductase subunit M2; metal-binding, HRRM2, oxidoreductase; 2.10A {Homo sapiens} Length = 286 Back     alignment and structure
>4dr0_A Ribonucleoside-diphosphate reductase subunit beta; ribonucleotide reductase, manganese, oxidoreductase; 1.90A {Bacillus subtilis} Length = 350 Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 3uus_E* 1yfd_A 1piy_A 1r65_A 2xof_A* 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A ... Length = 375 Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Length = 319 Back     alignment and structure
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Length = 346 Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A Length = 329 Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, C monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} Length = 323 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} PDB: 1uzr_A* Length = 296 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
1jk0_A419 RNR Y2, ribonucleoside-diphosphate reductase small 100.0
2p1i_A349 Ribonucleotide reductase, small chain; F222 twinni 100.0
1jk0_B345 RNR Y4, ribonucleoside-diphosphate reductase small 100.0
1h0o_A390 Ribonucleoside-diphosphate reductase; oxidoreducta 100.0
1syy_A346 Ribonucleoside-diphosphate reductase beta chain; D 100.0
4a58_A324 Ribonucleoside-diphosphate reductase small chain; 100.0
2rcc_A346 Ribonucleoside-diphosphate reductase subunit beta; 100.0
1mxr_A375 Ribonucleotide reductase R2; radical protein, DI i 100.0
4dr0_A350 Ribonucleoside-diphosphate reductase subunit beta; 100.0
3n37_A319 Ribonucleoside-diphosphate reductase 2 subunit BE; 100.0
3dhz_A329 Ribonucleotide reductase subunit R2F; metal free, 100.0
3olj_A286 Ribonucleoside-diphosphate reductase subunit M2; m 100.0
2o1z_A311 Ribonucleotide reductase subunit R2; small subunit 99.97
3mjo_A296 Ribonucleotide reductase subunit R2F; Mn ribonucle 99.92
3ee4_A323 Probable ribonucleoside-diphosphate reductase; man 99.87
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 99.61
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 99.61
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.6
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 99.6
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.59
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.59
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 99.59
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.58
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 99.58
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.57
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 99.57
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 99.57
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 99.56
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 99.55
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.54
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 99.54
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 99.53
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.5
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 99.48
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.47
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.47
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 99.47
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 99.46
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.45
>1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Back     alignment and structure
Probab=100.00  E-value=2.1e-42  Score=308.60  Aligned_cols=209  Identities=45%  Similarity=0.705  Sum_probs=145.7

Q ss_pred             hh-hhHHHHHHHhcCcccccccc-cccCChHHHHHHHHhhhccCCCcHHHHHHHHhCCCHHHHHHHHHHHHHhhCCcHHH
Q psy4803           3 HT-VDSLLIDTYIKDQEERMTAP-GITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDE   80 (235)
Q Consensus         3 h~-~ys~~~~~~~~~~~~~~~i~-~~~~~~~~d~~~l~~a~~~~g~de~~~~~iL~~rs~~~l~~i~~~y~~~~g~~l~~   80 (235)
                      |+ +||++|+++++||.+|+++| ++.+.|+.. +...-+.++...+...+.+.++     ....+              
T Consensus       199 HsesYS~il~tl~~d~~e~~~iF~~i~~~p~L~-~Ka~~i~~~~~~~~~~~~~~lv-----a~~~l--------------  258 (419)
T 1jk0_A          199 HSETYSLLIDTYIKDPKESEFLFNAIHTIPEIG-EKAEWALRWIQDADALFGERLV-----AFASI--------------  258 (419)
T ss_dssp             HHHHHHHHHHHHCCCHHHHHHHHHHHTTCHHHH-HHHHHHHHHTTSSSCCHHHHHH-----HHHHH--------------
T ss_pred             HHHHHHHHHHHhCCCHHHHHHHHHHHhhCHHHH-HHHHHHHHHHhccchhHHHHHH-----HHHHH--------------
Confidence            87 99999999999999999999 999999811 1111224444333333444444     23222              


Q ss_pred             HhhccchhhH-------HHHHHhhccccccccchhhhcccchhhHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHhh
Q psy4803          81 AIGREFSGDI-------KEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEA  153 (235)
Q Consensus        81 ~i~~~~sg~f-------~~~ll~l~~~~~~a~~li~~de~~ht~~~~ll~~~L~~~~~~~~i~~i~~~av~iE~~f~~~~  153 (235)
                       ++..|+|.|       ++++|   ||+.+++++|.|||++|+.+++.+++.+..+++.++|++++.+||++|++|++++
T Consensus       259 -EGI~fsg~Fa~~~~l~~rg~M---pG~~~~i~lI~RDE~lH~~f~~~l~~~l~~~~~~e~v~el~~eave~E~~~~~~~  334 (419)
T 1jk0_A          259 -EGVFFSGSFASIFWLKKRGMM---PGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDA  334 (419)
T ss_dssp             -HHTTTHHHHHHHHHHHHTTCC---HHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             -HHHHHHHHHHHHHHHHHcCCC---ccHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHHHHHHHHHh
Confidence             888899998       45666   9999999999999999999999999998888899999999999999999999999


Q ss_pred             cCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCchHHHhhhhcCCCCccccccchhhccccccCC---CCCcee
Q psy4803         154 LPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQ---DNQVFR  230 (235)
Q Consensus       154 ~~~~~~gl~~~~~~~yi~~~an~~l~~lG~~~~y~~~np~~w~~~~~~~~~~nffe~~~~~Y~~~~~~~~~---~~~~~~  230 (235)
                      +|.+++|||++.|++||+|+||++|.+||++|+|++.||+|||+.++..+++||||+++++|+++++....   .+++|+
T Consensus       335 lp~~liGln~~~~~~YI~Y~Anr~L~~LG~~~~y~~~NP~~wm~~is~~~ktnFFE~r~t~Y~k~~~~~~~~~~~~~~~~  414 (419)
T 1jk0_A          335 LPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENISLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFT  414 (419)
T ss_dssp             SCGGGGTCCHHHHHHHHHHHHHHHHHTTTCCCSSCCCCCCGGGGC-----------------------------------
T ss_pred             ccCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCCChHHHHHhccccccccCcCCcccccccccccccCCCCCCccc
Confidence            99889999999999999999999999999999999999999999888888899999999999999877643   367899


Q ss_pred             ccCCC
Q psy4803         231 LDEQF  235 (235)
Q Consensus       231 ~~~~~  235 (235)
                      ||+||
T Consensus       415 ~~~~f  419 (419)
T 1jk0_A          415 FNEDF  419 (419)
T ss_dssp             -----
T ss_pred             cCCCC
Confidence            99998
>2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, S genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii} Back     alignment and structure
>1jk0_B RNR Y4, ribonucleoside-diphosphate reductase small chain 2; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1sms_A Back     alignment and structure
>1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Back     alignment and structure
>1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune EVAS replication, oxidoreductase; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 4d8g_A 4d8f_A 2ani_A Back     alignment and structure
>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>1mxr_A Ribonucleotide reductase R2; radical protein, DI iron, oxidoreductase; 1.42A {Escherichia coli} SCOP: a.25.1.2 PDB: 1jpr_A 1jqc_A 1xik_A 3uus_E* 1yfd_A 1piy_A 1r65_A 2xof_A* 1biq_B* 1rsv_A 1piz_A 1piu_A 1pim_A 1rsr_A 1biq_A* 1rib_A 1mrr_A 1rnr_A* 1pj0_A 1pj1_A ... Back     alignment and structure
>4dr0_A Ribonucleoside-diphosphate reductase subunit beta; ribonucleotide reductase, manganese, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Back     alignment and structure
>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A Back     alignment and structure
>3olj_A Ribonucleoside-diphosphate reductase subunit M2; metal-binding, HRRM2, oxidoreductase; 2.10A {Homo sapiens} PDB: 4djn_A Back     alignment and structure
>2o1z_A Ribonucleotide reductase subunit R2; small subunit ribonucleotide reductase, oxidoreductase, DNA replication, iron, DIIRON, radical, R2 subunit; 2.40A {Plasmodium vivax} Back     alignment and structure
>3mjo_A Ribonucleotide reductase subunit R2F; Mn ribonucleotide reductase, RNR, radical enzyme, split SIGN metallocofactor; 1.36A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1uzr_A* Back     alignment and structure
>3ee4_A Probable ribonucleoside-diphosphate reductase; manganese, iron, DIIRON, carboxylate, oxidase, ligand, C monooxygenase; HET: MYR; 1.90A {Mycobacterium tuberculosis} PDB: 4ac8_A* Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1jk0a_334 a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's 4e-25
d1w68a_281 a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse ( 1e-21
d1syya_317 a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamyd 2e-21
d1jk0b_285 a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's 1e-20
d1mxra_339 a.25.1.2 (A:) Ribonucleotide reductase R2 {Escheri 6e-18
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 5e-14
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 6e-12
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 8e-10
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 4e-07
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 0.002
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 1e-11
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 5e-09
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 8e-07
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 6e-05
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 2e-11
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 2e-09
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 3e-07
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 4e-04
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 8e-11
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 2e-09
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-06
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 5e-05
d3dhza1284 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {C 8e-11
d1r2fa_283 a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmone 1e-10
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 8e-10
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 4e-09
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 8e-07
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-04
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-09
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 5e-09
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 9e-07
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-04
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 1e-09
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 3e-09
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 1e-06
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 0.001
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 2e-09
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 2e-09
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 1e-05
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 6e-04
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 2e-09
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-07
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 6e-06
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 9e-05
>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Length = 334 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]

 Score = 98.7 bits (245), Expect = 4e-25
 Identities = 52/86 (60%), Positives = 64/86 (74%)

Query: 113 GLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEALPVKLIGMNCDLMKQYIEY 172
           GLH +FACL+F HL NKP    ++ IV +AV +EQ +  +ALPV L+GMN DLM QY+E+
Sbjct: 249 GLHTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEF 308

Query: 173 VADRLLVDLGCSKHYFAENPFDFMEN 198
           VADRLLV  G  K+Y  ENPFDFMEN
Sbjct: 309 VADRLLVAFGNKKYYKVENPFDFMEN 334
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Length = 317 Back     information, alignment and structure
>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]} Length = 285 Back     information, alignment and structure
>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Length = 339 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 284 Back     information, alignment and structure
>d1r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} Length = 283 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1jk0a_334 Ribonucleotide reductase R2 {Baker's yeast (Saccha 100.0
d1syya_317 Ribonucleotide reductase R2 {Chlamydia trachomatis 99.96
d1mxra_339 Ribonucleotide reductase R2 {Escherichia coli [Tax 99.94
d1w68a_281 Ribonucleotide reductase R2 {Mouse (Mus musculus) 99.94
d1jk0b_285 Ribonucleotide reductase R2 {Baker's yeast (Saccha 99.93
d3dhza1284 Ribonucleotide reductase R2 {Corynebacterium ammon 99.88
d1r2fa_283 Ribonucleotide reductase R2 {Salmonella typhimuriu 99.87
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.55
d1avca1 341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.53
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.53
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.52
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.52
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.51
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.41
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.38
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.37
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.3
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.29
>d1jk0a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]

Probab=100.00  E-value=3e-34  Score=248.69  Aligned_cols=171  Identities=44%  Similarity=0.651  Sum_probs=146.9

Q ss_pred             hh-hhHHHHHHHhcCcccccccc-cccCChHHHHHHHHhhhccCCCcHHHHHHHHhCCCHHHHHHHHHHHHHhhCCcHHH
Q psy4803           3 HT-VDSLLIDTYIKDQEERMTAP-GITRSVCSLWFEARRGELMLGTDESTFNAILCTRSYPQLAEVFSQYYTLTGHELDE   80 (235)
Q Consensus         3 h~-~ys~~~~~~~~~~~~~~~i~-~~~~~~~~d~~~l~~a~~~~g~de~~~~~iL~~rs~~~l~~i~~~y~~~~g~~l~~   80 (235)
                      |+ +||++++++++||.+++.+| ++.+.|+. .+...-+.++.......+.+.+.     ....+              
T Consensus       154 HsesYS~ii~tl~~d~~e~~~lf~~~~~~~~i-~~k~~~~~~~~~~~~~~~~~~lv-----a~~~l--------------  213 (334)
T d1jk0a_         154 HSETYSLLIDTYIKDPKESEFLFNAIHTIPEI-GEKAEWALRWIQDADALFGERLV-----AFASI--------------  213 (334)
T ss_dssp             HHHHHHHHHHHHCCCHHHHHHHHHHHTTCHHH-HHHHHHHHHHTTSSSCCHHHHHH-----HHHHH--------------
T ss_pred             HHHHHHHHHHHhccchhHHHHHHHHHHHCHHH-HHHHHHHHHhhhhhhHHHHHHHH-----HHHHH--------------
Confidence            88 99999999999999999999 99999982 11122224444443344444444     23333              


Q ss_pred             HhhccchhhH-------HHHHHhhccccccccchhhhcccchhhHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHhh
Q psy4803          81 AIGREFSGDI-------KEGLIAISPLTNYKPGFGLIMCGLHCEFACLMFKHLVNKPSEERIKSIVLDAVLVEQEFLTEA  153 (235)
Q Consensus        81 ~i~~~~sg~f-------~~~ll~l~~~~~~a~~li~~de~~ht~~~~ll~~~L~~~~~~~~i~~i~~~av~iE~~f~~~~  153 (235)
                       ++..|+|+|       ++++|   ||++.++++|.|||++|+.+++.+++.++.+++.++|.+++++||++|.+|+.++
T Consensus       214 -Egi~F~ssFa~~~~l~~~g~m---~G~~~~i~~I~RDE~lH~~f~~~l~~~l~~~~~~~~i~~i~~eAvelE~~~~~~~  289 (334)
T d1jk0a_         214 -EGVFFSGSFASIFWLKKRGMM---PGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDA  289 (334)
T ss_dssp             -HHTTTHHHHHHHHHHHHTTCC---HHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             -hHHhhhhhHHHHHHHhhcCch---hhHHHHHHHHHHHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHh
Confidence             899999999       56677   9999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCCCchHHH
Q psy4803         154 LPVKLIGMNCDLMKQYIEYVADRLLVDLGCSKHYFAENPFDFME  197 (235)
Q Consensus       154 ~~~~~~gl~~~~~~~yi~~~an~~l~~lG~~~~y~~~np~~w~~  197 (235)
                      +|.+++|||++.|++||+|+||+||.+||++|+|+++||+|||+
T Consensus       290 ~~~~~~Gln~~~~~~YI~y~Anr~L~~LG~~~~f~~~NP~~wme  333 (334)
T d1jk0a_         290 LPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFME  333 (334)
T ss_dssp             SCGGGGTCCHHHHHHHHHHHHHHHHHTTTCCCSSCCCCCCGGGG
T ss_pred             CCCCcCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCccc
Confidence            99899999999999999999999999999999999999999997
>d1syya_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Chlamydia trachomatis [TaxId: 813]} Back     information, alignment and structure
>d1mxra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w68a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jk0b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y4 [TaxId: 4932]} Back     information, alignment and structure
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1r2fa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure