Psyllid ID: psy4847
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 396 | ||||||
| 328720335 | 986 | PREDICTED: metal transporter CNNM2-like | 0.929 | 0.373 | 0.706 | 1e-153 | |
| 328720337 | 950 | PREDICTED: metal transporter CNNM2-like | 0.929 | 0.387 | 0.706 | 1e-153 | |
| 328720333 | 931 | PREDICTED: metal transporter CNNM2-like | 0.929 | 0.395 | 0.706 | 1e-153 | |
| 328783660 | 945 | PREDICTED: metal transporter CNNM2-like | 0.931 | 0.390 | 0.676 | 1e-149 | |
| 380016390 | 985 | PREDICTED: LOW QUALITY PROTEIN: metal tr | 0.931 | 0.374 | 0.676 | 1e-149 | |
| 350403868 | 950 | PREDICTED: metal transporter CNNM2-like | 0.931 | 0.388 | 0.677 | 1e-147 | |
| 383860842 | 944 | PREDICTED: metal transporter CNNM2-like | 0.934 | 0.391 | 0.674 | 1e-147 | |
| 332022207 | 999 | Metal transporter CNNM2 [Acromyrmex echi | 0.934 | 0.370 | 0.676 | 1e-146 | |
| 307177469 | 1003 | Metal transporter CNNM2 [Camponotus flor | 0.931 | 0.367 | 0.672 | 1e-146 | |
| 307209414 | 1012 | Metal transporter CNNM2 [Harpegnathos sa | 0.934 | 0.365 | 0.659 | 1e-144 |
| >gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 548 bits (1412), Expect = e-153, Method: Compositional matrix adjust.
Identities = 279/395 (70%), Positives = 319/395 (80%), Gaps = 27/395 (6%)
Query: 22 EFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP 81
E+NDLEKDEVNIISGALEL RK VGDVMTKLEDVYMLSYD ILDFETVSEIMKSGYSRIP
Sbjct: 507 EYNDLEKDEVNIISGALELHRKKVGDVMTKLEDVYMLSYDTILDFETVSEIMKSGYSRIP 566
Query: 82 VYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGI 141
VYE R NIVTM YIKDLALVDPDDNT LKTLCQFYQN CYFVFEDTTLDVL KQFKEGI
Sbjct: 567 VYEGNRQNIVTMLYIKDLALVDPDDNTLLKTLCQFYQNPCYFVFEDTTLDVLFKQFKEGI 626
Query: 142 KGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQS 201
KGHMAFVHRVNNEGEGDPFYETVG+ITLEDVIEELIQAEIMDETDV+TDN+ K +R +Q
Sbjct: 627 KGHMAFVHRVNNEGEGDPFYETVGIITLEDVIEELIQAEIMDETDVYTDNRSK-QRRQQR 685
Query: 202 SHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSS-------NFYVGSLLDRITQKGT-- 252
S R QDFT FAE+S+ QRIHISPQL LATFQFLSS + ++L R+ ++
Sbjct: 686 SLRTQDFTAFAERSDNQRIHISPQLTLATFQFLSSSVEAFKTDVVSETILMRLLKQDVIF 745
Query: 253 ---SQQKPTFKS-----LKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQAL 304
+ K FKS + ++ KPVDYFVLILEGR EV VG+ENLV+E+GPF+YFG QAL
Sbjct: 746 HIKMKDKERFKSDPASIIYQQGKPVDYFVLILEGRVEVTVGRENLVFESGPFTYFGSQAL 805
Query: 305 TQNIGIAESPTNNSSAAQAYG-----GSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIR 359
QNIGI ESP + ++ A GS+QSVN+D++LRYTFVPDYSVRA TE+ Y++++
Sbjct: 806 HQNIGIGESPPSGANPTMANSTVNNMGSIQSVNIDAMLRYTFVPDYSVRAVTEVMYLRVK 865
Query: 360 RSFYLAAKRATLMEKSKKSEESMSAGDQFEDEVEK 394
RSFY+AAKRATLME+SKK MS +F++EV+K
Sbjct: 866 RSFYMAAKRATLMERSKK----MSNAGEFDEEVDK 896
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328783660|ref|XP_625178.3| PREDICTED: metal transporter CNNM2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016390|ref|XP_003692168.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter CNNM2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383860842|ref|XP_003705897.1| PREDICTED: metal transporter CNNM2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332022207|gb|EGI62522.1| Metal transporter CNNM2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307177469|gb|EFN66596.1| Metal transporter CNNM2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307209414|gb|EFN86431.1| Metal transporter CNNM2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 396 | ||||||
| FB|FBgn0262124 | 834 | uex "unextended" [Drosophila m | 0.911 | 0.432 | 0.579 | 3.8e-110 | |
| ZFIN|ZDB-GENE-050208-36 | 811 | cnnm2a "cyclin M2a" [Danio rer | 0.772 | 0.377 | 0.509 | 1.2e-85 | |
| UNIPROTKB|Q9H8M5 | 875 | CNNM2 "Metal transporter CNNM2 | 0.714 | 0.323 | 0.529 | 1.1e-82 | |
| MGI|MGI:2151054 | 875 | Cnnm2 "cyclin M2" [Mus musculu | 0.714 | 0.323 | 0.529 | 3.6e-82 | |
| UNIPROTKB|E2RJ19 | 875 | CNNM2 "Uncharacterized protein | 0.714 | 0.323 | 0.529 | 4.5e-82 | |
| RGD|1308162 | 875 | Cnnm2 "cyclin M2" [Rattus norv | 0.714 | 0.323 | 0.529 | 4.5e-82 | |
| UNIPROTKB|Q5U2P1 | 875 | Cnnm2 "Metal transporter CNNM2 | 0.714 | 0.323 | 0.529 | 4.5e-82 | |
| UNIPROTKB|F1ND49 | 598 | CNNM2 "Uncharacterized protein | 0.717 | 0.474 | 0.524 | 4.5e-82 | |
| UNIPROTKB|Q9NRU3 | 951 | CNNM1 "Metal transporter CNNM1 | 0.707 | 0.294 | 0.511 | 1.5e-77 | |
| UNIPROTKB|F1MD84 | 941 | CNNM1 "Uncharacterized protein | 0.707 | 0.297 | 0.508 | 6.6e-77 |
| FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1088 (388.1 bits), Expect = 3.8e-110, P = 3.8e-110
Identities = 227/392 (57%), Positives = 285/392 (72%)
Query: 19 VTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYS 78
VT + NDL+K+EVNIISGALELR+K V DVMT + D +MLS DA+LDFETVSEIM SGYS
Sbjct: 350 VTNDVNDLDKNEVNIISGALELRKKTVADVMTHINDAFMLSLDALLDFETVSEIMNSGYS 409
Query: 79 RIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFK 138
RIPVY+ R NIVT+ YIKDLA VD DDNTPLKTLC+FYQN +FVFED TLD++ QFK
Sbjct: 410 RIPVYDGDRKNIVTLLYIKDLAFVDTDDNTPLKTLCEFYQNPVHFVFEDYTLDIMFNQFK 469
Query: 139 EGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRH 198
EG GH+AFVHRVNNEG+GDPFYETVGL+TLEDVIEELIQAEI+DETDV+ DN+ KT+R+
Sbjct: 470 EGTIGHIAFVHRVNNEGDGDPFYETVGLVTLEDVIEELIQAEIVDETDVFVDNRTKTRRN 529
Query: 199 KQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLS-----------SNFYVGSLLDR- 246
+ ++ DF+ FAE+ E Q + ISPQL LATFQ+LS S + LL++
Sbjct: 530 R---YKKADFSAFAERREVQTVRISPQLTLATFQYLSTAVDAFKKDVISELILRRLLNQD 586
Query: 247 ----ITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQ 302
I KG S+ P+ + + K VD+FVLILEGR EV +GKE L++E+GPF+YFG Q
Sbjct: 587 VFHNIKTKGKSKDDPSLY-IFTQGKAVDFFVLILEGRVEVTIGKEALMFESGPFTYFGTQ 645
Query: 303 ALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSF 362
AL N+ + +SPT GSLQS+N+DS +R +FVPDYSVRA +++ Y+ I+R
Sbjct: 646 ALVPNV-VIDSPTQM--------GSLQSLNMDSKIRQSFVPDYSVRAISDVIYITIKRVL 696
Query: 363 YLAAKRATLMXXXXXXXXXMSAGDQFEDEVEK 394
YL AK+ATL+ S + F+DEVE+
Sbjct: 697 YLTAKKATLLEKSRKSGTFSS--ETFDDEVER 726
|
|
| ZFIN|ZDB-GENE-050208-36 cnnm2a "cyclin M2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H8M5 CNNM2 "Metal transporter CNNM2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2151054 Cnnm2 "cyclin M2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJ19 CNNM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1308162 Cnnm2 "cyclin M2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5U2P1 Cnnm2 "Metal transporter CNNM2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NRU3 CNNM1 "Metal transporter CNNM1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MD84 CNNM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 396 | |||
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 4e-32 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 1e-21 | |
| TIGR03520 | 408 | TIGR03520, GldE, gliding motility-associated prote | 4e-19 | |
| COG4536 | 423 | COG4536, CorB, Putative Mg2+ and Co2+ transporter | 9e-16 | |
| COG4535 | 293 | COG4535, CorC, Putative Mg2+ and Co2+ transporter | 2e-11 | |
| PRK15094 | 292 | PRK15094, PRK15094, magnesium/cobalt efflux protei | 2e-07 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Score = 125 bits (316), Expect = 4e-32
Identities = 54/171 (31%), Positives = 87/171 (50%), Gaps = 13/171 (7%)
Query: 26 LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYED 85
LE++E +I+ L+L + V ++MT D+ L ++ E + I++SG+SRIPVY+
Sbjct: 189 LEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESGHSRIPVYDG 247
Query: 86 RRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHM 145
NI+ + ++KDL D + FV E +L LL++F+E + HM
Sbjct: 248 DLDNIIGIVHVKDLLRALLDG--QSDLDLRVLVRPPLFVPETLSLSDLLEEFREE-RTHM 304
Query: 146 AFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTK 196
A V D + GL+TLED+IEE++ EI DE D + +
Sbjct: 305 AIVV--------DEYGGVEGLVTLEDIIEEIVG-EIPDEHDEDEEEDIIQR 346
|
Length = 429 |
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 396 | |||
| PRK11573 | 413 | hypothetical protein; Provisional | 100.0 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.98 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.97 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.97 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.97 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.96 | |
| KOG2118|consensus | 498 | 99.83 | ||
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.63 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.56 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.47 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.46 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.43 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.37 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.37 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.36 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.35 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.34 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.33 | |
| KOG2118|consensus | 498 | 99.32 | ||
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.32 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.32 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.3 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.29 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.29 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.29 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.28 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.27 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.26 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.26 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.26 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.25 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.25 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.25 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.24 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.24 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.24 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.24 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.24 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.24 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.22 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.22 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.22 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.22 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.22 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.21 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.2 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.2 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.2 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.2 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.2 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.2 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.19 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.19 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.19 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.18 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.17 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.17 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.17 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.17 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.16 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.16 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.15 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.14 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.14 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.14 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.14 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.14 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.14 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.14 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.13 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.13 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.13 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.13 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.12 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.12 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.12 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.1 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.09 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.09 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.09 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.08 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.08 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.07 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.04 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.03 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.03 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.01 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.01 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 98.97 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 98.92 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 98.55 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.54 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.49 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.42 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.41 | |
| KOG1764|consensus | 381 | 98.32 | ||
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 98.22 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 98.17 | |
| cd00038 | 115 | CAP_ED effector domain of the CAP family of transc | 98.13 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.11 | |
| smart00100 | 120 | cNMP Cyclic nucleotide-monophosphate binding domai | 98.07 | |
| COG0664 | 214 | Crp cAMP-binding proteins - catabolite gene activa | 98.0 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 97.97 | |
| KOG2550|consensus | 503 | 97.91 | ||
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.83 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 97.74 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 97.73 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 97.67 | |
| KOG0474|consensus | 762 | 97.64 | ||
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.62 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 97.57 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.54 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.54 | |
| PLN02868 | 413 | acyl-CoA thioesterase family protein | 97.47 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.45 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.44 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.43 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.42 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 97.41 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.36 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 97.32 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.23 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.21 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.2 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.19 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.18 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.14 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.14 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.12 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.12 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.12 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.12 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.12 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.1 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.1 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.08 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.08 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.04 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.04 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.03 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.03 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.02 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.01 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 96.99 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 96.98 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 96.96 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 96.96 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.95 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 96.94 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 96.94 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 96.91 | |
| KOG0475|consensus | 696 | 96.9 | ||
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 96.89 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.88 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 96.88 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 96.86 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 96.85 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 96.84 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 96.83 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 96.83 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 96.83 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 96.82 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 96.82 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 96.81 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 96.8 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 96.77 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.76 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 96.76 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 96.75 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 96.73 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 96.73 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 96.73 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 96.7 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 96.69 | |
| KOG1764|consensus | 381 | 96.69 | ||
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.64 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 96.63 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 96.57 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 96.55 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.5 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 96.5 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 96.49 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 96.44 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 96.41 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.38 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 96.38 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 96.38 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 96.32 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.27 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.26 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.24 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 96.24 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.12 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 95.99 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 95.99 | |
| KOG0498|consensus | 727 | 95.96 | ||
| KOG0614|consensus | 732 | 95.92 | ||
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 95.89 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 95.88 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 95.86 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 95.74 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 95.72 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 95.71 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 95.65 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 95.59 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 95.45 | |
| KOG1113|consensus | 368 | 95.23 | ||
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 94.84 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 94.75 | |
| PRK11832 | 207 | putative DNA-binding transcriptional regulator; Pr | 92.94 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 92.84 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 91.02 | |
| KOG1113|consensus | 368 | 90.41 | ||
| KOG2550|consensus | 503 | 90.07 | ||
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 88.64 | |
| KOG0614|consensus | 732 | 87.64 | ||
| PRK11573 | 413 | hypothetical protein; Provisional | 85.17 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 85.15 | |
| PF04831 | 153 | Popeye: Popeye protein conserved region; InterPro: | 84.93 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 80.91 |
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-32 Score=278.83 Aligned_cols=200 Identities=17% Similarity=0.325 Sum_probs=166.3
Q ss_pred CCCHHHHHHHHHccccccccccCCCCHHHHHHHHHHhcccccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEE
Q psy4847 2 CVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP 81 (396)
Q Consensus 2 ~~~~~Elk~ll~~~~~~~~~e~~~l~~~E~~~i~~alel~~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriP 81 (396)
.+|++||+.+++.+ .+ .++++|.+||.++|+|++++|+||||||.++++++.++++. ++++.+.++||||+|
T Consensus 153 ~~s~eEl~~lv~~~-----~~--~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~SR~P 224 (413)
T PRK11573 153 ALSKEELRTIVHES-----RS--QISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPHGRIV 224 (413)
T ss_pred CCCHHHHHHHHHHH-----hh--hcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCCceEE
Confidence 36899999999985 22 59999999999999999999999999999999999999999 999999999999999
Q ss_pred EEeCCCCcEEEEEEhhhhcccCCc-cccchhhhhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCC
Q psy4847 82 VYEDRRTNIVTMFYIKDLALVDPD-DNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPF 160 (396)
Q Consensus 82 V~~~~~~~IVGiL~vkDLl~~~~~-~~~~l~~v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~ 160 (396)
||+++.++|+|+|++|||+..... ...+..++.++ .+++.+||+++++.++|+.|+++ +.|||+|+ |||
T Consensus 225 Vy~~~~D~IiGiv~~kDll~~~~~~~~~~~~~l~~~-~r~~~~Vpe~~~l~~lL~~~~~~-~~~~AiVv--------DEy 294 (413)
T PRK11573 225 LYRDSLDDAISMLRVREAYRLMTEKKEFTKENMLRA-ADEIYFVPEGTPLSTQLVKFQRN-KKKVGLVV--------DEY 294 (413)
T ss_pred EEcCCCCceEEEEEHHHHHHHhhccCcCCHHHHHhh-ccCCeEeCCCCcHHHHHHHHHhc-CCeEEEEE--------ecC
Confidence 999888999999999999753221 22234445444 37899999999999999999995 99999999 999
Q ss_pred CceeeeecHHHHHHHHHhcccccccccccccccccccccCCCCCCccccchhccccccccccCchhhHHHHH-Hhhcccc
Q psy4847 161 YETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQ-FLSSNFY 239 (396)
Q Consensus 161 g~~vGIVTleDIiEeli~~eI~DE~D~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~is~q~~la~~~-~Ls~~~~ 239 (396)
|+++||||+|||+|+|+ |||.||+|...+.. +.+.+++.|.+++.+.+..++ .|....+
T Consensus 295 G~~~GiVTleDilEeiv-Gei~de~d~~~~~~-------------------i~~~~~~~~~v~G~~~l~d~~~~l~~~l~ 354 (413)
T PRK11573 295 GDIQGLVTVEDILEEIV-GDFTTSMSPTLAEE-------------------VTPQNDGSVIIDGTANVREINKAFNWHLP 354 (413)
T ss_pred CCeEEEeeHHHHHHHHh-CCCCcccCcccccc-------------------eEEecCCEEEEEeeeEHHHHHHHhCCCCC
Confidence 99999999999999999 89999987421110 223345678888888888765 3444443
|
|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118|consensus | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >KOG2118|consensus | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >smart00100 cNMP Cyclic nucleotide-monophosphate binding domain | Back alignment and domain information |
|---|
| >COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0474|consensus | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >PLN02868 acyl-CoA thioesterase family protein | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >KOG1113|consensus | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK11832 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG1113|consensus | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 396 | ||||
| 3jtf_A | 129 | The Cbs Domain Pair Structure Of A Magnesium And Co | 1e-06 | ||
| 3lfr_A | 136 | The Crystal Structure Of A Cbs Domain From A Putati | 7e-04 |
| >pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 | Back alignment and structure |
|
| >pdb|3LFR|A Chain A, The Crystal Structure Of A Cbs Domain From A Putative Metal Ion Transporter Bound To Amp From Pseudomonas Syringae To 1.55a Length = 136 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 396 | |||
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 1e-31 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 6e-31 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 2e-29 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 2e-27 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 3e-27 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 1e-26 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 6e-25 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 2e-24 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 5e-24 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 1e-23 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 |
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 | Back alignment and structure |
|---|
Score = 117 bits (295), Expect = 1e-31
Identities = 37/162 (22%), Positives = 68/162 (41%), Gaps = 16/162 (9%)
Query: 26 LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYED 85
+E +E ++ L + + +M D+ L + LD + +M+S +SR PV +
Sbjct: 25 IEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRFPVCRN 83
Query: 86 RRTNIVTMFYIKDL-ALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGH 144
++V + K L + + L L + +C FV + LL+ F+
Sbjct: 84 NVDDMVGIISAKQLLSESIAGERLELVDLVK----NCNFVPNSLSGMELLEHFRTT-GSQ 138
Query: 145 MAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETD 186
M FV D + + GL+TL+D+++ L E E
Sbjct: 139 MVFVV--------DEYGDLKGLVTLQDMMDALT-GEFFQEDG 171
|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 396 | |||
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.93 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.93 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.91 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.89 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.88 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.86 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.85 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.84 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.84 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.82 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.81 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.81 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.77 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.74 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.73 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.72 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.68 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.68 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.67 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.67 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.66 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.66 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.66 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.65 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.65 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.65 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.64 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.63 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.63 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.63 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.63 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.63 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.61 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.61 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.59 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.59 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.59 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.59 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.58 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.58 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.58 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.58 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.57 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.56 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.52 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.51 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.48 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.48 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.47 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.47 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.46 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.45 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.45 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.44 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.43 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.43 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.4 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.37 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.36 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.34 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.33 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.33 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.32 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.3 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.3 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.09 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.88 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.83 | |
| 3mdp_A | 142 | Cyclic nucleotide-binding domain (CNMP-BD) protei; | 98.61 | |
| 1wgp_A | 137 | Probable cyclic nucleotide-gated ION channel 6; cy | 98.56 | |
| 3idb_B | 161 | CAMP-dependent protein kinase type II-beta regulat | 98.54 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 98.53 | |
| 2z69_A | 154 | DNR protein; beta barrel, dimerization helix, tran | 98.48 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 98.47 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 98.44 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 98.41 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 98.37 | |
| 3gyd_A | 187 | CNMP-BD protein, cyclic nucleotide-binding domain; | 98.37 | |
| 2ptm_A | 198 | Hyperpolarization-activated (IH) channel; ION chan | 98.36 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 98.36 | |
| 1vp6_A | 138 | CNBD, cyclic-nucleotide binding domain of mesorhiz | 98.33 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 98.32 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 98.32 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 98.31 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 98.29 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 98.27 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 98.27 | |
| 3dn7_A | 194 | Cyclic nucleotide binding regulatory protein; stru | 98.26 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 98.26 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 98.25 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 98.25 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 98.24 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 98.24 | |
| 3ukn_A | 212 | Novel protein similar to vertebrate potassium VOL | 98.24 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 98.24 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 98.23 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 98.22 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 98.22 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 98.21 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 98.2 | |
| 3shr_A | 299 | CGMP-dependent protein kinase 1; cyclic nucleotide | 98.19 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 98.19 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 98.17 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 98.14 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.14 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 98.14 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.13 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.11 | |
| 4din_B | 381 | CAMP-dependent protein kinase type I-beta regulat | 98.1 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.07 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 98.06 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 98.05 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.05 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 98.04 | |
| 4f7z_A | 999 | RAP guanine nucleotide exchange factor 4; cyclic n | 98.04 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 98.0 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 97.94 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 97.91 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 97.88 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 97.88 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 97.87 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 97.87 | |
| 1o7f_A | 469 | CAMP-dependent RAP1 guanine-nucleotide exchange fa | 97.87 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 97.82 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 97.8 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 97.79 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 97.79 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 97.76 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 97.75 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 97.75 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 97.74 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 97.72 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 97.72 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 97.71 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 97.71 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 97.7 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 97.69 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 97.67 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 97.67 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 97.66 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 97.66 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 97.65 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 97.63 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 97.63 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 97.62 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 97.62 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 97.57 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 97.56 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 97.56 | |
| 3cf6_E | 694 | RAP guanine nucleotide exchange factor (GEF) 4; EP | 97.53 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 97.53 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.52 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 97.52 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 97.52 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 97.49 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 97.46 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.45 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 97.41 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 97.41 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 97.39 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 97.37 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 97.29 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 97.25 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.24 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 97.22 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 97.19 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.13 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.13 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 96.94 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 96.89 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 96.78 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 96.76 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.55 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.37 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 96.33 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.19 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.02 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 95.95 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 95.67 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 95.67 |
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
Probab=99.93 E-value=2.7e-26 Score=204.78 Aligned_cols=165 Identities=23% Similarity=0.408 Sum_probs=110.1
Q ss_pred CCCHHHHHHHHHccccccccccCCCCHHHHHHHHHHhcccccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEE
Q psy4847 2 CVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP 81 (396)
Q Consensus 2 ~~~~~Elk~ll~~~~~~~~~e~~~l~~~E~~~i~~alel~~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriP 81 (396)
.+|++||+.+++.+ .+.|.|+++|++++.+++.|.+.+|+++|+|+.+++++++++++. ++++.|.+++++++|
T Consensus 6 ~~t~~el~~l~~~~-----~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~v~-~a~~~m~~~~~~~~p 79 (172)
T 3lhh_A 6 NVTQEDIQAMLQEG-----SSAGVIEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRFP 79 (172)
T ss_dssp ------------------------------------------CTTTTSEEGGGCCCEETTSCHH-HHHHHHHTCCCSEEE
T ss_pred cCCHHHHHHHHHHH-----HHcCCCCHHHHHHHHHHhccCCCCHHHhCccHHHeEEEcCCCCHH-HHHHHHHhCCCCEEE
Confidence 36899999999986 678999999999999999999999999999988899999999999 999999999999999
Q ss_pred EEeCCCCcEEEEEEhhhhcccCCc-cccchhhhhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCC
Q psy4847 82 VYEDRRTNIVTMFYIKDLALVDPD-DNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPF 160 (396)
Q Consensus 82 V~~~~~~~IVGiL~vkDLl~~~~~-~~~~l~~v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~ 160 (396)
|++++.++++|+|+.+||+..... ...++.++| +++++|++++++.+++..|.+. +.+.++|+ |++
T Consensus 80 Vvd~~~~~lvGivt~~dl~~~~~~~~~~~v~~im----~~~~~v~~~~~l~~a~~~m~~~-~~~~~pVv--------d~~ 146 (172)
T 3lhh_A 80 VCRNNVDDMVGIISAKQLLSESIAGERLELVDLV----KNCNFVPNSLSGMELLEHFRTT-GSQMVFVV--------DEY 146 (172)
T ss_dssp EESSSTTSEEEEEEHHHHHHHHHTTCCCCGGGGC----BCCEEEETTCCHHHHHHHHHHH-TCSEEEEE--------CTT
T ss_pred EEeCCCCeEEEEEEHHHHHHHHhhcCcccHHHHh----cCCeEeCCCCCHHHHHHHHHHc-CCeEEEEE--------eCC
Confidence 997654799999999999864321 234566654 6889999999999999999995 78999998 888
Q ss_pred CceeeeecHHHHHHHHHhcccccccc
Q psy4847 161 YETVGLITLEDVIEELIQAEIMDETD 186 (396)
Q Consensus 161 g~~vGIVTleDIiEeli~~eI~DE~D 186 (396)
|+++||||++||+++++ ++|.||.|
T Consensus 147 g~lvGiit~~Dil~~l~-~~~~de~~ 171 (172)
T 3lhh_A 147 GDLKGLVTLQDMMDALT-GEFFQEDG 171 (172)
T ss_dssp SCEEEEEEHHHHHHHHH-TTCC----
T ss_pred CCEEEEeeHHHHHHHHh-CCCccccC
Confidence 99999999999999999 79999976
|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 396 | ||||
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 3e-09 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 2e-07 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 3e-07 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 3e-07 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 7e-07 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-06 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 1e-06 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 2e-05 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 2e-05 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 2e-05 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 4e-05 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 4e-05 | |
| d1yava3 | 132 | d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac | 8e-05 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-04 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 1e-04 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 2e-04 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 9e-04 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 0.001 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 0.003 |
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 53.3 bits (127), Expect = 3e-09
Identities = 16/153 (10%), Positives = 49/153 (32%), Gaps = 25/153 (16%)
Query: 40 LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDL 99
++ D++ + + + + ++ +G P+++ ++ + V M I D
Sbjct: 10 MKSHRCYDLIPTSSKLVVFDTSLQVK-KAFFALVTNGVRAAPLWDSKKQSFVGMLTITDF 68
Query: 100 --ALVDPDDNTPLKTLCQFYQNSC--------------YFVFEDTTLDVLLKQFKEGIKG 143
L + ++ + + +L + K
Sbjct: 69 INILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRN-KI 127
Query: 144 HMAFVHRVNNEGEGDPFYETVGLITLEDVIEEL 176
H V ++ E T+ ++T + +++ L
Sbjct: 128 HRLPV--IDPESG-----NTLYILTHKRILKFL 153
|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 396 | |||
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.77 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.72 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.7 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.7 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.69 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.68 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.68 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.66 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.66 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.64 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.64 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.63 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.63 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.63 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.63 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.6 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.6 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.6 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.59 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.58 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.58 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.57 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.56 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.54 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.53 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.43 | |
| d1o7fa3 | 124 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 98.77 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 98.76 | |
| d1cx4a1 | 136 | Regulatory subunit of Protein kinase A {Rat (Rattu | 98.72 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 98.69 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 98.69 | |
| d1o5la1 | 129 | CRP-like transcriptional regulator TM1171, N-termi | 98.64 | |
| d1wgpa_ | 137 | Probable cyclic nucleotide-gated ion channel 6 {Th | 98.59 | |
| d1o7fa2 | 155 | Regulatory domain of Epac2, domains 1 and 3 {Mouse | 98.56 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 98.49 | |
| d1ne6a2 | 132 | Regulatory subunit of Protein kinase A {Cow (Bos t | 98.47 | |
| d2gaua2 | 142 | Transcriptional regulator PG0396, N-terminal domai | 98.46 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 98.42 | |
| d1zyba2 | 147 | Probable transcription regulator BT4300, N-termina | 98.36 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 98.34 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 98.23 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.13 | |
| d3e5ua2 | 139 | Chlorophenol reduction protein CprK {Desulfitobact | 98.11 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 98.1 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.0 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 97.99 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 97.96 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 97.93 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 97.9 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 97.87 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 97.82 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 97.81 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 97.78 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 97.78 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 97.73 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 97.72 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 97.63 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 97.6 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.58 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 97.52 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 97.5 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 97.44 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.41 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 97.37 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 97.35 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 97.2 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.03 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 96.99 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 96.59 |
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Hypothetical protein YkuL species: Bacillus subtilis [TaxId: 1423]
Probab=99.77 E-value=4.9e-19 Score=149.56 Aligned_cols=121 Identities=15% Similarity=0.160 Sum_probs=102.5
Q ss_pred ccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEEEEeCCCCcEEEEEEhhhhccc--CC-------ccccchhh
Q psy4847 42 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALV--DP-------DDNTPLKT 112 (396)
Q Consensus 42 ~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriPV~~~~~~~IVGiL~vkDLl~~--~~-------~~~~~l~~ 112 (396)
++||+++|+|.+++.+++.++++. ++++.|.++||+++||++++ ++++|+|+.+|++.. .. ....++++
T Consensus 1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s~~pVvd~~-~~~vGiit~~di~~~~~~~~~~~~~~~~~~~v~~ 78 (132)
T d1yava3 1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYTAIPVLDPS-YRLHGLIGTNMIMNSIFGLERIEFEKLDQITVEE 78 (132)
T ss_dssp TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCSEEEEECTT-CBEEEEEEHHHHHHHHBCSSSBCGGGTTTSBHHH
T ss_pred CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCCceEEeecc-cccccEEEcchhHHHhhccccccccccccccccc
Confidence 578999999999999999999999 99999999999999999876 899999999999732 11 01234444
Q ss_pred hhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCCCceeeeecHHHHHHHHHh
Q psy4847 113 LCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQ 178 (396)
Q Consensus 113 v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~g~~vGIVTleDIiEeli~ 178 (396)
+ |.++++++.+++++.+++..|.++ ++++|+ |++|+++||||.+||+++|.+
T Consensus 79 ~---m~~~~~~v~~~~~l~~~~~~~~~~---~~l~Vv--------d~~~~~~Givt~~dil~~l~~ 130 (132)
T d1yava3 79 V---MLTDIPRLHINDPIMKGFGMVINN---GFVCVE--------NDEQVFEGIFTRRVVLKELNK 130 (132)
T ss_dssp H---SBCSCCEEETTSBHHHHHHHTTTC---SEEEEE--------CTTCBEEEEEEHHHHHHHHHH
T ss_pred c---ccccccccccchhHHHHHHHHHhC---CEEEEE--------ccCCEEEEEEEHHHHHHHHHh
Confidence 4 468999999999999999999873 346666 889999999999999999863
|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|