Psyllid ID: psy4832

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770

SIQIPGSDLHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADPNLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLLTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDSVRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHITTRDMTSGKPRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKIRALKKGRFDVTYDYDHLDRLSVRKDNYGNITQFFYNNHEYPTQVTHIYSPRYGKLISLVYDERGFLIFAQMFRHKYYIATDQCGTPVMVFNQYGETVREIMRSPYGHIVYDSNPYIYLPIDFCGGLLDQE

ccccccccEEEEEEccccccccEEEEEEEccccccccccEEEEEEEEcEEEEEEEEccccccEEEEEEcccccccEEEEEEEEEEEEEcEEEccccEEEEEEEEEEEccccccccccccccccccccccccccEEEEcccccEEEEEEcccEEEEEEcccccccccccccccccccEEEccccEEEEcccccEEEEEccEEEEEcccccEEEEEEccccccccccEEEEEcccccEEEEEccccEEEEEEcccccccccccEEEEEEEcccccccccccccccccccEEEcccccEEEEcccccEEEEEcccEEEEcccccEEEEEccccccccccccccccccccccccccccEEEEEcccccEEEEEEccEEEEEccccEEEEEEcccccccccccccccccccccccccEEEEcccccccccccccEEEEEEcccccEEEEEccccEEEEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEcccccEEEEEEcccccccccccEEEEccccccEEEEEEccEEEEEEEccccccEEEEEEEcccccccEEEEEEccccEEEEEEcccccEEEEcccEEEEccccccEEEEccEEEEEEccccEEEEEEEcccEEEEEEcccccEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEEEcccccEEEEEEEccEEEEEEcccccEEEEEEccccEEEEEEEcccccEEEcccccEEEEEEEcccccccc

ccccccccEEEEEEccccccccEEEEEEccccccccccEEEEEEEEEEcHHHEEEcccccccEEEEEEccccccccEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEcEEccHcccccccccccEEEcccccEEEEccccEEEEEcccccEEEEEEccccEEEccccccccccccccccccEEEEEcccccEEEEcccEEEEEcccccEEEEEEcccccccccEEEEEcccccEEEEEcccccEEEEEEcccccccccccEEEEEcccccccccccccccccccccEcEcccccEEEEccccEEEEEccccEEEEccccEEEEEEcccccccccccccccccccccEEEEcccccEEEcccccEEEEEcccEEEEEccccEEEEEEcccEEEccccccccccccccccccccccccccccEEEEEcccccEEEEccccEEEEEEcccccEEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccEEEEEcccccEEEEEcccccccccccEEEEccccccEEEEEEccccEEEEEEEEcccEEEEEEEEcccccccEEEEEcccccEEEEEEccccccEEEEEEcccccccccEEEEccEEEEEEEccccEEEEEccccEEEEEEEccccEEEEEEcccccEEEEEEcccccccEEEEEEEccccEEEEEEEccccEEEEEEEcccEEEEEEccccccEEEEcccccEEEEEEEccccEEEEcccccEEEEEcccccccccc

siqipgsdlhltyrsslsSGYLSSILIHLTHNEIPASLVKVHVRVEIegsvhtktyeadpnlthvfTWNKRNVYKQKVYGVAQCKISigyehescsSIVWETQTctlqgfdvdisdiggwsldvhhhynfhegilqkgdgsslhlkhefprtvsvvmgtglqrplvckdcdgvardarlltpvaltsgpdgslyvgdfnlvrrltpegnvFTVLQLSATQVSYQYYLalspadghlyisdaEKHQILRVLSlesvadpsinwevavgsgercipgdetncgdngpalaaklshpkglaikadktmfiadgtnirvvspegIIHTLIGhhkhhniwspfnchrsfpastaqlqwptglalsplddslhfidDRVIFKLTNDLKVkivagiplhcrtgdkdkrdfkdkqsktkkstvqddsvrasnmdlgsltalafsptgdlyiadidARKVNALRVIDSTGRMFDFAgrwqsdkkncnttncaefeknsketlltSTARFTSIsalsvspdgvvnvadqgSLHILALQHylpthdehgefkipypatneiYVFNrygqhittrdmtsgkprysflyskntsfgklstitdasgnkinflrdysnvaqlqwptglalsplddslhfidDRVIFKLTNDLKIRALkkgrfdvtydydhldrlsvrkdnygnitqffynnheyptqvthiysprygkLISLVYDERGFLIFAQMFRHKYyiatdqcgtpVMVFNQYGETVREIMRspyghivydsnpyiylpidfcgglldqe

siqipgsdlHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGsvhtktyeadpnlthvftWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLLTpvaltsgpdgslyVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTndlkvkivagiplhcrtgdkdkrdfkdkqsktkkstvqddsvrasnmdlgslTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFdfagrwqsdkkncnttnCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHIttrdmtsgkpRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKltndlkiralkkgrfdvtydydhldrlsvrkDNYGNITQFFYNNHEYPTQVTHIYSPRYGKLISLVYDERGFLIFAQMFRHKYYIATDQCGTPVMVFNQYGETVREIMRSPYGHIVYDSNPYIYLPIDFCGGLLDQE

SIQIPGSDLHLTYRsslssgylssilihlTHNEIPASLVKVHVRVEIEGSVHTKTYEADPNLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLLTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDSVRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHITTRDMTSGKPRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKIRALKKGRFDVTYDYDHLDRLSVRKDNYGNITQFFYNNHEYPTQVTHIYSPRYGKLISLVYDERGFLIFAQMFRHKYYIATDQCGTPVMVFNQYGETVREIMRSPYGHIVYDSNPYIYLPIDFCGGLLDQE

*********HLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADPNLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLLTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHT**********WSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRT********************************GSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEFE****ETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHITTRDMTSGKPRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKIRALKKGRFDVTYDYDHLDRLSVRKDNYGNITQFFYNNHEYPTQVTHIYSPRYGKLISLVYDERGFLIFAQMFRHKYYIATDQCGTPVMVFNQYGETVREIMRSPYGHIVYDSNPYIYLPIDFCGGLL***

SIQIPGSDLHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADPNLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLLTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDK********************SVRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHITTRDMTSGKPRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKIRALKKGRFDVTYDYDHLDRLSVRKDNYGNITQFFYNNHEYPTQVTHIYSPRYGKLISLVYDERGFLIFAQMFRHKYYIATDQCGTPVMVFNQYGETVREIMRSPYGHIVYDSNPYIYLPIDFCGGLLDQE

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		770	2.2.26 [Sep-21-2011]
Q9VYN8		3004	Teneurin-a OS=Drosophila	no	N/A	0.602	0.154	0.665	0.0
O61307		2731	Teneurin-m OS=Drosophila	no	N/A	0.858	0.242	0.435	1e-165
Q9W7R3		2824	Teneurin-4 OS=Danio rerio	yes	N/A	0.838	0.228	0.367	1e-121
Q9W7R4		2590	Teneurin-3 OS=Danio rerio	no	N/A	0.820	0.244	0.366	1e-121
Q9NT68		2774	Teneurin-2 OS=Homo sapien	yes	N/A	0.754	0.209	0.375	1e-119
Q9WTS5		2764	Teneurin-2 OS=Mus musculu	yes	N/A	0.754	0.210	0.371	1e-118
Q9DER5		2802	Teneurin-2 OS=Gallus gall	yes	N/A	0.754	0.207	0.376	1e-118
Q9R1K2		2774	Teneurin-2 OS=Rattus norv	yes	N/A	0.754	0.209	0.371	1e-118
Q9P273		2699	Teneurin-3 OS=Homo sapien	no	N/A	0.742	0.211	0.382	1e-117
Q9WTS6		2715	Teneurin-3 OS=Mus musculu	no	N/A	0.744	0.211	0.378	1e-116

>sp\|Q9VYN8\|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2	Back alignment and function desciption

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/484 (66%), Positives = 385/484 (79%), Gaps = 20/484 (4%)

Query: 1    SIQIPGSDLHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADP 60
            SIQIPGSDLHLTY+SS +SGYLS + + LT   IP +L  VHV VEIEG++H KTYEADP
Sbjct: 1069 SIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADP 1128

Query: 61   NLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGW 120
            +L H F WNKRNVY+QKVYGV   +IS+GY+H +C S VW  QT  LQG+DVDISDIGGW
Sbjct: 1129 SLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIGGW 1188

Query: 121  SLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKD-CDGVARDARL 179
             LD+HHHYNFHEGILQKGDGS+LH+K E+PRTV VVMGTGLQRPL C D C+GVA+DA+L
Sbjct: 1189 GLDIHHHYNFHEGILQKGDGSTLHMK-EYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAKL 1247

Query: 180  LTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYIS 239
            LTP+AL +GPDGSLYVGDFNLVRR+TP+G V+T+LQLSATQVSYQYYLA+SPADGHLYIS
Sbjct: 1248 LTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYIS 1307

Query: 240  DAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAI 299
            D E+HQILR++ LE V DPSIN +  VGSG+RCIPGDE NCGD GPAL A+LSHPKGLAI
Sbjct: 1308 DPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHPKGLAI 1367

Query: 300  KADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLAL 359
             AD+TM+IADGTNIR V P+G+IHTLIGHH HHN WSP  C  +  A+ AQLQWPTGLAL
Sbjct: 1368 AADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLAL 1427

Query: 360  SPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDS 419
            SPLD SLHFIDDR++ +LT+D+K+++VAG PLHC  G +D R      +KT    V    
Sbjct: 1428 SPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGR-----VNKTGADNV---- 1478

Query: 420  VRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNT 479
                   LG++ A+AFSP G+LYIAD D+R+VN++RV+D+ G M  FAG+   +     T
Sbjct: 1479 -------LGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGK--QEGTGSQT 1529

Query: 480  TNCA 483
             +CA
Sbjct: 1530 CDCA 1533

Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-m to organize neuromuscular synapses.
Drosophila melanogaster (taxid: 7227)

>sp\|O61307\|TENM_DROME Teneurin-m OS=Drosophila melanogaster GN=Ten-m PE=1 SV=2	Back alignment and function description

>sp\|Q9W7R3\|TEN4_DANRE Teneurin-4 OS=Danio rerio GN=tenm4 PE=2 SV=1	Back alignment and function description

>sp\|Q9W7R4\|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1	Back alignment and function description

>sp\|Q9NT68\|TEN2_HUMAN Teneurin-2 OS=Homo sapiens GN=TENM2 PE=1 SV=3	Back alignment and function description

>sp\|Q9WTS5\|TEN2_MOUSE Teneurin-2 OS=Mus musculus GN=Tenm2 PE=2 SV=1	Back alignment and function description

>sp\|Q9DER5\|TEN2_CHICK Teneurin-2 OS=Gallus gallus GN=TENM2 PE=1 SV=1	Back alignment and function description

>sp\|Q9R1K2\|TEN2_RAT Teneurin-2 OS=Rattus norvegicus GN=Tenm2 PE=1 SV=2	Back alignment and function description

>sp\|Q9P273\|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=TENM3 PE=2 SV=3	Back alignment and function description

>sp\|Q9WTS6\|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Tenm3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		770
322794626		1900	hypothetical protein SINV_12598 [Solenop	0.884	0.358	0.614	0.0
307202989		1949	Teneurin-3 [Harpegnathos saltator]	0.781	0.308	0.688	0.0
332028723		2615	Teneurin-3 [Acromyrmex echinatior]	0.883	0.260	0.617	0.0
383855590		2641	PREDICTED: teneurin-3-like [Megachile ro	0.880	0.256	0.612	0.0
307167252		2600	Teneurin-3 [Camponotus floridanus]	0.781	0.231	0.685	0.0
350397567		2628	PREDICTED: teneurin-3-like [Bombus impat	0.888	0.260	0.605	0.0
340714986		2646	PREDICTED: teneurin-3-like isoform 2 [Bo	0.885	0.257	0.603	0.0
340714984		2628	PREDICTED: teneurin-3-like isoform 1 [Bo	0.885	0.259	0.603	0.0
328790868		2646	PREDICTED: teneurin-3-like isoform 1 [Ap	0.889	0.258	0.610	0.0
157135459		1854	odd Oz protein [Aedes aegypti] gi\|108870	0.890	0.370	0.573	0.0

>gi\|322794626\|gb\|EFZ17634.1\| hypothetical protein SINV_12598 [Solenopsis invicta]	Back alignment and taxonomy information

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/729 (61%), Positives = 547/729 (75%), Gaps = 48/729 (6%)

Query: 1   SIQIPGSDLHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADP 60
           SI IPGS+LHL Y+SS ++GYLS++ + LT   IP SL  VHV VEIEGS+HTKTYEADP
Sbjct: 114 SIAIPGSNLHLMYQSSQAAGYLSTVRMQLTGPFIPKSLTHVHVHVEIEGSLHTKTYEADP 173

Query: 61  NLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGW 120
           NLTH F WNKRNVYKQKVYGVAQ ++SIGY+H +C S++WETQT TLQGFDVDISDIGGW
Sbjct: 174 NLTHTFAWNKRNVYKQKVYGVAQARMSIGYQHSTCPSVIWETQTATLQGFDVDISDIGGW 233

Query: 121 SLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKDCDGVARDARLL 180
            LD+HHHYNFHEGILQKGDGS+LH K ++PRTV VVMGTGLQR LVC++CDG+A+DARLL
Sbjct: 234 GLDIHHHYNFHEGILQKGDGSTLHFK-QYPRTVKVVMGTGLQRSLVCQNCDGLAKDARLL 292

Query: 181 TPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISD 240
           TPVALTSGPDGS+YVGDFNLVRR+TPEG V+TVL LSATQV+YQYYL +SPADGHLYISD
Sbjct: 293 TPVALTSGPDGSIYVGDFNLVRRITPEGKVYTVLILSATQVAYQYYLCISPADGHLYISD 352

Query: 241 AEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIK 300
            EKHQIL+ LSL+ V DPSIN E  VGSGERCIPGDE +CGD GPA+ AKL+HPKG+AI 
Sbjct: 353 PEKHQILKALSLDQVQDPSINIEPVVGSGERCIPGDEGHCGDEGPAIHAKLAHPKGIAIA 412

Query: 301 ADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALS 360
           ADKTM+IADGTNIR V P GIIHTL+GHH HHN WSP  C  + PA  AQLQWPTGL LS
Sbjct: 413 ADKTMYIADGTNIRAVDPRGIIHTLVGHHGHHNHWSPAPCIGAIPAHQAQLQWPTGLTLS 472

Query: 361 PLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDSV 420
           PLD SLHFIDDR++ KLT+DLKV++VAG PLHC +      +  D+  K   S   +   
Sbjct: 473 PLDGSLHFIDDRLVLKLTSDLKVRVVAGTPLHCTSNANSNSNVNDELPKLNSSLTTNP-- 530

Query: 421 RASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQS-------- 472
           + S+  LGS+ A+ FSPTG+LYIAD D+ +VN++R++DS+G+M  FAG+ Q         
Sbjct: 531 KKSDEVLGSVLAVGFSPTGELYIADRDSHRVNSIRIVDSSGKMSHFAGQQQDRLRGQCDC 590

Query: 473 -----DKKNCNTTNCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILAL 527
                  K+ +T  C + + +S ETLL+S A+FT+ISAL+VSPDGV++VADQGSLHILAL
Sbjct: 591 NNTTPSTKDLDTCTCID-DTSSTETLLSSNAKFTAISALAVSPDGVLHVADQGSLHILAL 649

Query: 528 QHYLPTHDEHGEFKIPYPATNEIYVFNRYGQHITTRDMTSGKPRYSFLYSKNTSFGKLST 587
           Q YLP HDE+GEF+IP+P +NEIYVFNRYGQHI+T+D+TSGK RYSFLYSKNTSFGKLST
Sbjct: 650 QPYLPNHDENGEFRIPFPPSNEIYVFNRYGQHISTKDLTSGKTRYSFLYSKNTSFGKLST 709

Query: 588 ITDASGNKINFLRDYSNVAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKIRAL---- 643
           +TD++GNKI FLRDYS+V                S+    D       ++LKI A+    
Sbjct: 710 VTDSAGNKIQFLRDYSSVV--------------SSIENTQDH-----KSELKISAVGFLE 750

Query: 644 ---KKGRFDVTYDYDHLDRLSVRKDNYGNITQFFYNNHEYPTQVTHIYSP--RYGKLISL 698
              ++GR ++   YD    L   +   G    + Y N++   +VT +  P     KL+S 
Sbjct: 751 KLSERGRAEIALAYDGSTGLLTSRS--GGDETYIY-NYDSLGRVTDVILPTGEKLKLLSD 807

Query: 699 VYDERGFLI 707
           + D+ G L+
Sbjct: 808 LSDDEGLLV 816

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307202989\|gb\|EFN82205.1\| Teneurin-3 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|332028723\|gb\|EGI68754.1\| Teneurin-3 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|383855590\|ref\|XP_003703293.1\| PREDICTED: teneurin-3-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|307167252\|gb\|EFN60940.1\| Teneurin-3 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|350397567\|ref\|XP_003484916.1\| PREDICTED: teneurin-3-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340714986\|ref\|XP_003396002.1\| PREDICTED: teneurin-3-like isoform 2 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|340714984\|ref\|XP_003396001.1\| PREDICTED: teneurin-3-like isoform 1 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|328790868\|ref\|XP_394629.4\| PREDICTED: teneurin-3-like isoform 1 [Apis mellifera]	Back alignment and taxonomy information

>gi\|157135459\|ref\|XP_001663451.1\| odd Oz protein [Aedes aegypti] gi\|108870228\|gb\|EAT34453.1\| AAEL013308-PA, partial [Aedes aegypti]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		770
FB\|FBgn0259240		3378	Ten-a "Tenascin accessory" [Dr	0.598	0.136	0.652	1.3e-224
FB\|FBgn0004449		2731	Ten-m "Tenascin major" [Drosop	0.511	0.144	0.498	1.8e-152
ZFIN\|ZDB-GENE-990714-19		2778	tenm3 "teneurin transmembrane	0.503	0.139	0.410	3.7e-130
ZFIN\|ZDB-GENE-060531-26		2571	tenm1 "teneurin transmembrane	0.750	0.224	0.350	5.9e-116
ZFIN\|ZDB-GENE-990714-20		2849	odz4 "odd Oz/ten-m homolog 4"	0.601	0.162	0.397	2.4e-113
UNIPROTKB\|F1NVT4		2293	ODZ4 "Uncharacterized protein"	0.601	0.201	0.387	5.8e-113
UNIPROTKB\|E1BR60		2729	ODZ1 "Uncharacterized protein"	0.583	0.164	0.378	8.2e-112
UNIPROTKB\|F1NVT3		2295	ODZ4 "Uncharacterized protein"	0.602	0.202	0.380	3e-111
UNIPROTKB\|F1NVT5		2297	ODZ4 "Uncharacterized protein"	0.602	0.202	0.380	3e-111
UNIPROTKB\|Q9UKZ4		2725	TENM1 "Teneurin-1" [Homo sapie	0.583	0.164	0.378	4.5e-111

FB\|FBgn0259240 Ten-a "Tenascin accessory" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1663 (590.5 bits), Expect = 1.3e-224, Sum P(3) = 1.3e-224
 Identities = 313/480 (65%), Positives = 376/480 (78%)

Query:     1 SIQIPGSDLHLTYRXXXXXXXXXXXXXXXTHNEIPASLVKVHVRVEIEGSVHTKTYEADP 60
             SIQIPGSDLHLTY+               T   IP +L  VHV VEIEG++H KTYEADP
Sbjct:  1443 SIQIPGSDLHLTYQSSQASGYLSIVRMRLTGETIPPTLTHVHVGVEIEGALHVKTYEADP 1502

Query:    61 NLTHVFTWNKRNVYKQKVYGVAQCKISIGYEHESCSSIVWETQTCTLQGFDVDISDIGGW 120
             +L H F WNKRNVY+QKVYGV   +IS+GY+H +C S VW  QT  LQG+DVDISDIGGW
Sbjct:  1503 SLVHTFAWNKRNVYRQKVYGVTVARISVGYQHSTCQSPVWIAQTAKLQGYDVDISDIGGW 1562

Query:   121 SLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGTGLQRPLVCKD-CDGVARDARL 179
              LD+HHHYNFHEGILQKGDGS+LH+K E+PRTV VVMGTGLQRPL C D C+GVA+DA+L
Sbjct:  1563 GLDIHHHYNFHEGILQKGDGSTLHMK-EYPRTVKVVMGTGLQRPLTCPDYCNGVAKDAKL 1621

Query:   180 LTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYIS 239
             LTP+AL +GPDGSLYVGDFNLVRR+TP+G V+T+LQLSATQVSYQYYLA+SPADGHLYIS
Sbjct:  1622 LTPIALATGPDGSLYVGDFNLVRRITPDGKVYTILQLSATQVSYQYYLAVSPADGHLYIS 1681

Query:   240 DAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAI 299
             D E+HQILR++ LE V DPSIN +  VGSG+RCIPGDE NCGD GPAL A+LSHPKGLAI
Sbjct:  1682 DPERHQILRLVRLEKVKDPSINSDPVVGSGQRCIPGDEGNCGDGGPALLARLSHPKGLAI 1741

Query:   300 KADKTMFIADGTNIRVVSPEGIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLAL 359
              AD+TM+IADGTNIR V P+G+IHTLIGHH HHN WSP  C  +  A+ AQLQWPTGLAL
Sbjct:  1742 AADRTMYIADGTNIRAVDPKGVIHTLIGHHGHHNHWSPAPCSGTLMANQAQLQWPTGLAL 1801

Query:   360 SPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDS 419
             SPLD SLHFIDDR++ +LT+D+K+++VAG PLHC  G +D R      +KT         
Sbjct:  1802 SPLDGSLHFIDDRLVLRLTSDMKIRVVAGTPLHCSNGGQDGR-----VNKTG-------- 1848

Query:   420 VRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQ-SDKKNCN 478
               A N+ LG++ A+AFSP G+LYIAD D+R+VN++RV+D+ G M  FAG+ + +  + C+
Sbjct:  1849 --ADNV-LGTVLAMAFSPFGNLYIADSDSRRVNSIRVVDTAGNMRYFAGKQEGTGSQTCD 1905

GO:0005578 "proteinaceous extracellular matrix" evidence=ISS

GO:0007155 "cell adhesion" evidence=ISS

GO:0005576 "extracellular region" evidence=ISS

GO:0007160 "cell-matrix adhesion" evidence=ISS

GO:0005886 "plasma membrane" evidence=NAS

GO:0008039 "synaptic target recognition" evidence=IMP

GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP

GO:0031594 "neuromuscular junction" evidence=IDA

GO:0042734 "presynaptic membrane" evidence=IDA

GO:0016200 "synaptic target attraction" evidence=IMP

FB\|FBgn0004449 Ten-m "Tenascin major" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-990714-19 tenm3 "teneurin transmembrane protein 3" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060531-26 tenm1 "teneurin transmembrane protein 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-990714-20 odz4 "odd Oz/ten-m homolog 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NVT4 ODZ4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BR60 ODZ1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NVT3 ODZ4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NVT5 ODZ4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UKZ4 TENM1 "Teneurin-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		770
PLN02919		1057	PLN02919, PLN02919, haloacid dehalogenase-like hyd	4e-04
PLN02919		1057	PLN02919, PLN02919, haloacid dehalogenase-like hyd	6e-04

>gnl\|CDD\|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

 Score = 43.7 bits (103), Expect = 4e-04
 Identities = 42/146 (28%), Positives = 59/146 (40%), Gaps = 33/146 (22%)

Query: 227 LALSPADGHLYISDAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDN--- 283
           ++LSP    LYI+D+E   I R L L++              G R + G +    DN   
Sbjct: 745 ISLSPDLKELYIADSESSSI-RALDLKT-------------GGSRLLAGGDPTFSDNLFK 790

Query: 284 -----GPALAAKLSHPKGLAIKADKTMFIADGTN--IRVVSP-EGIIHTLIGHHKHHNIW 335
                G      L HP G+    D  +++AD  N  I+ + P    + TL G  K     
Sbjct: 791 FGDHDGVGSEVLLQHPLGVLCAKDGQIYVADSYNHKIKKLDPATKRVTTLAGTGK----- 845

Query: 336 SPFNCHRSFPASTAQLQWPTGLALSP 361
           + F   +   A  AQL  P GLAL  
Sbjct: 846 AGFKDGK---ALKAQLSEPAGLALGE 868

Length = 1057

>gnl\|CDD\|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		770
KOG4659\|consensus		1899		100.0
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.96
KOG4659\|consensus		1899		99.94
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.93
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	99.77
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	99.74
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	99.67
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	99.49
COG4257		353	Vgb Streptogramin lyase [Defense mechanisms]	99.44
COG4257		353	Vgb Streptogramin lyase [Defense mechanisms]	99.38
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	99.37
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.36
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	99.35
PRK11028		330	6-phosphogluconolactonase; Provisional	99.34
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	99.32
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.29
PRK11028		330	6-phosphogluconolactonase; Provisional	99.2
KOG1214\|consensus		1289		99.19
COG3391		381	Uncharacterized conserved protein [Function unknow	99.18
KOG1214\|consensus		1289		99.13
COG3391		381	Uncharacterized conserved protein [Function unknow	99.12
TIGR03606		454	non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH	99.1
KOG1520\|consensus		376		99.05
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.98
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	98.97
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.94
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	98.87
COG2133		399	Glucose/sorbosone dehydrogenases [Carbohydrate tra	98.86
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	98.77
TIGR03606		454	non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH	98.7
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	98.66
PF03527		41	RHS: RHS protein; InterPro: IPR001826 RHS elements	98.63
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	98.52
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	98.48
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.47
KOG1520\|consensus		376		98.42
TIGR01643		42	YD_repeat_2x YD repeat (two copies). This model de	98.29
PF03022		287	MRJP: Major royal jelly protein; InterPro: IPR0035	98.29
PF03022		287	MRJP: Major royal jelly protein; InterPro: IPR0035	98.2
COG2133		399	Glucose/sorbosone dehydrogenases [Carbohydrate tra	98.14
PF05593		38	RHS_repeat: RHS Repeat; InterPro: IPR006530 These	98.12
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.11
PF01436		28	NHL: NHL repeat; InterPro: IPR001258 The NHL repea	98.1
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	98.09
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.04
KOG0318\|consensus		603		98.03
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	97.93
COG3209		796	RhsA Rhs family protein [Cell envelope biogenesis,	97.9
PF01436		28	NHL: NHL repeat; InterPro: IPR001258 The NHL repea	97.84
TIGR03118		336	PEPCTERM_chp_1 conserved hypothetical protein TIGR	97.83
PF03088		89	Str_synth: Strictosidine synthase; InterPro: IPR01	97.82
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	97.81
KOG0291\|consensus		893		97.8
KOG4499\|consensus		310		97.79
TIGR01643		42	YD_repeat_2x YD repeat (two copies). This model de	97.74
PF05593		38	RHS_repeat: RHS Repeat; InterPro: IPR006530 These	97.73
TIGR03032		335	conserved hypothetical protein TIGR03032. This pro	97.59
PF05787		524	DUF839: Bacterial protein of unknown function (DUF	97.58
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	97.56
KOG4499\|consensus		310		97.51
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	97.4
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	97.22
KOG1215\|consensus		877		97.21
KOG1215\|consensus		877		97.18
COG3209		796	RhsA Rhs family protein [Cell envelope biogenesis,	97.16
KOG0318\|consensus		603		97.11
PF05787		524	DUF839: Bacterial protein of unknown function (DUF	97.04
KOG0291\|consensus		893		96.81
PRK02888		635	nitrous-oxide reductase; Validated	96.41
TIGR03032		335	conserved hypothetical protein TIGR03032. This pro	96.36
PF13449		326	Phytase-like: Esterase-like activity of phytase	96.15
KOG0772\|consensus		641		96.07
PF02333		381	Phytase: Phytase; InterPro: IPR003431 Phytase (3.1	95.93
COG3211		616	PhoX Predicted phosphatase [General function predi	95.88
PRK02888		635	nitrous-oxide reductase; Validated	95.85
COG3292		671	Predicted periplasmic ligand-binding sensor domain	95.77
KOG1446\|consensus		311		95.63
KOG0263\|consensus		707		95.63
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	95.59
PF13449		326	Phytase-like: Esterase-like activity of phytase	95.39
COG3823		262	Glutamine cyclotransferase [Posttranslational modi	95.36
KOG0640\|consensus		430		95.35
PRK01742		429	tolB translocation protein TolB; Provisional	95.14
COG3211		616	PhoX Predicted phosphatase [General function predi	95.12
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	95.04
KOG0286\|consensus		343		94.83
PRK04792		448	tolB translocation protein TolB; Provisional	94.75
KOG1446\|consensus		311		94.68
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	94.59
PRK03629		429	tolB translocation protein TolB; Provisional	94.54
PF15283		197	DUF4595: Domain of unknown function (DUF4595) with	94.47
PF06788		236	UPF0257: Uncharacterised protein family (UPF0257);	94.46
KOG2106\|consensus		626		94.44
PF14517		229	Tachylectin: Tachylectin; PDB: 1TL2_A.	94.33
KOG0272\|consensus		459		94.3
KOG1274\|consensus		933		94.17
PF15283		197	DUF4595: Domain of unknown function (DUF4595) with	93.99
smart00135		43	LY Low-density lipoprotein-receptor YWTD domain. T	93.96
PRK04922		433	tolB translocation protein TolB; Provisional	93.71
smart00135		43	LY Low-density lipoprotein-receptor YWTD domain. T	93.67
PF00058		42	Ldl_recept_b: Low-density lipoprotein receptor rep	93.62
COG4946		668	Uncharacterized protein related to the periplasmic	93.56
PF00058		42	Ldl_recept_b: Low-density lipoprotein receptor rep	93.35
PRK02889		427	tolB translocation protein TolB; Provisional	93.01
PRK03629		429	tolB translocation protein TolB; Provisional	92.99
TIGR03696		76	Rhs_assc_core RHS repeat-associated core domain. T	92.81
KOG0266\|consensus		456		92.7
PF14517		229	Tachylectin: Tachylectin; PDB: 1TL2_A.	92.42
PF05935		477	Arylsulfotrans: Arylsulfotransferase (ASST); Inter	92.42
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	92.32
KOG2055\|consensus		514		91.78
PRK05137		435	tolB translocation protein TolB; Provisional	91.55
PRK04922		433	tolB translocation protein TolB; Provisional	91.36
KOG0266\|consensus		456		91.35
PRK00178		430	tolB translocation protein TolB; Provisional	91.18
PRK04792		448	tolB translocation protein TolB; Provisional	91.08
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	90.83
KOG0772\|consensus		641		90.78
COG4946		668	Uncharacterized protein related to the periplasmic	90.71
PRK01742		429	tolB translocation protein TolB; Provisional	90.29
PRK02939		236	lipoprotein; Reviewed	90.23
KOG1274\|consensus		933		90.07
KOG0279\|consensus		315		90.02
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	90.01
KOG0282\|consensus		503		89.57
PF05935		477	Arylsulfotrans: Arylsulfotransferase (ASST); Inter	89.37
COG3292		671	Predicted periplasmic ligand-binding sensor domain	89.37
PF02333		381	Phytase: Phytase; InterPro: IPR003431 Phytase (3.1	89.26
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	88.6
KOG2106\|consensus		626		88.48
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	88.03
KOG0645\|consensus		312		87.87
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	87.82
PF14269		299	Arylsulfotran_2: Arylsulfotransferase (ASST)	87.79
KOG0279\|consensus		315		87.36
PRK00178		430	tolB translocation protein TolB; Provisional	86.92
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	86.54
PLN00181		793	protein SPA1-RELATED; Provisional	85.89
PF01731		86	Arylesterase: Arylesterase; InterPro: IPR002640 Th	85.67
KOG0282\|consensus		503		85.47
PF01731		86	Arylesterase: Arylesterase; InterPro: IPR002640 Th	85.33
KOG0272\|consensus		459		84.22
KOG0283\|consensus		712		84.03
PF14269		299	Arylsulfotran_2: Arylsulfotransferase (ASST)	83.69
KOG0268\|consensus		433		83.67
KOG0263\|consensus		707		83.41
PF07202		179	Tcp10_C: T-complex protein 10 C-terminus; InterPro	83.19
PF06739		38	SBBP: Beta-propeller repeat; InterPro: IPR010620 T	83.15
PF06739		38	SBBP: Beta-propeller repeat; InterPro: IPR010620 T	82.76
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	82.67
PRK02889		427	tolB translocation protein TolB; Provisional	81.7
PRK01029		428	tolB translocation protein TolB; Provisional	80.77
PF13860		81	FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A.	80.46

>KOG4659\|consensus	Back alignment and domain information

Probab=100.00  E-value=7e-151  Score=1255.97  Aligned_cols=586  Identities=40%  Similarity=0.708  Sum_probs=565.4

Q ss_pred             CcccCCCCeEEEEecCCCCCCceEEEEeecCCCCCCCccEEEEEEEEceeEEEEEeeCCCCceEEEEEecccccCceeee
Q psy4832           1 SIQIPGSDLHLTYRSSLSSGYLSSILIHLTHNEIPASLVKVHVRVEIEGSVHTKTYEADPNLTHVFTWNKRNVYKQKVYG   80 (770)
Q Consensus         1 ~~~i~gt~~~l~y~s~r~~g~~~~~~~~~~~~~~p~~l~~v~~~~~v~g~~~~~~~~~~p~~~~~~~W~~~d~y~~~v~g   80 (770)
                      |||||||+++|+|+|||+|||||+|+|.||+++||.+|+||||+|+|||++|+|+|+|+|||+|||+|||+|+|||+|||
T Consensus       186 sl~ipgt~vrLvY~SsRs~gy~St~ki~lt~d~vp~~l~kVHl~i~ieG~lf~r~f~a~~nl~ytfaWdk~n~YrQrv~G  265 (1899)
T KOG4659|consen  186 SLPIPGTDVRLVYDSSRSPGYPSTMKIGLTYDRVPKELRKVHLNIRIEGRLFDRVFAARPNLTYTFAWDKMNAYRQRVYG  265 (1899)
T ss_pred             hccCCCCceEEEEecccCCCcchheEEeecccccccceEEEEEEEEEeeEEeeeeccCCCCcEEEEEecccchhhheeec
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEEeeeEecccce-eEEeEEEEEeecccccccCCCCCccceeeeeecCCCeEEECCCccEEecccCCCeEEEEecc
Q psy4832          81 VAQCKISIGYEHESCSS-IVWETQTCTLQGFDVDISDIGGWSLDVHHHYNFHEGILQKGDGSSLHLKHEFPRTVSVVMGT  159 (770)
Q Consensus        81 ~~~a~v~~g~~y~~~~~-~~w~~~~~~l~g~~~~~~~~ggw~l~~~~~~~~~~gil~~~dG~~~~~~~~~~~~i~~v~g~  159 (770)
                      +++|+|+|||||+.|.+ ++|++||++|+|++|+.|++|+|+||+||+||+.+||++||+|+|+|+++ +|++|+++||+
T Consensus       266 l~~avV~VGyeY~~C~~~ivW~~rt~~l~G~~m~~s~~g~W~LdiHH~ln~~~gIl~kGnG~n~~it~-~Prvitt~mgd  344 (1899)
T KOG4659|consen  266 LVPAVVRVGYEYQGCDDTIVWQTRTSQLMGATMRKSIGGGWTLDIHHHLNIVNGILEKGNGGNRLITE-EPRVITTAMGD  344 (1899)
T ss_pred             cceeEEEeeeEecCCCceeeeeeehhhhccccccchhcCcceeecceecccccCeEEecCCcceEeec-CCceEEEeccC
Confidence            99999999999999999 89999999999999999999999999999999999999999999999999 99999999999


Q ss_pred             CccCCccCCCCCcccccccccCceEEEEcCCCCEEEEeCceEEEEcCCCcEEEEeccCcccccceeEEEEeCCCCcEEEE
Q psy4832         160 GLQRPLVCKDCDGVARDARLLTPVALTSGPDGSLYVGDFNLVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYIS  239 (770)
Q Consensus       160 G~~~~~~~~~~~g~~~~~~l~~P~~la~~~dG~lyv~d~~~I~~i~~~G~v~~~~~~~~~~~~~p~~lav~p~~g~lyvs  239 (770)
                      |.+|++.|+.|+|.+...+|.+|.++|..|||+|||+|+|.||||.++|++++++.++.+..++.++||++|.+|.|||+
T Consensus       345 G~qR~veC~~C~G~a~~~~L~aPvala~a~DGSl~VGDfNyIRRI~~dg~v~tIl~L~~t~~sh~Yy~AvsPvdgtlyvS  424 (1899)
T KOG4659|consen  345 GHQRDVECPKCEGKADSISLFAPVALAYAPDGSLIVGDFNYIRRISQDGQVSTILTLGLTDTSHSYYIAVSPVDGTLYVS  424 (1899)
T ss_pred             cccccccCCCCCCccccceeeceeeEEEcCCCcEEEccchheeeecCCCceEEEEEecCCCccceeEEEecCcCceEEec
Confidence            99999999999999999999999999999999999999999999999999999999988899999999999999999999


Q ss_pred             eCCCcEEEEEeccCCccCCCCcEEEEECCCccccCCCCCCcCCCcccccccccCcceEEEccCCcEEEEeCCCeEEECCC
Q psy4832         240 DAEKHQILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPE  319 (770)
Q Consensus       240 d~~~~~I~~i~~~~~~~~~~g~~~~vaG~g~~~~p~~~~~~g~~g~~~~a~l~~P~gIavd~~G~lYvaD~~~Ir~id~~  319 (770)
                      |+.+++|+|+.++.. +|+.+|++++||+|++|+|+++. ||||+.|.+|+|.+|+|||||++|+|||+|+.+||++|.+
T Consensus       425 dp~s~qv~rv~sl~~-~d~~~N~evvaG~Ge~Clp~des-CGDGalA~dA~L~~PkGIa~dk~g~lYfaD~t~IR~iD~~  502 (1899)
T KOG4659|consen  425 DPLSKQVWRVSSLEP-QDSRNNYEVVAGDGEVCLPADES-CGDGALAQDAQLIFPKGIAFDKMGNLYFADGTRIRVIDTT  502 (1899)
T ss_pred             CCCcceEEEeccCCc-cccccCeeEEeccCcCccccccc-cCcchhcccceeccCCceeEccCCcEEEecccEEEEeccC
Confidence            999999999998887 79999999999999999999988 9999999999999999999999999999999999999999


Q ss_pred             CcEEEeecCCCCCCCcCCCccCCCcccccccccCcceEEEeCCCCeEEEEeCCEEEEEcCCCcEEEEecCCCCCCCCCCC
Q psy4832         320 GIIHTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVKIVAGIPLHCRTGDKD  399 (770)
Q Consensus       320 G~i~t~~g~~~~~~~~~p~~~~~~~~~~~~~l~~P~gla~d~~~g~lyv~D~~~I~~i~~~G~v~~vaG~~~~~~~~~~~  399 (770)
                      |.|++++|+....  +.|++|+..+...+.+|+||+.||++|+++.|||.|+|.|++|+++++|++++|+|.+|......
T Consensus       503 giIstlig~~~~~--~~p~~C~~~~kl~~~~leWPT~LaV~Pmdnsl~Vld~nvvlrit~~~rV~Ii~GrP~hC~~a~~t  580 (1899)
T KOG4659|consen  503 GIISTLIGTTPDQ--HPPRTCAQITKLVDLQLEWPTSLAVDPMDNSLLVLDTNVVLRITVVHRVRIILGRPTHCDLANAT  580 (1899)
T ss_pred             ceEEEeccCCCCc--cCccccccccchhheeeecccceeecCCCCeEEEeecceEEEEccCccEEEEcCCccccccCCCc
Confidence            9999999998887  89999999999999999999999999999999999999999999999999999999999876543


Q ss_pred             CccccccccccccccccCCcccccccccCCeeEEEEcCCCCEEEEeCCCCceeeEEEEcCCCcEEEeecCccCCCCCcCC
Q psy4832         400 KRDFKDKQSKTKKSTVQDDSVRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNT  479 (770)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~~~a~~~~l~~P~giavd~~G~lyVaD~~~~ri~~i~~i~~~G~i~~~aG~~~~~~~~~~~  479 (770)
                      ..                ..+.|.++.|..|.+|||+++|.|||||++.+|||+||++.+||+|..+||..    +.|+|
T Consensus       581 ~~----------------~skla~H~tl~~~r~Iavg~~G~lyvaEsD~rriNrvr~~~tdg~i~ilaGa~----S~C~C  640 (1899)
T KOG4659|consen  581 SS----------------ASKLADHRTLLIQRDIAVGTDGALYVAESDGRRINRVRKLSTDGTISILAGAK----SPCSC  640 (1899)
T ss_pred             hh----------------hhhhhhhhhhhhhhceeecCCceEEEEeccchhhhheEEeccCceEEEecCCC----CCCCc
Confidence            22                33778999999999999999999999999999999999999999999999988    89999


Q ss_pred             C---CCcccccCccCcccccceecCCeeEEEEcCCCcEEEEcCCCceEEeeecCCcccCCCCcEEEeCCCCCcEEEEecC
Q psy4832         480 T---NCAEFEKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHYLPTHDEHGEFKIPYPATNEIYVFNRY  556 (770)
Q Consensus       480 ~---~~~~~~~~~~d~~~~~~~~l~~P~giav~~dG~lyvaD~~~~~I~~i~~~~~~~~~~g~~~i~~~~~~e~yvfd~~  556 (770)
                      .   +|+||+   .++..|+.|+|++|++|||+|||.+||||.+|.||+++....|..++...|+|++|+.+|+|+||..
T Consensus       641 ~~~~~cdcfs---~~~~~At~A~lnsp~alaVsPdg~v~IAD~gN~rIr~Vs~~~~~~~~sr~YEi~~p~~QE~Y~Fnr~  717 (1899)
T KOG4659|consen  641 DVAACCDCFS---LRDVAATQAKLNSPYALAVSPDGDVIIADSGNSRIRKVSARMAKYDGSRTYEITDPERQEKYTFNRH  717 (1899)
T ss_pred             ccccCCcccc---ccchhhhccccCCcceEEECCCCcEEEecCCchhhhhhhhcccccCCCceeeccCcccceeEEEecc
Confidence            6   499996   6888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEEcCCCCCcEEEEEecCCCCCCceEEEECCCCCEEEEEEcCCCcce-EeccCCc
Q psy4832         557 GQHITTRDMTSGKPRYSFLYSKNTSFGKLSTITDASGNKINFLRDYSNVAQ-LQWPTGL  614 (770)
Q Consensus       557 G~~~~t~d~~tg~~~y~~~Yd~~~~~G~L~~vtd~~G~~~~~~~d~~~~~~-~~~p~G~  614 (770)
                      |+|+.|+++.||.+.|+|+|..+++.|.|++++|++|+.+++.||++.+.. ++.|.|+
T Consensus       718 GqH~sTvsliTget~ynFtY~v~ss~~~lsei~~a~Gn~l~ilrd~~s~~~~~~~~~~q  776 (1899)
T KOG4659|consen  718 GQHSSTVSLITGETFYNFTYQVDSSIGMLSEITDASGNVLRVLRDNDSLFDLETTLGGQ  776 (1899)
T ss_pred             ceeeeeEEEEeceeEEEEEEecCCCcchhhhhhhcCCcEEEEEecCCCCcceeecCCCc
Confidence            999999999999999999999998999999999999999999999987766 5667763

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4659\|consensus	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>COG4257 Vgb Streptogramin lyase [Defense mechanisms]	Back alignment and domain information

>COG4257 Vgb Streptogramin lyase [Defense mechanisms]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1214\|consensus	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1214\|consensus	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family	Back alignment and domain information

>KOG1520\|consensus	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PF03527 RHS: RHS protein; InterPro: IPR001826 RHS elements are proteins of non-essential function believed to play an important role in the natural ecology of the cell	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG1520\|consensus	Back alignment and domain information

>TIGR01643 YD_repeat_2x YD repeat (two copies)	Back alignment and domain information

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12	Back alignment and domain information

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12	Back alignment and domain information

>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF05593 RHS_repeat: RHS Repeat; InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>COG3209 RhsA Rhs family protein [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins	Back alignment and domain information

>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118	Back alignment and domain information

>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>KOG4499\|consensus	Back alignment and domain information

>TIGR01643 YD_repeat_2x YD repeat (two copies)	Back alignment and domain information

>PF05593 RHS_repeat: RHS Repeat; InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins	Back alignment and domain information

>TIGR03032 conserved hypothetical protein TIGR03032	Back alignment and domain information

>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG4499\|consensus	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG1215\|consensus	Back alignment and domain information

>KOG1215\|consensus	Back alignment and domain information

>COG3209 RhsA Rhs family protein [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>TIGR03032 conserved hypothetical protein TIGR03032	Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3	Back alignment and domain information

>COG3211 PhoX Predicted phosphatase [General function prediction only]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

Back alignment and domain information

>PF13449 Phytase-like: Esterase-like activity of phytase	Back alignment and domain information

>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0640\|consensus	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG3211 PhoX Predicted phosphatase [General function prediction only]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG0286\|consensus	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF15283 DUF4595: Domain of unknown function (DUF4595) with porin-like fold	Back alignment and domain information

>PF06788 UPF0257: Uncharacterised protein family (UPF0257); InterPro: IPR010646 This is a group of proteins of unknown function	Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>PF15283 DUF4595: Domain of unknown function (DUF4595) with porin-like fold	Back alignment and domain information

>smart00135 LY Low-density lipoprotein-receptor YWTD domain	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>smart00135 LY Low-density lipoprotein-receptor YWTD domain	Back alignment and domain information

>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR03696 Rhs_assc_core RHS repeat-associated core domain	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>PF14517 Tachylectin: Tachylectin; PDB: 1TL2_A	Back alignment and domain information

>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02939 lipoprotein; Reviewed	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins	Back alignment and domain information

>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG0645\|consensus	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST)	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides	Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>KOG0283\|consensus	Back alignment and domain information

>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST)	Back alignment and domain information

>KOG0268\|consensus	Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

>PF07202 Tcp10_C: T-complex protein 10 C-terminus; InterPro: IPR009852 Proteins in this entry include T-complex 10, involved in spermatogenesis in mice, and centromere protein J, which not only inhibits microtubule nucleation from the centrosome, but also depolymerises taxol-stabilised microtubules [, ]	Back alignment and domain information

>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller	Back alignment and domain information

>PF06739 SBBP: Beta-propeller repeat; InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF13860 FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		770
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	8e-22
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	1e-11
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	1e-05
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	1e-20
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	6e-14
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	3e-13
3kya_A		496	Putative phosphatase; structural genomics, joint c	7e-16
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	9e-16
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	3e-07
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	7e-07
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	2e-15
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	9e-10
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	5e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-15
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	3e-12
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	8e-10
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	1e-07
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	4e-07
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	7e-04
2p4o_A		306	Hypothetical protein; putative lactonase, structur	4e-05
2p4o_A		306	Hypothetical protein; putative lactonase, structur	4e-05

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430	Back alignment and structure

 Score = 97.9 bits (243), Expect = 8e-22
 Identities = 34/193 (17%), Positives = 65/193 (33%), Gaps = 12/193 (6%)

Query: 184 ALTSGPDGSLYVGDFN--LVRRLTPEGNVFTVLQLSATQVSYQYYLALSPADGHLYISDA 241
           A T   +G LY   +N   V R        T L  +     +++++   P+  + YI   
Sbjct: 231 AETHPINGELYFNSWNAGQVFRYDFTTQETTPL-FTIQDSGWEFHIQFHPSGNYAYIVVV 289

Query: 242 EKHQILRVLSLESVADPSINWEVAVGSGER-CIPGDETNCGDNGPALAAKLSHPKGLAIK 300
            +H ILR          +  + V    G +  + G       + P     + +P      
Sbjct: 290 NQHYILRSDYDWKTKRLTTPYIVCGQQGAKDWVDGVGKKARMHAPRQGTFVKNPAYKGSS 349

Query: 301 ADKTMFIADGTN--IRVVSPEGIIHTLIGHHKHHNIWSPFNCHRS-FPASTAQLQWPTGL 357
            +   +  D  N  IR+++P+G + T  G        +  + +        A+   P G+
Sbjct: 350 DEYDFYFCDRENHCIRILTPQGRVTTFAG-----RGSNGTSGYNDGDLRQEARFNHPEGI 404

Query: 358 ALSPLDDSLHFID 370
                 +     D
Sbjct: 405 VYDEERECFFIGD 417

PyMOL of 3tc9

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Length = 430	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 409	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Length = 496	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Length = 270	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Length = 329	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Length = 306	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		770
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	99.97
3kya_A		496	Putative phosphatase; structural genomics, joint c	99.97
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	99.97
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	99.97
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.94
3kya_A		496	Putative phosphatase; structural genomics, joint c	99.93
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	99.93
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	99.93
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	99.92
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	99.92
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	99.91
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	99.91
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.91
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.9
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	99.89
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.89
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.89
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	99.88
3v65_B		386	Low-density lipoprotein receptor-related protein;	99.88
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.87
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.87
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.87
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	99.87
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	99.86
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	99.86
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	99.86
3v65_B		386	Low-density lipoprotein receptor-related protein;	99.85
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	99.85
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	99.85
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	99.84
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.84
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	99.84
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	99.84
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	99.83
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	99.83
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	99.82
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.82
2p4o_A		306	Hypothetical protein; putative lactonase, structur	99.79
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	99.78
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	99.78
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	99.75
1n7d_A		699	LDL receptor, low-density lipoprotein receptor; fa	99.74
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.74
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.73
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	99.72
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	99.71
2qe8_A		343	Uncharacterized protein; structural genomics, join	99.69
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.69
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	99.69
2qe8_A		343	Uncharacterized protein; structural genomics, join	99.68
2p4o_A		306	Hypothetical protein; putative lactonase, structur	99.67
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.67
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.65
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.61
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	99.61
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.6
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.59
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	99.59
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.59
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.59
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.57
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.56
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.5
1cru_A		454	Protein (soluble quinoprotein glucose dehydrogena;	99.5
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.48
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	99.44
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.43
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.43
2g8s_A		353	Glucose/sorbosone dehydrogenases; bladed beta-prop	99.41
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.39
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.38
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	99.34
3das_A		347	Putative oxidoreductase; aldose sugar dehydrogenas	99.33
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.33
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.33
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	99.32
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	99.31
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.3
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.29
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	99.26
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	99.25
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	99.2
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	99.19
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	99.18
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.16
1cru_A		454	Protein (soluble quinoprotein glucose dehydrogena;	99.16
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.16
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	99.15
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.08
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.07
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.05
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.01
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	98.98
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	98.97
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.96
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	98.95
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.94
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	98.88
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	98.84
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	98.84
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	98.83
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.83
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	98.81
2wg3_C		463	Hedgehog-interacting protein; lipoprotein, develop	98.78
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	98.74
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	98.72
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	98.69
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	98.68
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	98.66
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	98.66
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	98.65
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	98.64
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	98.64
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	98.63
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	98.57
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	98.55
3q6k_A		381	43.2 kDa salivary protein; beta propeller, binding	98.54
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	98.49
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	98.47
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.47
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	98.44
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	98.43
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	98.42
4a2l_A		795	BT_4663, two-component system sensor histidine kin	98.4
3v9f_A		781	Two-component system sensor histidine kinase/RESP	98.38
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	98.36
4a2l_A		795	BT_4663, two-component system sensor histidine kin	98.35
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	98.31
3q6k_A		381	43.2 kDa salivary protein; beta propeller, binding	98.28
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.26
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	98.26
3v9f_A		781	Two-component system sensor histidine kinase/RESP	98.25
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.21
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	98.2
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	98.19
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	98.16
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	98.14
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	98.13
3ow8_A		321	WD repeat-containing protein 61; structural genomi	98.12
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.1
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.05
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	98.04
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.02
4a9v_A		592	PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona	98.0
3ow8_A		321	WD repeat-containing protein 61; structural genomi	97.97
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	97.93
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	97.91
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.91
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	97.82
1tl2_A		236	L10, protein (tachylectin-2); animal lectin, horse	97.81
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	97.81
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.77
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	97.76
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	97.74
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	97.73
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	97.72
4a9v_A		592	PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona	97.69
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	97.68
1tl2_A		236	L10, protein (tachylectin-2); animal lectin, horse	97.62
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	97.61
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	97.58
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	97.57
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	97.57
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	97.48
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	97.47
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	97.45
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	97.44
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	97.41
1k32_A		1045	Tricorn protease; protein degradation, substrate g	97.39
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	97.39
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	97.39
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	97.37
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	97.35
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	97.35
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	97.32
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	97.32
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	97.29
3ott_A		758	Two-component system sensor histidine kinase; beta	97.28
3zwu_A		592	Alkaline phosphatase PHOX; hydrolase, beta-propell	97.24
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	97.21
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	97.2
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	97.19
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.17
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	97.15
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	97.15
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	97.12
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	97.11
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	97.09
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	97.08
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	97.03
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.02
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	96.99
3ott_A		758	Two-component system sensor histidine kinase; beta	96.97
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	96.96
1k32_A		1045	Tricorn protease; protein degradation, substrate g	96.93
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	96.93
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	96.92
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	96.88
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	96.88
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.86
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	96.82
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	96.81
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	96.81
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	96.8
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	96.79
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	96.72
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	96.71
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	96.7
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	96.69
3zwu_A		592	Alkaline phosphatase PHOX; hydrolase, beta-propell	96.68
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	96.64
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	96.64
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	96.62
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	96.59
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	96.58
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	96.58
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.55
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	96.53
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	96.49
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	96.39
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	96.39
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	96.34
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	96.25
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	96.24
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	96.16
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	96.02
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	96.01
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	95.96
3jrp_A		379	Fusion protein of protein transport protein SEC13	95.86
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	95.81
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	95.8
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	95.77
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	95.76
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	95.61
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	95.59
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	95.46
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	95.39
3jro_A		753	Fusion protein of protein transport protein SEC13	95.32
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	95.16
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	95.15
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	95.05
2pm7_B		297	Protein transport protein SEC13, protein transport	95.01
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	94.99
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	94.98
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	94.3
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	94.24
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	93.99
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	93.95
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	93.78
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	93.69
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	93.51
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	93.31
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	93.07
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	93.05
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	92.84
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	92.8
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	92.54
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	92.17
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	92.15
3jro_A		753	Fusion protein of protein transport protein SEC13	91.97
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	91.9
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	91.45
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	90.62
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	90.44
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	90.33
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	90.2
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	89.32
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	89.24
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	89.2
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	87.63
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	87.38
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	86.62
2pm7_B		297	Protein transport protein SEC13, protein transport	85.64
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	85.45
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	84.62
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	83.99
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	83.93

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

Probab=99.97  E-value=6e-30  Score=285.71  Aligned_cols=286  Identities=15%  Similarity=0.150  Sum_probs=215.9

Q ss_pred             CCCeEEEEec-----cCccCCccCCCCCcccccc-cccCceEEEEcCC---CCEEEEeC-ceEEEEcC-CCcEEEEeccC
Q psy4832         149 FPRTVSVVMG-----TGLQRPLVCKDCDGVARDA-RLLTPVALTSGPD---GSLYVGDF-NLVRRLTP-EGNVFTVLQLS  217 (770)
Q Consensus       149 ~~~~i~~v~g-----~G~~~~~~~~~~~g~~~~~-~l~~P~~la~~~d---G~lyv~d~-~~I~~i~~-~G~v~~~~~~~  217 (770)
                      .+..|++++|     +|...     .++|+...+ +|..|.+|++|++   |+|||+|. ++|+++++ +|.+.++++  
T Consensus       107 ~~~~VsTv~G~~~~~~g~~~-----~~dG~~~~a~~~~~P~gvavd~~s~~g~Lyv~D~~~~I~~id~~~g~v~~~~~--  179 (433)
T 4hw6_A          107 YNYVVTTFLGKLYENNTKWD-----VLAGPFDDCGAFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYVDIKTT--  179 (433)
T ss_dssp             CCEEEEEEECCCBTTTTBCC-----CCCEETTSCCCCSCCCEEEECTTTTTCEEEEECBTSCEEEEETTTTEEEEECC--
T ss_pred             eeeEEeeeecceeccCCCcc-----ccCCchHHhcccCCCceEEEccccCCCEEEEEeCCCCEEEEECCCCEEEEeec--
Confidence            6789999999     67654     356766555 9999999999985   99999999 89999998 677777763  


Q ss_pred             cccccceeEEEEeCCCCcEEEEeCCCc----EEEEEeccCCccCCCCcEEEEECCCccccCCCCCCcCCCcccccccccC
Q psy4832         218 ATQVSYQYYLALSPADGHLYISDAEKH----QILRVLSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSH  293 (770)
Q Consensus       218 ~~~~~~p~~lav~p~~g~lyvsd~~~~----~I~~i~~~~~~~~~~g~~~~vaG~g~~~~p~~~~~~g~~g~~~~a~l~~  293 (770)
                        .+..|.+|++++ +|+|||+|..++    .+..+..       ++.                 +..   ....+.+..
T Consensus       180 --~~~~P~giavd~-dG~lyVad~~~~~~~~gv~~~~~-------~~~-----------------~~~---~~~~~~~~~  229 (433)
T 4hw6_A          180 --NIGQCADVNFTL-NGDMVVVDDQSSDTNTGIYLFTR-------ASG-----------------FTE---RLSLCNARG  229 (433)
T ss_dssp             --CCSCEEEEEECT-TCCEEEEECCSCTTSEEEEEECG-------GGT-----------------TCC---EEEEEECSS
T ss_pred             --CCCCccEEEECC-CCCEEEEcCCCCcccceEEEEEC-------CCC-----------------eec---cccccccCC
Confidence              678899999997 677999998642    2444421       110                 000   012235789


Q ss_pred             cceEEEcc-CCcEEEEeCCC--eEEECCC-CcE-EEeecCCCCCCCcCCCccCCCcccccccccCcceEEEeCCCCe-EE
Q psy4832         294 PKGLAIKA-DKTMFIADGTN--IRVVSPE-GII-HTLIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDS-LH  367 (770)
Q Consensus       294 P~gIavd~-~G~lYvaD~~~--Ir~id~~-G~i-~t~~g~~~~~~~~~p~~~~~~~~~~~~~l~~P~gla~d~~~g~-ly  367 (770)
                      |.+|++|+ +|+|||+|..+  |++++++ |.+ ..++..+.                    ..+|.+|+++| +|+ ||
T Consensus       230 P~giavd~~~G~lyv~d~~~~~V~~~d~~~g~~~~~~~~~~~--------------------~~~~~~ia~dp-dG~~LY  288 (433)
T 4hw6_A          230 AKTCAVHPQNGKIYYTRYHHAMISSYDPATGTLTEEEVMMDT--------------------KGSNFHIVWHP-TGDWAY  288 (433)
T ss_dssp             BCCCEECTTTCCEEECBTTCSEEEEECTTTCCEEEEEEECSC--------------------CSSCEEEEECT-TSSEEE
T ss_pred             CCEEEEeCCCCeEEEEECCCCEEEEEECCCCeEEEEEeccCC--------------------CCCcccEEEeC-CCCEEE
Confidence            99999999 89999999876  9999987 877 44443221                    23567899999 776 99


Q ss_pred             EEe--CCEEEEEcCC---Cc---EEEEecCCCCCCCCCCCCccccccccccccccccCCcccccccccCCeeEEEE----
Q psy4832         368 FID--DRVIFKLTND---LK---VKIVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDDSVRASNMDLGSLTALAF----  435 (770)
Q Consensus       368 v~D--~~~I~~i~~~---G~---v~~vaG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~l~~P~giav----  435 (770)
                      |+|  +++|++++.+   +.   ..+++|.......                      ....+..+.|..|.+|++    
T Consensus       289 vad~~~~~I~~~~~d~~~~~~~~~~~~ag~~g~~g~----------------------~dg~~~~a~~~~P~giav~~n~  346 (433)
T 4hw6_A          289 IIYNGKHCIYRVDYNRETGKLAVPYIVCGQHSSPGW----------------------VDGMGTGARLWGPNQGIFVKNE  346 (433)
T ss_dssp             EEETTTTEEEEEEBCTTTCCBCCCEEEEECTTCCCC----------------------BCEEGGGSBCSSEEEEEEEECG
T ss_pred             EEeCCCCEEEEEeCCCCCcccCcEEEEEecCCCCcc----------------------CCCcccceEEcCCccEEEEccc
Confidence            999  6899999865   32   3577775322111                      012345678999999999    


Q ss_pred             -----cCCCCEEEEeCCCCceeeEEEEcCCCcEEEeecCccCCCCCcCCCCCcccccCccCcccccceecCCeeEEEEc-
Q psy4832         436 -----SPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEFEKNSKETLLTSTARFTSISALSVS-  509 (770)
Q Consensus       436 -----d~~G~lyVaD~~~~ri~~i~~i~~~G~i~~~aG~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~l~~P~giav~-  509 (770)
                           +++|+|||||+.++|   |++++++|.+++++|.+..    |.+        +..++.++..++|+.|.+||++ 
T Consensus       347 ~y~~dd~~g~lyvaD~~n~~---I~~~~~~G~v~t~~G~g~~----~~~--------G~~dG~~~~~~~~~~P~giavd~  411 (433)
T 4hw6_A          347 AYAGEEDEYDFYFCDRDSHT---VRVLTPEGRVTTYAGRGNS----REW--------GYVDGELRSQALFNHPTSIAYDM  411 (433)
T ss_dssp             GGTTSSCCEEEEEEETTTTE---EEEECTTSEEEEEECCCTT----CSS--------CCBCEETTTTCBCSSEEEEEEET
T ss_pred             cccccCCCCcEEEEECCCCE---EEEECCCCCEEEEEeCCCC----Ccc--------ccCCCccccccEeCCCcEEEEEC
Confidence                 899999999999986   7888999999999987630    000        0134446778899999999999 


Q ss_pred             CCCcEEEEcCCCceEEeeec
Q psy4832         510 PDGVVNVADQGSLHILALQH  529 (770)
Q Consensus       510 ~dG~lyvaD~~~~~I~~i~~  529 (770)
                      ++|.|||+|.+|+||++|..
T Consensus       412 ~~g~lyVaD~~n~rIr~i~~  431 (433)
T 4hw6_A          412 KRKCFYIGDCDNHRVRKIAP  431 (433)
T ss_dssp             TTTEEEEEEGGGTEEEEEEE
T ss_pred             CCCEEEEEeCCCCEEEEEec
Confidence            79999999999999999865

PyMOL of 4hw6

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A*	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A*	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A*	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A*	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		770
d2p4oa1		302	b.68.6.3 (A:4-305) Hypothetical protein All0351 ho	4e-04

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Length = 302	Back information, alignment and structure


class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]

 Score = 40.8 bits (94), Expect = 4e-04
 Identities = 35/320 (10%), Positives = 83/320 (25%), Gaps = 53/320 (16%)

Query: 212 TVLQLSATQVSYQYY-------LALSPADGHLYISDAEKHQILRVLSLESVADPSINWEV 264
             ++L+  ++   +        LA +P DG +++++ E  +I+ +        P  N ++
Sbjct: 11  KPIELAPAKIITSFPVNTFLENLASAP-DGTIFVTNHEVGEIVSI-------TPDGNQQI 62

Query: 265 AVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTNIRVVSPEGIIHT 324
                                          GLA  ++  +         +     +   
Sbjct: 63  HATVE----------------------GKVSGLAFTSNGDLVATGWNADSIPVVSLVKSD 100

Query: 325 LIGHHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFIDDRVIFKLTNDLKVK 384
                      + F    +  + T  L   +      L D +       +      L   
Sbjct: 101 GTVETLLTLPDAIFLNGITPLSDTQYLTADSYRGAIWLIDVVQPSGSIWL--EHPMLARS 158

Query: 385 IVAGIPLHCRTGDKDKRDFKDKQSKTKKSTVQDD------SVRASNMDLGSLTALAFSPT 438
               +        +         ++                     ++  ++   AF   
Sbjct: 159 NSESVFPAANGLKRFGNFLYVSNTEKMLLLRIPVDSTDKPGEPEIFVEQTNIDDFAFDVE 218

Query: 439 GDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCA--EFEKNSKETLLTS 496
           G+LY A       N++  I         A    +++    +T  A  + E +     + +
Sbjct: 219 GNLYGATHIY---NSVVRIAPDRSTTIIAQ---AEQGVIGSTAVAFGQTEGDCTAIYVVT 272

Query: 497 TARFTSISALSVSPDGVVNV 516
                      V P  VV +
Sbjct: 273 NGGMFLPPPTGVVPANVVRL 292

PyMOL of d2p4oa1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		770
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	99.95
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	99.95
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	99.91
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	99.89
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	99.89
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	99.82
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	99.81
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	99.8
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	99.79
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	99.79
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	99.77
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	99.75
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	99.75
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	99.65
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	99.55
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	99.44
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	99.28
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.21
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.11
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	99.04
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.0
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	98.97
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.7
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	98.67
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	98.52
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	98.35
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	98.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	97.98
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	97.94
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	97.93
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	97.93
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	97.89
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.88
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	97.83
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	97.81
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	97.8
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	97.74
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	97.73
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	97.66
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.65
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.6
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	97.53
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	97.5
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	97.41
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	97.37
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	97.36
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	97.19
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	97.17
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	96.18
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	95.99
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	95.18
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	94.95
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	94.15
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	93.78
d1tl2a_		235	Tachylectin-2 {Japanese horseshoe crab (Tachypleus	93.7
d1tbga_		340	beta1-subunit of the signal-transducing G protein	93.42
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	92.63
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	92.61
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	92.13
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	92.02
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	91.94
d1tbga_		340	beta1-subunit of the signal-transducing G protein	91.77
d1tl2a_		235	Tachylectin-2 {Japanese horseshoe crab (Tachypleus	90.09
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	90.05
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	88.03
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	84.83
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	82.43

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: NHL repeat
family: NHL repeat
domain: Brain tumor cg10719-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.95  E-value=1e-25  Score=234.49  Aligned_cols=244  Identities=14%  Similarity=0.257  Sum_probs=190.5

Q ss_pred             cccccCceEEEEcCCCCEEEEeC--ceEEEEcCCCcEEEEeccC---cccccceeEEEEeCCCCcEEEE-eCCCcEEEEE
Q psy4832         176 DARLLTPVALTSGPDGSLYVGDF--NLVRRLTPEGNVFTVLQLS---ATQVSYQYYLALSPADGHLYIS-DAEKHQILRV  249 (770)
Q Consensus       176 ~~~l~~P~~la~~~dG~lyv~d~--~~I~~i~~~G~v~~~~~~~---~~~~~~p~~lav~p~~g~lyvs-d~~~~~I~~i  249 (770)
                      ..+|..|.+||++++|+|||+|.  ++|++++++|+..+.++..   ......|.++++.+..+..+++ +..+++|.++
T Consensus        19 ~g~f~~P~gvavd~dg~i~VaD~~n~rI~v~d~~G~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~i~~~   98 (279)
T d1q7fa_          19 EGQFTEPSGVAVNAQNDIIVADTNNHRIQIFDKEGRFKFQFGECGKRDSQLLYPNRVAVVRNSGDIIVTERSPTHQIQIY   98 (279)
T ss_dssp             TTCBSCEEEEEECTTCCEEEEEGGGTEEEEECTTSCEEEEECCBSSSTTCBSSEEEEEEETTTTEEEEEECGGGCEEEEE
T ss_pred             CCeECCccEEEEcCCCCEEEEECCCCEEEEEeCCCCEEEEecccCCCcccccccccccccccccccceeccCCccccccc
Confidence            45799999999999999999997  5999999999998877542   3456789999988666665554 5567788888


Q ss_pred             eccCCccCCCCcEEEEECCCccccCCCCCCcCCCcccccccccCcceEEEccCCcEEEEeCCC--eEEECCCCcEEEeec
Q psy4832         250 LSLESVADPSINWEVAVGSGERCIPGDETNCGDNGPALAAKLSHPKGLAIKADKTMFIADGTN--IRVVSPEGIIHTLIG  327 (770)
Q Consensus       250 ~~~~~~~~~~g~~~~vaG~g~~~~p~~~~~~g~~g~~~~a~l~~P~gIavd~~G~lYvaD~~~--Ir~id~~G~i~t~~g  327 (770)
                             +++|......+.                    ..+..|.+++++++|.+|++|..+  +.+++++|.+...++
T Consensus        99 -------~~~g~~~~~~~~--------------------~~~~~p~~~avd~~G~i~v~~~~~~~~~~~~~~g~~~~~~g  151 (279)
T d1q7fa_          99 -------NQYGQFVRKFGA--------------------TILQHPRGVTVDNKGRIIVVECKVMRVIIFDQNGNVLHKFG  151 (279)
T ss_dssp             -------CTTSCEEEEECT--------------------TTCSCEEEEEECTTSCEEEEETTTTEEEEECTTSCEEEEEE
T ss_pred             -------cccccceeecCC--------------------CcccccceeccccCCcEEEEeeccceeeEeccCCceeeccc
Confidence                   567776554432                    235689999999999999999876  889999998766554


Q ss_pred             CCCCCCCcCCCccCCCcccccccccCcceEEEeCCCCeEEEEe--CCEEEEEcCCCcEEEEecCCCCCCCCCCCCccccc
Q psy4832         328 HHKHHNIWSPFNCHRSFPASTAQLQWPTGLALSPLDDSLHFID--DRVIFKLTNDLKVKIVAGIPLHCRTGDKDKRDFKD  405 (770)
Q Consensus       328 ~~~~~~~~~p~~~~~~~~~~~~~l~~P~gla~d~~~g~lyv~D--~~~I~~i~~~G~v~~vaG~~~~~~~~~~~~~~~~~  405 (770)
                      ..                   ..+.+|.+|++++ +++|||+|  +++|++++++|+.....|.+               
T Consensus       152 ~~-------------------~~~~~~~~i~~d~-~g~i~v~d~~~~~V~~~d~~G~~~~~~g~~---------------  196 (279)
T d1q7fa_         152 CS-------------------KHLEFPNGVVVND-KQEIFISDNRAHCVKVFNYEGQYLRQIGGE---------------  196 (279)
T ss_dssp             CT-------------------TTCSSEEEEEECS-SSEEEEEEGGGTEEEEEETTCCEEEEESCT---------------
T ss_pred             cc-------------------ccccccceeeecc-ceeEEeeeccccceeeeecCCceeeeeccc---------------
Confidence            32                   2477899999999 99999999  58999999999865444321               


Q ss_pred             cccccccccccCCcccccccccCCeeEEEEcCCCCEEEEeCCCCceeeEEEEcCCCcEEEeecCccCCCCCcCCCCCccc
Q psy4832         406 KQSKTKKSTVQDDSVRASNMDLGSLTALAFSPTGDLYIADIDARKVNALRVIDSTGRMFDFAGRWQSDKKNCNTTNCAEF  485 (770)
Q Consensus       406 ~~~~~~~~~~~~~~~~a~~~~l~~P~giavd~~G~lyVaD~~~~ri~~i~~i~~~G~i~~~aG~~~~~~~~~~~~~~~~~  485 (770)
                                         ..+..|.||++|++|+|||||..++.  +|.+++++|++....+..               
T Consensus       197 -------------------g~~~~P~giavD~~G~i~Vad~~~~~--~v~~f~~~G~~~~~~~~~---------------  240 (279)
T d1q7fa_         197 -------------------GITNYPIGVGINSNGEILIADNHNNF--NLTIFTQDGQLISALESK---------------  240 (279)
T ss_dssp             -------------------TTSCSEEEEEECTTCCEEEEECSSSC--EEEEECTTSCEEEEEEES---------------
T ss_pred             -------------------ccccCCcccccccCCeEEEEECCCCc--EEEEECCCCCEEEEEeCC---------------
Confidence                               23577999999999999999987653  478899999864433221               


Q ss_pred             ccCccCcccccceecCCeeEEEEcCCCcEEEEcCCCceEEeeecC
Q psy4832         486 EKNSKETLLTSTARFTSISALSVSPDGVVNVADQGSLHILALQHY  530 (770)
Q Consensus       486 ~~~~~d~~~~~~~~l~~P~giav~~dG~lyvaD~~~~~I~~i~~~  530 (770)
                                  ..+..|.+||+++||.|||+| .|++|++++..
T Consensus       241 ------------~~~~~p~~vav~~dG~l~V~~-~n~~v~~fr~~  272 (279)
T d1q7fa_         241 ------------VKHAQCFDVALMDDGSVVLAS-KDYRLYIYRYV  272 (279)
T ss_dssp             ------------SCCSCEEEEEEETTTEEEEEE-TTTEEEEEECS
T ss_pred             ------------CCCCCEeEEEEeCCCcEEEEe-CCCeEEEEEee
Confidence                        113469999999999999999 57888877554

PyMOL of d1q7fa_

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tl2a_ b.67.1.1 (A:) Tachylectin-2 {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure