Psyllid ID: psy4847


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MCVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLMEKSKKSEESMSAGDQFEDEVEKCH
ccccHHHHHHHHcccccccccccccccHHHHHHHHHcccccccEEccccEEcccEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEHHccccccccccccHHHHHHccccccEEcccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccHHcccHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccEEEEEEcHHHHHHHHHHHHHHHccccccccccccccccHHHHcc
cccccccHcHEEEHHHHccccccccccHHHHHHHHHHHHHHHccHHHHcccHHHEEEEcccccccHHHHHHHHHccccccEEEccccccHHHEEEHHHHHcccccccccHHHHHHHccccEEEEcccccHHHHHHHHHcccccEEEEEEEEcccccccccHEEEEEEEHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccccEEEcHHHHHHHHHHcccccccHHHHHHHHcccccEEccccHHHHEccccccEEEEEEEEEEEEEEcccccEEcccccEEccHHHHccccccccccccccccccccccccccccccccccccEccccEEEEEccEEEEEEcHHHHHHHHHHHHHccccccccccccccccccccHHcc
mcvhpqglrsfirvrdhdvttefndleKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSgysripvyedrrtNIVTMFYIKDlalvdpddntplktlcqfyqnscyfvfedTTLDVLLKQFKEGIKGHMAFVHRVnnegegdpfyeTVGLITLEDVIEELIQAEImdetdvwtdnqhktkrhkqsshrgqdftlfaekseaqrihispqlnlatFQFLSSNFYVGSLLDRItqkgtsqqkptfkslkkrnkpvDYFVLILEGRAevvvgkenlvyeagpfsyfgCQALTqnigiaesptnnssaaqayggslqsvnldsilrytfvpdysvraTTEMFYVKIRRSFYLAAKRATLMEKSKkseesmsagdqFEDEVEKCH
mcvhpqglrsfirvrdhdvttefndlekdevniisgalelrrKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKsgysripvyedrrTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHktkrhkqsshrgqdFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITqkgtsqqkptfkslkkrnkpVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLMekskkseesmsagdqfedevekch
MCVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLMekskkseesMSAGDQFEDEVEKCH
*******LRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQF*********************PFYETVGLITLEDVIEELIQAEIMDETDVWT*********************F******QRIHISPQLNLATFQFLSSNFYVGSLLDRIT******************KPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIA************YGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKR****************************
*CVHPQGLRSFIRV*************KDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEG*G*PFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAE**********EAGPFSYFGCQALTQN*********************************FVPDYSVRATTEMFYVKIRRSFYLAA******************************
MCVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWT***************GQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRIT**************KKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATL*************************
MCVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTD***************QDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQN******************************RYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLME***********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGSLLDRITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLMEKSKKSEESMSAGDQFEDEVEKCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q9H8M5875 Metal transporter CNNM2 O yes N/A 0.909 0.411 0.454 1e-90
Q5U2P1875 Metal transporter CNNM2 O yes N/A 0.909 0.411 0.451 4e-90
Q3TWN3875 Metal transporter CNNM2 O yes N/A 0.909 0.411 0.451 4e-90
Q6P4Q7775 Metal transporter CNNM4 O no N/A 0.886 0.452 0.456 6e-87
Q69ZF7771 Metal transporter CNNM4 O no N/A 0.888 0.456 0.446 4e-85
P0C588772 Metal transporter CNNM4 O no N/A 0.888 0.455 0.441 2e-84
A0JPA0769 Metal transporter CNNM4 O yes N/A 0.906 0.466 0.441 6e-84
Q32NY4713 Metal transporter CNNM3 O no N/A 0.851 0.472 0.440 2e-76
Q9NRU3 951 Metal transporter CNNM1 O no N/A 0.909 0.378 0.437 9e-76
Q8NE01707 Metal transporter CNNM3 O no N/A 0.851 0.476 0.443 1e-75
>sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 Back     alignment and function desciption
 Score =  333 bits (855), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 257/414 (62%), Gaps = 54/414 (13%)

Query: 19  VTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYS 78
           VT  +NDL K+E+NII GALELR K V DVMT L D +M++ +AILDF T+SEIM+SGY+
Sbjct: 420 VTDPYNDLVKEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYT 479

Query: 79  RIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFK 138
           RIPV+E  R+NIV + ++KDLA VDPDD TPLKT+ +FY +  +FVF DT LD +L++FK
Sbjct: 480 RIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFK 539

Query: 139 EGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRH 198
           +G K H+A V RVNNEGEGDPFYE +G++TLEDVIEE+I++EI+DETD++TDN  +TK+ 
Sbjct: 540 KG-KSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSEILDETDLYTDN--RTKKK 596

Query: 199 KQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSSNFYVGS-------LLDRITQKG 251
                R QDF+ F +     ++ ISPQL LA  +FL++     S       +L R+ +  
Sbjct: 597 VAHRERKQDFSAFKQTDSEMKVKISPQLLLAMHRFLATEVEAFSPSQMSEKILLRLLKHP 656

Query: 252 TSQQKPTFKS---------LKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQ 302
              Q+  +           L +RNKPVDYFVLIL+G+ EV  GKE + +EA  FSY+G  
Sbjct: 657 NVIQELKYDEKNKKAPEYYLYQRNKPVDYFVLILQGKVEVEAGKEGMKFEASAFSYYGVM 716

Query: 303 ALTQN----------------IGIAESPTNNSSAAQAYG-----------------GSLQ 329
           ALT +                +  A SP  N S  +  G                  +L 
Sbjct: 717 ALTASPVPLSLSRTFVVSRTELLAAGSPGENKSPPRPCGLNHSDSLSRSDRIDAVTPTLG 776

Query: 330 SVN--LDSILRYTFVPDYSVRATTEMFYVKIRRSFYLAAKRATLMEKSKKSEES 381
           S N  L+S L   ++PDYSVRA +++ +VKI R  Y  A  A+ M+K+ +S +S
Sbjct: 777 SSNNQLNSSLLQVYIPDYSVRALSDLQFVKISRQQYQNALMASRMDKTPQSSDS 830




Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+).
Homo sapiens (taxid: 9606)
>sp|Q5U2P1|CNNM2_RAT Metal transporter CNNM2 OS=Rattus norvegicus GN=Cnnm2 PE=2 SV=1 Back     alignment and function description
>sp|Q3TWN3|CNNM2_MOUSE Metal transporter CNNM2 OS=Mus musculus GN=Cnnm2 PE=1 SV=3 Back     alignment and function description
>sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3 Back     alignment and function description
>sp|Q69ZF7|CNNM4_MOUSE Metal transporter CNNM4 OS=Mus musculus GN=Cnnm4 PE=1 SV=2 Back     alignment and function description
>sp|P0C588|CNNM4_RAT Metal transporter CNNM4 OS=Rattus norvegicus GN=Cnnm4 PE=1 SV=1 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description
>sp|Q32NY4|CNNM3_MOUSE Metal transporter CNNM3 OS=Mus musculus GN=Cnnm3 PE=1 SV=2 Back     alignment and function description
>sp|Q9NRU3|CNNM1_HUMAN Metal transporter CNNM1 OS=Homo sapiens GN=CNNM1 PE=2 SV=3 Back     alignment and function description
>sp|Q8NE01|CNNM3_HUMAN Metal transporter CNNM3 OS=Homo sapiens GN=CNNM3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
328720335 986 PREDICTED: metal transporter CNNM2-like 0.929 0.373 0.706 1e-153
328720337 950 PREDICTED: metal transporter CNNM2-like 0.929 0.387 0.706 1e-153
328720333 931 PREDICTED: metal transporter CNNM2-like 0.929 0.395 0.706 1e-153
328783660 945 PREDICTED: metal transporter CNNM2-like 0.931 0.390 0.676 1e-149
380016390 985 PREDICTED: LOW QUALITY PROTEIN: metal tr 0.931 0.374 0.676 1e-149
350403868 950 PREDICTED: metal transporter CNNM2-like 0.931 0.388 0.677 1e-147
383860842 944 PREDICTED: metal transporter CNNM2-like 0.934 0.391 0.674 1e-147
332022207 999 Metal transporter CNNM2 [Acromyrmex echi 0.934 0.370 0.676 1e-146
307177469 1003 Metal transporter CNNM2 [Camponotus flor 0.931 0.367 0.672 1e-146
307209414 1012 Metal transporter CNNM2 [Harpegnathos sa 0.934 0.365 0.659 1e-144
>gi|328720335|ref|XP_001945496.2| PREDICTED: metal transporter CNNM2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 279/395 (70%), Positives = 319/395 (80%), Gaps = 27/395 (6%)

Query: 22  EFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP 81
           E+NDLEKDEVNIISGALEL RK VGDVMTKLEDVYMLSYD ILDFETVSEIMKSGYSRIP
Sbjct: 507 EYNDLEKDEVNIISGALELHRKKVGDVMTKLEDVYMLSYDTILDFETVSEIMKSGYSRIP 566

Query: 82  VYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGI 141
           VYE  R NIVTM YIKDLALVDPDDNT LKTLCQFYQN CYFVFEDTTLDVL KQFKEGI
Sbjct: 567 VYEGNRQNIVTMLYIKDLALVDPDDNTLLKTLCQFYQNPCYFVFEDTTLDVLFKQFKEGI 626

Query: 142 KGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQS 201
           KGHMAFVHRVNNEGEGDPFYETVG+ITLEDVIEELIQAEIMDETDV+TDN+ K +R +Q 
Sbjct: 627 KGHMAFVHRVNNEGEGDPFYETVGIITLEDVIEELIQAEIMDETDVYTDNRSK-QRRQQR 685

Query: 202 SHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLSS-------NFYVGSLLDRITQKGT-- 252
           S R QDFT FAE+S+ QRIHISPQL LATFQFLSS       +    ++L R+ ++    
Sbjct: 686 SLRTQDFTAFAERSDNQRIHISPQLTLATFQFLSSSVEAFKTDVVSETILMRLLKQDVIF 745

Query: 253 ---SQQKPTFKS-----LKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQAL 304
               + K  FKS     + ++ KPVDYFVLILEGR EV VG+ENLV+E+GPF+YFG QAL
Sbjct: 746 HIKMKDKERFKSDPASIIYQQGKPVDYFVLILEGRVEVTVGRENLVFESGPFTYFGSQAL 805

Query: 305 TQNIGIAESPTNNSSAAQAYG-----GSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIR 359
            QNIGI ESP + ++   A       GS+QSVN+D++LRYTFVPDYSVRA TE+ Y++++
Sbjct: 806 HQNIGIGESPPSGANPTMANSTVNNMGSIQSVNIDAMLRYTFVPDYSVRAVTEVMYLRVK 865

Query: 360 RSFYLAAKRATLMEKSKKSEESMSAGDQFEDEVEK 394
           RSFY+AAKRATLME+SKK    MS   +F++EV+K
Sbjct: 866 RSFYMAAKRATLMERSKK----MSNAGEFDEEVDK 896




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328720337|ref|XP_003247005.1| PREDICTED: metal transporter CNNM2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328720333|ref|XP_003247004.1| PREDICTED: metal transporter CNNM2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328783660|ref|XP_625178.3| PREDICTED: metal transporter CNNM2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016390|ref|XP_003692168.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter CNNM2-like [Apis florea] Back     alignment and taxonomy information
>gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383860842|ref|XP_003705897.1| PREDICTED: metal transporter CNNM2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332022207|gb|EGI62522.1| Metal transporter CNNM2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307177469|gb|EFN66596.1| Metal transporter CNNM2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307209414|gb|EFN86431.1| Metal transporter CNNM2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
FB|FBgn0262124 834 uex "unextended" [Drosophila m 0.911 0.432 0.579 3.8e-110
ZFIN|ZDB-GENE-050208-36811 cnnm2a "cyclin M2a" [Danio rer 0.772 0.377 0.509 1.2e-85
UNIPROTKB|Q9H8M5875 CNNM2 "Metal transporter CNNM2 0.714 0.323 0.529 1.1e-82
MGI|MGI:2151054875 Cnnm2 "cyclin M2" [Mus musculu 0.714 0.323 0.529 3.6e-82
UNIPROTKB|E2RJ19875 CNNM2 "Uncharacterized protein 0.714 0.323 0.529 4.5e-82
RGD|1308162875 Cnnm2 "cyclin M2" [Rattus norv 0.714 0.323 0.529 4.5e-82
UNIPROTKB|Q5U2P1875 Cnnm2 "Metal transporter CNNM2 0.714 0.323 0.529 4.5e-82
UNIPROTKB|F1ND49598 CNNM2 "Uncharacterized protein 0.717 0.474 0.524 4.5e-82
UNIPROTKB|Q9NRU3 951 CNNM1 "Metal transporter CNNM1 0.707 0.294 0.511 1.5e-77
UNIPROTKB|F1MD84 941 CNNM1 "Uncharacterized protein 0.707 0.297 0.508 6.6e-77
FB|FBgn0262124 uex "unextended" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1088 (388.1 bits), Expect = 3.8e-110, P = 3.8e-110
 Identities = 227/392 (57%), Positives = 285/392 (72%)

Query:    19 VTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYS 78
             VT + NDL+K+EVNIISGALELR+K V DVMT + D +MLS DA+LDFETVSEIM SGYS
Sbjct:   350 VTNDVNDLDKNEVNIISGALELRKKTVADVMTHINDAFMLSLDALLDFETVSEIMNSGYS 409

Query:    79 RIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFK 138
             RIPVY+  R NIVT+ YIKDLA VD DDNTPLKTLC+FYQN  +FVFED TLD++  QFK
Sbjct:   410 RIPVYDGDRKNIVTLLYIKDLAFVDTDDNTPLKTLCEFYQNPVHFVFEDYTLDIMFNQFK 469

Query:   139 EGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRH 198
             EG  GH+AFVHRVNNEG+GDPFYETVGL+TLEDVIEELIQAEI+DETDV+ DN+ KT+R+
Sbjct:   470 EGTIGHIAFVHRVNNEGDGDPFYETVGLVTLEDVIEELIQAEIVDETDVFVDNRTKTRRN 529

Query:   199 KQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQFLS-----------SNFYVGSLLDR- 246
             +   ++  DF+ FAE+ E Q + ISPQL LATFQ+LS           S   +  LL++ 
Sbjct:   530 R---YKKADFSAFAERREVQTVRISPQLTLATFQYLSTAVDAFKKDVISELILRRLLNQD 586

Query:   247 ----ITQKGTSQQKPTFKSLKKRNKPVDYFVLILEGRAEVVVGKENLVYEAGPFSYFGCQ 302
                 I  KG S+  P+   +  + K VD+FVLILEGR EV +GKE L++E+GPF+YFG Q
Sbjct:   587 VFHNIKTKGKSKDDPSLY-IFTQGKAVDFFVLILEGRVEVTIGKEALMFESGPFTYFGTQ 645

Query:   303 ALTQNIGIAESPTNNSSAAQAYGGSLQSVNLDSILRYTFVPDYSVRATTEMFYVKIRRSF 362
             AL  N+ + +SPT          GSLQS+N+DS +R +FVPDYSVRA +++ Y+ I+R  
Sbjct:   646 ALVPNV-VIDSPTQM--------GSLQSLNMDSKIRQSFVPDYSVRAISDVIYITIKRVL 696

Query:   363 YLAAKRATLMXXXXXXXXXMSAGDQFEDEVEK 394
             YL AK+ATL+          S  + F+DEVE+
Sbjct:   697 YLTAKKATLLEKSRKSGTFSS--ETFDDEVER 726




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006873 "cellular ion homeostasis" evidence=ISS
ZFIN|ZDB-GENE-050208-36 cnnm2a "cyclin M2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H8M5 CNNM2 "Metal transporter CNNM2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2151054 Cnnm2 "cyclin M2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ19 CNNM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308162 Cnnm2 "cyclin M2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5U2P1 Cnnm2 "Metal transporter CNNM2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NRU3 CNNM1 "Metal transporter CNNM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD84 CNNM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
COG1253429 COG1253, TlyC, Hemolysins and related proteins con 4e-32
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain 1e-21
TIGR03520408 TIGR03520, GldE, gliding motility-associated prote 4e-19
COG4536423 COG4536, CorB, Putative Mg2+ and Co2+ transporter 9e-16
COG4535293 COG4535, CorC, Putative Mg2+ and Co2+ transporter 2e-11
PRK15094292 PRK15094, PRK15094, magnesium/cobalt efflux protei 2e-07
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
 Score =  125 bits (316), Expect = 4e-32
 Identities = 54/171 (31%), Positives = 87/171 (50%), Gaps = 13/171 (7%)

Query: 26  LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYED 85
           LE++E  +I+  L+L  + V ++MT   D+  L     ++ E +  I++SG+SRIPVY+ 
Sbjct: 189 LEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESGHSRIPVYDG 247

Query: 86  RRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHM 145
              NI+ + ++KDL     D         +       FV E  +L  LL++F+E  + HM
Sbjct: 248 DLDNIIGIVHVKDLLRALLDG--QSDLDLRVLVRPPLFVPETLSLSDLLEEFREE-RTHM 304

Query: 146 AFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTK 196
           A V         D +    GL+TLED+IEE++  EI DE D   +     +
Sbjct: 305 AIVV--------DEYGGVEGLVTLEDIIEEIVG-EIPDEHDEDEEEDIIQR 346


Length = 429

>gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE Back     alignment and domain information
>gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
PRK11573413 hypothetical protein; Provisional 100.0
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.98
COG1253429 TlyC Hemolysins and related proteins containing CB 99.97
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.97
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.97
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.96
KOG2118|consensus498 99.83
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 99.63
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.56
COG2524294 Predicted transcriptional regulator, contains C-te 99.47
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.46
COG4109432 Predicted transcriptional regulator containing CBS 99.43
COG3620187 Predicted transcriptional regulator with C-termina 99.37
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.37
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.36
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.35
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.34
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.33
KOG2118|consensus498 99.32
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.32
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.32
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.3
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.29
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.29
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.29
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.28
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.27
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.26
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.26
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.26
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.25
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.25
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.25
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.24
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.24
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.24
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.24
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.24
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.24
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.22
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.22
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.22
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.22
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.22
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.21
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.2
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.2
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 99.2
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.2
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.2
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.2
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.19
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.19
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.19
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.18
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.17
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.17
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.17
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.17
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.16
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.16
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.15
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.14
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.14
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.14
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.14
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.14
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.14
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.14
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.13
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.13
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.13
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.13
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.12
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.12
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.12
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.1
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.09
PLN02274505 inosine-5'-monophosphate dehydrogenase 99.09
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.09
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.08
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 99.08
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.07
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.04
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.03
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.03
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.01
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.01
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 98.97
COG0517117 FOG: CBS domain [General function prediction only] 98.92
COG2905 610 Predicted signal-transduction protein containing c 98.55
PRK14869546 putative manganese-dependent inorganic pyrophospha 98.54
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.49
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.42
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.41
KOG1764|consensus381 98.32
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 98.22
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 98.17
cd00038115 CAP_ED effector domain of the CAP family of transc 98.13
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.11
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 98.07
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 98.0
PRK09392236 ftrB transcriptional activator FtrB; Provisional 97.97
KOG2550|consensus503 97.91
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 97.83
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 97.74
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 97.73
PRK11161235 fumarate/nitrate reduction transcriptional regulat 97.67
KOG0474|consensus762 97.64
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 97.62
PLN03192 823 Voltage-dependent potassium channel; Provisional 97.57
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 97.54
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.54
PLN02868 413 acyl-CoA thioesterase family protein 97.47
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.45
TIGR00400449 mgtE Mg2+ transporter (mgtE). This family of proka 97.44
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 97.43
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.42
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 97.41
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 97.36
PRK09391230 fixK transcriptional regulator FixK; Provisional 97.32
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 97.23
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 97.21
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 97.2
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.19
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.18
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 97.14
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.14
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.12
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 97.12
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 97.12
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 97.12
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.12
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 97.1
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 97.1
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 97.08
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 97.08
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 97.04
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 97.04
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.03
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 97.03
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 97.02
PRK14869546 putative manganese-dependent inorganic pyrophospha 97.01
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 96.99
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 96.98
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 96.96
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 96.96
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 96.95
COG2524294 Predicted transcriptional regulator, contains C-te 96.94
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 96.94
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 96.91
KOG0475|consensus696 96.9
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 96.89
PLN02274505 inosine-5'-monophosphate dehydrogenase 96.88
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 96.88
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 96.86
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 96.85
COG0517117 FOG: CBS domain [General function prediction only] 96.84
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 96.83
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 96.83
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 96.83
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 96.82
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 96.82
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 96.81
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 96.8
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 96.77
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 96.76
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 96.76
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 96.75
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 96.73
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 96.73
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 96.73
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 96.7
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 96.69
KOG1764|consensus381 96.69
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.64
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 96.63
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 96.57
COG3448382 CBS-domain-containing membrane protein [Signal tra 96.55
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 96.5
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 96.5
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 96.49
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 96.44
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 96.41
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.38
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 96.38
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.38
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 96.32
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.27
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 96.26
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.24
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 96.24
COG2905610 Predicted signal-transduction protein containing c 96.12
cd02205113 CBS_pair The CBS domain, named after human CBS, is 95.99
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 95.99
KOG0498|consensus 727 95.96
KOG0614|consensus 732 95.92
COG4175386 ProV ABC-type proline/glycine betaine transport sy 95.89
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 95.88
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 95.86
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 95.74
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.72
PRK01862574 putative voltage-gated ClC-type chloride channel C 95.71
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 95.65
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 95.59
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 95.45
KOG1113|consensus368 95.23
COG3620187 Predicted transcriptional regulator with C-termina 94.84
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 94.75
PRK11832207 putative DNA-binding transcriptional regulator; Pr 92.94
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 92.84
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 91.02
KOG1113|consensus368 90.41
KOG2550|consensus503 90.07
COG4109432 Predicted transcriptional regulator containing CBS 88.64
KOG0614|consensus 732 87.64
PRK11573413 hypothetical protein; Provisional 85.17
PRK10070400 glycine betaine transporter ATP-binding subunit; P 85.15
PF04831153 Popeye: Popeye protein conserved region; InterPro: 84.93
COG1253429 TlyC Hemolysins and related proteins containing CB 80.91
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-32  Score=278.83  Aligned_cols=200  Identities=17%  Similarity=0.325  Sum_probs=166.3

Q ss_pred             CCCHHHHHHHHHccccccccccCCCCHHHHHHHHHHhcccccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEE
Q psy4847           2 CVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP   81 (396)
Q Consensus         2 ~~~~~Elk~ll~~~~~~~~~e~~~l~~~E~~~i~~alel~~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriP   81 (396)
                      .+|++||+.+++.+     .+  .++++|.+||.++|+|++++|+||||||.++++++.++++. ++++.+.++||||+|
T Consensus       153 ~~s~eEl~~lv~~~-----~~--~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~SR~P  224 (413)
T PRK11573        153 ALSKEELRTIVHES-----RS--QISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPHGRIV  224 (413)
T ss_pred             CCCHHHHHHHHHHH-----hh--hcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCCceEE
Confidence            36899999999985     22  59999999999999999999999999999999999999999 999999999999999


Q ss_pred             EEeCCCCcEEEEEEhhhhcccCCc-cccchhhhhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCC
Q psy4847          82 VYEDRRTNIVTMFYIKDLALVDPD-DNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPF  160 (396)
Q Consensus        82 V~~~~~~~IVGiL~vkDLl~~~~~-~~~~l~~v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~  160 (396)
                      ||+++.++|+|+|++|||+..... ...+..++.++ .+++.+||+++++.++|+.|+++ +.|||+|+        |||
T Consensus       225 Vy~~~~D~IiGiv~~kDll~~~~~~~~~~~~~l~~~-~r~~~~Vpe~~~l~~lL~~~~~~-~~~~AiVv--------DEy  294 (413)
T PRK11573        225 LYRDSLDDAISMLRVREAYRLMTEKKEFTKENMLRA-ADEIYFVPEGTPLSTQLVKFQRN-KKKVGLVV--------DEY  294 (413)
T ss_pred             EEcCCCCceEEEEEHHHHHHHhhccCcCCHHHHHhh-ccCCeEeCCCCcHHHHHHHHHhc-CCeEEEEE--------ecC
Confidence            999888999999999999753221 22234445444 37899999999999999999995 99999999        999


Q ss_pred             CceeeeecHHHHHHHHHhcccccccccccccccccccccCCCCCCccccchhccccccccccCchhhHHHHH-Hhhcccc
Q psy4847         161 YETVGLITLEDVIEELIQAEIMDETDVWTDNQHKTKRHKQSSHRGQDFTLFAEKSEAQRIHISPQLNLATFQ-FLSSNFY  239 (396)
Q Consensus       161 g~~vGIVTleDIiEeli~~eI~DE~D~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~is~q~~la~~~-~Ls~~~~  239 (396)
                      |+++||||+|||+|+|+ |||.||+|...+..                   +.+.+++.|.+++.+.+..++ .|....+
T Consensus       295 G~~~GiVTleDilEeiv-Gei~de~d~~~~~~-------------------i~~~~~~~~~v~G~~~l~d~~~~l~~~l~  354 (413)
T PRK11573        295 GDIQGLVTVEDILEEIV-GDFTTSMSPTLAEE-------------------VTPQNDGSVIIDGTANVREINKAFNWHLP  354 (413)
T ss_pred             CCeEEEeeHHHHHHHHh-CCCCcccCcccccc-------------------eEEecCCEEEEEeeeEHHHHHHHhCCCCC
Confidence            99999999999999999 89999987421110                   223345678888888888765 3444443



>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2118|consensus Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>KOG2118|consensus Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>KOG1764|consensus Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0474|consensus Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>KOG0475|consensus Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>KOG1764|consensus Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
3jtf_A129 The Cbs Domain Pair Structure Of A Magnesium And Co 1e-06
3lfr_A136 The Crystal Structure Of A Cbs Domain From A Putati 7e-04
>pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 1e-06, Method: Composition-based stats. Identities = 33/111 (29%), Positives = 61/111 (54%), Gaps = 13/111 (11%) Query: 67 ETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALVDPDDNTPLKTLCQFYQNSCYFVFE 126 + ++ I+++ +SR PVYED R NI+ + KDL + +++L + F+ E Sbjct: 28 QLLATIIETAHSRFPVYEDDRDNIIGILLAKDLLRYXLEPALDIRSLVR----PAVFIPE 83 Query: 127 DTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELI 177 L+VLL++F+ + H+A V ++ G GL+T EDV+E+++ Sbjct: 84 VKRLNVLLREFRAS-RNHLAIV--IDEHG------GISGLVTXEDVLEQIV 125
>pdb|3LFR|A Chain A, The Crystal Structure Of A Cbs Domain From A Putative Metal Ion Transporter Bound To Amp From Pseudomonas Syringae To 1.55a Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 1e-31
3ocm_A173 Putative membrane protein; structural genomics, PS 6e-31
3oco_A153 Hemolysin-like protein containing CBS domains; str 2e-29
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 2e-27
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 3e-27
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 1e-26
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 6e-25
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 2e-24
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 5e-24
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 1e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 Back     alignment and structure
 Score =  117 bits (295), Expect = 1e-31
 Identities = 37/162 (22%), Positives = 68/162 (41%), Gaps = 16/162 (9%)

Query: 26  LEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYED 85
           +E +E  ++     L  + +  +M    D+  L  +  LD   +  +M+S +SR PV  +
Sbjct: 25  IEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRFPVCRN 83

Query: 86  RRTNIVTMFYIKDL-ALVDPDDNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGH 144
              ++V +   K L +     +   L  L +    +C FV    +   LL+ F+      
Sbjct: 84  NVDDMVGIISAKQLLSESIAGERLELVDLVK----NCNFVPNSLSGMELLEHFRTT-GSQ 138

Query: 145 MAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQAEIMDETD 186
           M FV         D + +  GL+TL+D+++ L   E   E  
Sbjct: 139 MVFVV--------DEYGDLKGLVTLQDMMDALT-GEFFQEDG 171


>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.93
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.93
3ocm_A173 Putative membrane protein; structural genomics, PS 99.91
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.89
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.88
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.86
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.85
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.84
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.84
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.82
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.81
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.81
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.77
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 99.74
4esy_A170 CBS domain containing membrane protein; structural 99.73
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.72
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.68
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.68
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.67
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.67
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.66
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.66
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.66
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.65
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.65
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.65
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.64
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.63
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.63
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.63
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.63
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.63
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.61
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.61
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.59
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.59
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.59
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.59
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.58
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.58
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.58
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.58
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.57
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.56
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.52
3ddj_A296 CBS domain-containing protein; structural genomics 99.51
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.48
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.48
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.47
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 99.47
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.46
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 99.45
3ddj_A296 CBS domain-containing protein; structural genomics 99.45
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.44
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.43
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.43
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.4
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.37
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.36
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 99.34
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.33
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.33
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.32
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.3
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.3
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.09
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.88
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.83
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 98.61
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 98.56
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 98.54
2pqq_A149 Putative transcriptional regulator; APC7345, strep 98.53
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 98.48
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 98.47
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 98.44
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 98.41
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 98.37
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 98.37
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 98.36
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 98.36
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 98.33
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 98.32
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 98.32
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 98.31
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 98.29
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 98.27
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 98.27
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 98.26
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 98.26
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 98.25
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 98.25
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 98.24
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 98.24
3ukn_A212 Novel protein similar to vertebrate potassium VOL 98.24
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 98.24
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 98.23
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 98.22
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 98.22
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 98.21
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 98.2
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 98.19
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 98.19
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.17
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 98.14
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.14
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 98.14
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 98.13
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.11
4din_B381 CAMP-dependent protein kinase type I-beta regulat 98.1
3fio_A70 A cystathionine beta-synthase domain protein fused 98.07
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 98.06
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 98.05
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.05
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 98.04
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.04
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 98.0
4esy_A170 CBS domain containing membrane protein; structural 97.94
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 97.91
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 97.88
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 97.88
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 97.87
3b02_A195 Transcriptional regulator, CRP family; structural 97.87
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 97.87
1pbj_A125 Hypothetical protein; structural genomics, domain, 97.82
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 97.8
3fio_A70 A cystathionine beta-synthase domain protein fused 97.79
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 97.79
1ft9_A222 Carbon monoxide oxidation system transcription reg 97.76
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.75
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 97.75
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 97.74
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 97.72
1pvm_A184 Conserved hypothetical protein TA0289; structural 97.72
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 97.71
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 97.71
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 97.7
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 97.69
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 97.67
3oco_A153 Hemolysin-like protein containing CBS domains; str 97.67
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 97.66
1o50_A157 CBS domain-containing predicted protein TM0935; CB 97.66
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 97.65
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 97.63
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 97.63
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 97.62
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.62
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.57
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 97.56
2o16_A160 Acetoin utilization protein ACUB, putative; struct 97.56
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 97.53
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 97.53
3kxr_A205 Magnesium transporter, putative; cystathionine bet 97.52
3lqn_A150 CBS domain protein; csgid, structural genomics, un 97.52
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 97.52
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 97.49
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 97.46
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.45
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 97.41
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 97.41
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 97.39
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 97.37
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 97.29
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 97.25
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 97.24
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 97.22
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 97.19
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 97.13
2oux_A286 Magnesium transporter; 10001B, structural genomics 97.13
3ocm_A173 Putative membrane protein; structural genomics, PS 96.94
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 96.89
2zy9_A473 Mg2+ transporter MGTE; membrane protien, metal tra 96.78
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 96.76
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.55
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 96.37
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 96.33
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.19
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.02
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 95.95
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 95.67
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 95.67
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
Probab=99.93  E-value=2.7e-26  Score=204.78  Aligned_cols=165  Identities=23%  Similarity=0.408  Sum_probs=110.1

Q ss_pred             CCCHHHHHHHHHccccccccccCCCCHHHHHHHHHHhcccccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEE
Q psy4847           2 CVHPQGLRSFIRVRDHDVTTEFNDLEKDEVNIISGALELRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIP   81 (396)
Q Consensus         2 ~~~~~Elk~ll~~~~~~~~~e~~~l~~~E~~~i~~alel~~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriP   81 (396)
                      .+|++||+.+++.+     .+.|.|+++|++++.+++.|.+.+|+++|+|+.+++++++++++. ++++.|.+++++++|
T Consensus         6 ~~t~~el~~l~~~~-----~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~v~-~a~~~m~~~~~~~~p   79 (172)
T 3lhh_A            6 NVTQEDIQAMLQEG-----SSAGVIEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRFP   79 (172)
T ss_dssp             ------------------------------------------CTTTTSEEGGGCCCEETTSCHH-HHHHHHHTCCCSEEE
T ss_pred             cCCHHHHHHHHHHH-----HHcCCCCHHHHHHHHHHhccCCCCHHHhCccHHHeEEEcCCCCHH-HHHHHHHhCCCCEEE
Confidence            36899999999986     678999999999999999999999999999988899999999999 999999999999999


Q ss_pred             EEeCCCCcEEEEEEhhhhcccCCc-cccchhhhhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCC
Q psy4847          82 VYEDRRTNIVTMFYIKDLALVDPD-DNTPLKTLCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPF  160 (396)
Q Consensus        82 V~~~~~~~IVGiL~vkDLl~~~~~-~~~~l~~v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~  160 (396)
                      |++++.++++|+|+.+||+..... ...++.++|    +++++|++++++.+++..|.+. +.+.++|+        |++
T Consensus        80 Vvd~~~~~lvGivt~~dl~~~~~~~~~~~v~~im----~~~~~v~~~~~l~~a~~~m~~~-~~~~~pVv--------d~~  146 (172)
T 3lhh_A           80 VCRNNVDDMVGIISAKQLLSESIAGERLELVDLV----KNCNFVPNSLSGMELLEHFRTT-GSQMVFVV--------DEY  146 (172)
T ss_dssp             EESSSTTSEEEEEEHHHHHHHHHTTCCCCGGGGC----BCCEEEETTCCHHHHHHHHHHH-TCSEEEEE--------CTT
T ss_pred             EEeCCCCeEEEEEEHHHHHHHHhhcCcccHHHHh----cCCeEeCCCCCHHHHHHHHHHc-CCeEEEEE--------eCC
Confidence            997654799999999999864321 234566654    6889999999999999999995 78999998        888


Q ss_pred             CceeeeecHHHHHHHHHhcccccccc
Q psy4847         161 YETVGLITLEDVIEELIQAEIMDETD  186 (396)
Q Consensus       161 g~~vGIVTleDIiEeli~~eI~DE~D  186 (396)
                      |+++||||++||+++++ ++|.||.|
T Consensus       147 g~lvGiit~~Dil~~l~-~~~~de~~  171 (172)
T 3lhh_A          147 GDLKGLVTLQDMMDALT-GEFFQEDG  171 (172)
T ss_dssp             SCEEEEEEHHHHHHHHH-TTCC----
T ss_pred             CCEEEEeeHHHHHHHHh-CCCccccC
Confidence            99999999999999999 79999976



>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 3e-09
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 2e-07
d1vr9a3121 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB 3e-07
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 3e-07
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 7e-07
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 1e-06
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 1e-06
d2ef7a1127 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 2e-05
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 2e-05
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 2e-05
d3ddja1141 d.37.1.1 (A:136-276) Uncharacterized protein SSO32 4e-05
d2riha1131 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 4e-05
d1yava3132 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bac 8e-05
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 1e-04
d1pbja3120 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A 1e-04
d2ooxe2153 d.37.1.1 (E:182-334) Uncharacterized protein C1556 2e-04
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 9e-04
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 0.001
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 0.003
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 53.3 bits (127), Expect = 3e-09
 Identities = 16/153 (10%), Positives = 49/153 (32%), Gaps = 25/153 (16%)

Query: 40  LRRKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDL 99
           ++     D++     + +      +  +    ++ +G    P+++ ++ + V M  I D 
Sbjct: 10  MKSHRCYDLIPTSSKLVVFDTSLQVK-KAFFALVTNGVRAAPLWDSKKQSFVGMLTITDF 68

Query: 100 --ALVDPDDNTPLKTLCQFYQNSC--------------YFVFEDTTLDVLLKQFKEGIKG 143
              L     +  ++                          +  + +L   +       K 
Sbjct: 69  INILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRN-KI 127

Query: 144 HMAFVHRVNNEGEGDPFYETVGLITLEDVIEEL 176
           H   V  ++ E        T+ ++T + +++ L
Sbjct: 128 HRLPV--IDPESG-----NTLYILTHKRILKFL 153


>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Length = 132 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.77
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.72
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.7
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.7
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.69
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.68
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.68
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.66
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.66
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.64
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.64
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.63
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.63
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.63
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.63
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.6
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.6
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.6
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.59
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.58
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.58
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.57
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.56
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.54
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.53
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.43
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 98.77
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 98.76
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 98.72
d1i5za2132 Catabolite gene activator protein, N-terminal doma 98.69
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 98.69
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 98.64
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 98.59
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 98.56
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 98.49
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 98.47
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 98.46
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 98.42
d1zyba2147 Probable transcription regulator BT4300, N-termina 98.36
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 98.34
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 98.23
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 98.13
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 98.11
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 98.1
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 98.0
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.99
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 97.96
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 97.93
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 97.9
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 97.87
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 97.82
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 97.81
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 97.78
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 97.78
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 97.73
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 97.72
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 97.63
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 97.6
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 97.58
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 97.52
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.5
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 97.44
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 97.41
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 97.37
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 97.35
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 97.2
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 97.03
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 96.99
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 96.59
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=99.77  E-value=4.9e-19  Score=149.56  Aligned_cols=121  Identities=15%  Similarity=0.160  Sum_probs=102.5

Q ss_pred             ccccccccccCCCEEEEeCCCChhHHHHHHHHHcCCcEEEEEeCCCCcEEEEEEhhhhccc--CC-------ccccchhh
Q psy4847          42 RKIVGDVMTKLEDVYMLSYDAILDFETVSEIMKSGYSRIPVYEDRRTNIVTMFYIKDLALV--DP-------DDNTPLKT  112 (396)
Q Consensus        42 ~~tV~dIMtp~~dv~~l~~d~~l~~e~i~~i~~~g~sriPV~~~~~~~IVGiL~vkDLl~~--~~-------~~~~~l~~  112 (396)
                      ++||+++|+|.+++.+++.++++. ++++.|.++||+++||++++ ++++|+|+.+|++..  ..       ....++++
T Consensus         1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s~~pVvd~~-~~~vGiit~~di~~~~~~~~~~~~~~~~~~~v~~   78 (132)
T d1yava3           1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYTAIPVLDPS-YRLHGLIGTNMIMNSIFGLERIEFEKLDQITVEE   78 (132)
T ss_dssp             TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCSEEEEECTT-CBEEEEEEHHHHHHHHBCSSSBCGGGTTTSBHHH
T ss_pred             CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCCceEEeecc-cccccEEEcchhHHHhhccccccccccccccccc
Confidence            578999999999999999999999 99999999999999999876 899999999999732  11       01234444


Q ss_pred             hhhhhcCCceEEcCCCCHHHHHHHHHhcCCceEEEEEEeCCCCCCCCCCceeeeecHHHHHHHHHh
Q psy4847         113 LCQFYQNSCYFVFEDTTLDVLLKQFKEGIKGHMAFVHRVNNEGEGDPFYETVGLITLEDVIEELIQ  178 (396)
Q Consensus       113 v~~~~~~~v~~V~~dt~L~~~L~~f~~~~~~h~avV~~~~~~~~~De~g~~vGIVTleDIiEeli~  178 (396)
                      +   |.++++++.+++++.+++..|.++   ++++|+        |++|+++||||.+||+++|.+
T Consensus        79 ~---m~~~~~~v~~~~~l~~~~~~~~~~---~~l~Vv--------d~~~~~~Givt~~dil~~l~~  130 (132)
T d1yava3          79 V---MLTDIPRLHINDPIMKGFGMVINN---GFVCVE--------NDEQVFEGIFTRRVVLKELNK  130 (132)
T ss_dssp             H---SBCSCCEEETTSBHHHHHHHTTTC---SEEEEE--------CTTCBEEEEEEHHHHHHHHHH
T ss_pred             c---ccccccccccchhHHHHHHHHHhC---CEEEEE--------ccCCEEEEEEEHHHHHHHHHh
Confidence            4   468999999999999999999873   346666        889999999999999999863



>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure