Psyllid ID: psy4881

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MTKVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKENEYSQDSDENMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL
ccEEcEEEHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHcHHHccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHcccHHHHHHccccccEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccccccccccccccccccccccc
cccEEEEEEEEEHHHHHHcccccccccccHHHcccccccccccHHccccccHHHHHHHHccccccccccEEEcccccHHHHHHHHHccccccccccccHcccccccccccEEEcccccHHHHHHccccccccccEEEHcHHHccEEEEccccHHHHHHHHHcccccccccccccEEccccccccccEEccccHHcHccHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHcccEEEEEEccccEEEccHHHHHcccccccccccccEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccc
MTKVNVFHLVICLDLLtfiptcypvedttekvfgpldyenipseefwgteprRLINKYYSkhhdvvtdrftidtgiHTEAICrcwkskkfpfcdnshkyhnkfhkdnvgpliidgntfpdyvldkytlptpnrsityptpstmsdsqVDKAIDKYVKeneysqdsdenMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAkysgtkgvcfalygdgaanqgqvfEVYNiaklwnipcifvcenngygmgtsserasasvdyytrgdyipgiwvdgMDILAVREAARFAVNHcrsdkgpilletatyrysghsmsdpgtsyrtrdEIQEVrqtrdpissLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKAradpevgldeltgdiyavpletdirgttpfnsyphkrvgkainl
MTKVNVFHLVICLDLLTFIPTCYPVEDTTEKVfgpldyenipseefwgtePRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSityptpstmsdsqvDKAIDKYVKENeysqdsdenMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVnhcrsdkgpillETATyrysghsmsdpgtsyrtrDEIQEVrqtrdpisslkdkilnaslvtpeelkkidtEVKAEIDAVIKkaradpevgldelTGDIYAVpletdirgttpfnsyphkrvgkainl
MTKVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKENEYSQDSDENMtnqlvtvtnqlvtvtnqlvtvtnqlvtvPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL
***VNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPT*****************************************QLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTS**RASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRY**************************************SLVT***LKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPF**************
**KVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKENEYSQDSDENMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL
MTKVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKE********ENMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHK********
*TKVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKENEYSQDSDENMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKVNVFHLVICLDLLTFIPTCYPVEDTTEKVFGPLDYENIPSEEFWGTEPRRLINKYYSKHHDVVTDRFTIDTGIHTEAICRCWKSKKFPFCDNSHKYHNKFHKDNVGPLIIDGNTFPDYVLDKYTLPTPNRSITYPTPSTMSDSQVDKAIDKYVKENEYSQDSDENMTNQLVTVTNQLVTVTNQLVTVTNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query423 2.2.26 [Sep-21-2011]
P52899397 Probable pyruvate dehydro yes N/A 0.527 0.561 0.599 4e-78
P08559390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.638 3e-77
Q8HXW9390 Pyruvate dehydrogenase E1 N/A N/A 0.503 0.546 0.633 1e-76
P29804389 Pyruvate dehydrogenase E1 yes N/A 0.503 0.547 0.633 1e-76
P35486390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.633 1e-76
P26284390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.633 1e-76
A5A6L0390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.633 2e-76
Q5R490390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.633 2e-76
A7MB35390 Pyruvate dehydrogenase E1 yes N/A 0.503 0.546 0.633 2e-76
P26267396 Pyruvate dehydrogenase E1 N/A N/A 0.468 0.5 0.636 3e-76
>sp|P52899|ODPA_CAEEL Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=T05H10.6 PE=2 SV=1 Back     alignment and function desciption
 Score =  292 bits (747), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 139/232 (59%), Positives = 173/232 (74%), Gaps = 9/232 (3%)

Query: 198 PLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGT 257
           PLG G+ALA KY   K VC  LYGDGAANQGQ+FE  N+AKLW++P +FVCENNG+GMGT
Sbjct: 166 PLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGT 225

Query: 258 SSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSG 317
           ++ER+SAS +YYTRGDY+PGIWVDGMDILAVREA ++A  +C S KGP+++E ATYRY G
Sbjct: 226 TAERSSASTEYYTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHG 285

Query: 318 HSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIK 377
           HSMSDPGTSYRTR+EIQEVR+TRDPI+  KD+I+ +SL T EELK ID EV+ E+D  +K
Sbjct: 286 HSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALK 345

Query: 378 KARADPEVGLDELTGDIYAVPLETDIRGTT-------PFNSYPH--KRVGKA 420
            A +D  +  + L  DIY      +IRG T       PF +     K +G+A
Sbjct: 346 IATSDGVLPPEALYADIYHNTPAQEIRGATIDETIVQPFKTSADVLKSIGRA 397
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 1
>sp|P08559|ODPA_HUMAN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens GN=PDHA1 PE=1 SV=3 Back     alignment and function description
>sp|Q8HXW9|ODPA_MACFA Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Macaca fascicularis GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|P29804|ODPA_PIG Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (Fragment) OS=Sus scrofa GN=PDHA1 PE=1 SV=1 Back     alignment and function description
>sp|P35486|ODPA_MOUSE Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus GN=Pdha1 PE=1 SV=1 Back     alignment and function description
>sp|P26284|ODPA_RAT Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Rattus norvegicus GN=Pdha1 PE=1 SV=2 Back     alignment and function description
>sp|A5A6L0|ODPA_PANTR Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Pan troglodytes GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R490|ODPA_PONAB Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Pongo abelii GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|A7MB35|ODPA_BOVIN Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Bos taurus GN=PDHA1 PE=2 SV=1 Back     alignment and function description
>sp|P26267|ODPA_ASCSU Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial OS=Ascaris suum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
91078982397 PREDICTED: similar to pyruvate dehydroge 0.536 0.571 0.740 3e-97
170036247398 pyruvate dehydrogenase [Culex quinquefas 0.536 0.570 0.719 1e-95
380029415402 PREDICTED: probable pyruvate dehydrogena 0.534 0.562 0.712 2e-95
328793432387 PREDICTED: probable pyruvate dehydrogena 0.534 0.583 0.707 2e-95
332373348398 unknown [Dendroctonus ponderosae] 0.536 0.570 0.704 2e-95
340722783396 PREDICTED: probable pyruvate dehydrogena 0.534 0.570 0.707 9e-95
307189557396 Probable pyruvate dehydrogenase E1 compo 0.534 0.570 0.699 1e-94
340722785402 PREDICTED: probable pyruvate dehydrogena 0.534 0.562 0.707 1e-94
350424173396 PREDICTED: probable pyruvate dehydrogena 0.534 0.570 0.703 1e-94
158297863397 AGAP004786-PA [Anopheles gambiae str. PE 0.536 0.571 0.701 2e-94
>gi|91078982|ref|XP_974523.1| PREDICTED: similar to pyruvate dehydrogenase [Tribolium castaneum] gi|270003684|gb|EFA00132.1| hypothetical protein TcasGA2_TC002948 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  362 bits (928), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 198/227 (87%)

Query: 197 VPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMG 256
           VPLGVG+ALAAKY GT GVC ALYGDGAANQGQVFEV+N+AKLW+IPCIFVCENNGYGMG
Sbjct: 170 VPLGVGLALAAKYKGTDGVCVALYGDGAANQGQVFEVFNMAKLWDIPCIFVCENNGYGMG 229

Query: 257 TSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYS 316
           TS+ RA+A+  YYTRGD IPGIW+DGMD+LAVREAA+FAV+HC S KGPILLE ATYRYS
Sbjct: 230 TSAARAAANTAYYTRGDVIPGIWIDGMDVLAVREAAKFAVDHCTSGKGPILLEAATYRYS 289

Query: 317 GHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVI 376
           GHSMSDPGTSYRTR+EIQEVRQTRDPI+S K+KI+ A+LV+PEELK IDTE+++ +D   
Sbjct: 290 GHSMSDPGTSYRTREEIQEVRQTRDPITSFKEKIITANLVSPEELKAIDTEIRSTVDEAT 349

Query: 377 KKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPHKRVGKAINL 423
           KKA+A+ E+ L+ELT DIY++ LE  IR   PFN  PHKR+G+A+N 
Sbjct: 350 KKAKAEKEIPLEELTADIYSLDLEKQIRNIDPFNPLPHKRIGEAVNF 396

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170036247|ref|XP_001845976.1| pyruvate dehydrogenase [Culex quinquefasciatus] gi|167878853|gb|EDS42236.1| pyruvate dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|380029415|ref|XP_003698369.1| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|328793432|ref|XP_623502.3| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332373348|gb|AEE61815.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|340722783|ref|XP_003399781.1| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307189557|gb|EFN73927.1| Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340722785|ref|XP_003399782.1| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424173|ref|XP_003493711.1| PREDICTED: probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|158297863|ref|XP_318026.4| AGAP004786-PA [Anopheles gambiae str. PEST] gi|157014531|gb|EAA13136.4| AGAP004786-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query423
WB|WBGene00011510414 pdha-1 [Caenorhabditis elegans 0.496 0.507 0.638 1.1e-71
FB|FBgn0028325443 l(1)G0334 "lethal (1) G0334" [ 0.527 0.503 0.595 1.8e-71
ZFIN|ZDB-GENE-040426-2719393 pdha1a "pyruvate dehydrogenase 0.503 0.541 0.615 9.9e-71
UNIPROTKB|E2RL90390 PDHA1 "Pyruvate dehydrogenase 0.491 0.533 0.649 1.6e-70
UNIPROTKB|P08559390 PDHA1 "Pyruvate dehydrogenase 0.491 0.533 0.649 1.6e-70
UNIPROTKB|I3LCI2390 PDHA1 "Pyruvate dehydrogenase 0.491 0.533 0.644 3.3e-70
UNIPROTKB|P29804389 PDHA1 "Pyruvate dehydrogenase 0.491 0.534 0.644 3.3e-70
MGI|MGI:97532390 Pdha1 "pyruvate dehydrogenase 0.491 0.533 0.644 3.3e-70
RGD|2318086390 LOC100365902 "pyruvate dehydro 0.491 0.533 0.644 3.3e-70
RGD|3286390 Pdha1 "pyruvate dehydrogenase 0.491 0.533 0.644 3.3e-70
WB|WBGene00011510 pdha-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 725 (260.3 bits), Expect = 1.1e-71, P = 1.1e-71
 Identities = 134/210 (63%), Positives = 165/210 (78%)

Query:   198 PLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGT 257
             PLG G+ALA KY   K VC  LYGDGAANQGQ+FE  N+AKLW++P +FVCENNG+GMGT
Sbjct:   183 PLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGT 242

Query:   258 SSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSG 317
             ++ER+SAS +YYTRGDY+PGIWVDGMDILAVREA ++A  +C S KGP+++E ATYRY G
Sbjct:   243 TAERSSASTEYYTRGDYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHG 302

Query:   318 HSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIK 377
             HSMSDPGTSYRTR+EIQEVR+TRDPI+  KD+I+ +SL T EELK ID EV+ E+D  +K
Sbjct:   303 HSMSDPGTSYRTREEIQEVRKTRDPITGFKDRIITSSLATEEELKAIDKEVRKEVDEALK 362

Query:   378 KARADPEVGLDELTGDIYAVPLETDIRGTT 407
              A +D  +  + L  DIY      +IRG T
Sbjct:   363 IATSDGVLPPEALYADIYHNTPAQEIRGAT 392
GO:0008152 "metabolic process" evidence=IEA
GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA
GO:0004739 "pyruvate dehydrogenase (acetyl-transferring) activity" evidence=IEA
GO:0006096 "glycolysis" evidence=IEA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0016477 "cell migration" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
FB|FBgn0028325 l(1)G0334 "lethal (1) G0334" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2719 pdha1a "pyruvate dehydrogenase (lipoamide) alpha 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RL90 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P08559 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCI2 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P29804 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97532 Pdha1 "pyruvate dehydrogenase E1 alpha 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2318086 LOC100365902 "pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|3286 Pdha1 "pyruvate dehydrogenase (lipoamide) alpha 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6Z5N4ODPA1_ORYSJ1, ., 2, ., 4, ., 10.55770.46800.5076yesN/A
P52899ODPA_CAEEL1, ., 2, ., 4, ., 10.59910.52710.5617yesN/A
P29804ODPA_PIG1, ., 2, ., 4, ., 10.63380.50350.5475yesN/A
P35486ODPA_MOUSE1, ., 2, ., 4, ., 10.63380.50350.5461yesN/A
P08559ODPA_HUMAN1, ., 2, ., 4, ., 10.63840.50350.5461yesN/A
Q54C70ODPA_DICDI1, ., 2, ., 4, ., 10.52090.50350.5649yesN/A
O13366ODPA_KLULA1, ., 2, ., 4, ., 10.52350.49400.5072yesN/A
A5A6L0ODPA_PANTR1, ., 2, ., 4, ., 10.63380.50350.5461yesN/A
P52901ODPA1_ARATH1, ., 2, ., 4, ., 10.55020.49170.5347yesN/A
P16387ODPA_YEAST1, ., 2, ., 4, ., 10.50660.52950.5333yesN/A
A7MB35ODPA_BOVIN1, ., 2, ., 4, ., 10.63380.50350.5461yesN/A
Q5R490ODPA_PONAB1, ., 2, ., 4, ., 10.63380.50350.5461yesN/A
Q9R9N5ODPA_RHIME1, ., 2, ., 4, ., 10.50990.47040.5718yesN/A
Q10489ODPA_SCHPO1, ., 2, ., 4, ., 10.52400.44200.4572yesN/A
P26284ODPA_RAT1, ., 2, ., 4, ., 10.63380.50350.5461yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E 1e-104
PLN02269362 PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp 1e-100
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 3e-97
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph 1e-91
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena 2e-82
TIGR03181341 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E 1e-53
CHL00149341 CHL00149, odpA, pyruvate dehydrogenase E1 componen 4e-48
PLN02374433 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl 3e-44
smart0070438 smart00704, ZnF_CDGSH, CDGSH-type zinc finger 1e-08
pfam0936034 pfam09360, zf-CDGSH, Iron-binding zinc finger CDGS 2e-08
COG0567 906 COG0567, SucA, 2-oxoglutarate dehydrogenase comple 8e-07
TIGR00239 929 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenas 2e-05
COG3959243 COG3959, COG3959, Transketolase, N-terminal subuni 3e-05
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 3e-04
cd02016265 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate 3e-04
cd02012255 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) fami 4e-04
>gnl|CDD|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information 
 Score =  310 bits (797), Expect = e-104
 Identities = 107/202 (52%), Positives = 139/202 (68%), Gaps = 4/202 (1%)

Query: 197 VPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMG 256
           VPL  G+A A KY G   V    +GDGAANQGQ +E +N+A LW +P IFV ENN Y MG
Sbjct: 116 VPLATGLAFANKYRGNDNVTACFFGDGAANQGQFYESFNMAALWKLPVIFVIENNLYAMG 175

Query: 257 TSSERASASVDYYTRGD--YIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYR 314
           T+ ER+S+  D Y RG+   IPG  VDGMD+LAVREAA+ AV   RS KGPILLE  TYR
Sbjct: 176 TAVERSSSVTDLYKRGESFGIPGERVDGMDVLAVREAAKEAVERARSGKGPILLEMKTYR 235

Query: 315 YSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDA 374
           + GHSMSDP   YR+++E++E R  RDPI  LK +++   + + EELK+ID EV+AE++ 
Sbjct: 236 FRGHSMSDPA-KYRSKEEVEEWR-KRDPIEKLKARLIEQGIASEEELKEIDKEVRAEVEE 293

Query: 375 VIKKARADPEVGLDELTGDIYA 396
            ++ A   PE  ++EL  D+YA
Sbjct: 294 AVEFAENSPEPPVEELYTDVYA 315

Members of this protein family are the alpha subunit of the E1 component of pyruvate dehydrogenase (PDH). This model represents one branch of a larger family that E1-alpha proteins from 2-oxoisovalerate dehydrogenase, acetoin dehydrogenase, another PDH clade, etc [Energy metabolism, Pyruvate dehydrogenase]. Length = 315
>gnl|CDD|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>gnl|CDD|201386 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>gnl|CDD|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>gnl|CDD|197836 smart00704, ZnF_CDGSH, CDGSH-type zinc finger Back     alignment and domain information
>gnl|CDD|220203 pfam09360, zf-CDGSH, Iron-binding zinc finger CDGSH type Back     alignment and domain information
>gnl|CDD|223641 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>gnl|CDD|226468 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|238974 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>gnl|CDD|238970 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 423
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
KOG0225|consensus394 100.0
PLN02269362 Pyruvate dehydrogenase E1 component subunit alpha 100.0
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 100.0
PF00676300 E1_dh: Dehydrogenase E1 component; InterPro: IPR00 100.0
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 100.0
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 100.0
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 100.0
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 100.0
KOG1182|consensus432 100.0
PRK09404 924 sucA 2-oxoglutarate dehydrogenase E1 component; Re 100.0
TIGR00239 929 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon 100.0
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami 99.97
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.97
KOG4166|consensus675 99.96
PF13292270 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn 99.95
COG1154 627 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m 99.95
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.93
PRK12315 581 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.93
PRK06154565 hypothetical protein; Provisional 99.93
PLN02225 701 1-deoxy-D-xylulose-5-phosphate synthase 99.92
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 99.92
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 99.92
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 99.92
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.92
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 99.91
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 99.91
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 99.91
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.91
PRK07524535 hypothetical protein; Provisional 99.91
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 99.91
PLN02470585 acetolactate synthase 99.91
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.9
PRK09124574 pyruvate dehydrogenase; Provisional 99.9
PRK08273597 thiamine pyrophosphate protein; Provisional 99.9
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 99.9
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 99.9
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.9
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 99.9
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.9
CHL00099585 ilvB acetohydroxyacid synthase large subunit 99.9
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.9
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 99.9
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 99.9
PRK11269591 glyoxylate carboligase; Provisional 99.9
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 99.9
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.9
PRK08611576 pyruvate oxidase; Provisional 99.9
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.89
PRK06457549 pyruvate dehydrogenase; Provisional 99.89
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 99.89
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.89
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.89
PRK06546578 pyruvate dehydrogenase; Provisional 99.89
PLN02573578 pyruvate decarboxylase 99.89
PRK08322547 acetolactate synthase; Reviewed 99.89
PRK08617552 acetolactate synthase; Reviewed 99.89
TIGR00204 617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 99.89
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 99.88
PRK05858542 hypothetical protein; Provisional 99.88
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 99.88
PRK06112578 acetolactate synthase catalytic subunit; Validated 99.88
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 99.88
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.87
PRK08327569 acetolactate synthase catalytic subunit; Validated 99.87
PRK12571 641 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.87
PLN02234 641 1-deoxy-D-xylulose-5-phosphate synthase 99.87
PRK07064544 hypothetical protein; Provisional 99.87
PRK08199557 thiamine pyrophosphate protein; Validated 99.87
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 99.87
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.87
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.86
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.86
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.86
PRK08266542 hypothetical protein; Provisional 99.86
PLN02582 677 1-deoxy-D-xylulose-5-phosphate synthase 99.86
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.86
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.86
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 99.86
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.85
TIGR00232 653 tktlase_bact transketolase, bacterial and yeast. T 99.85
PRK07092530 benzoylformate decarboxylase; Reviewed 99.85
PRK05899 624 transketolase; Reviewed 99.85
PTZ00089 661 transketolase; Provisional 99.85
PRK12754 663 transketolase; Reviewed 99.84
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 99.84
PRK12753 663 transketolase; Reviewed 99.83
PLN02790 654 transketolase 99.83
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 99.83
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.82
PRK06163202 hypothetical protein; Provisional 99.82
PRK12474518 hypothetical protein; Provisional 99.82
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.81
COG3959243 Transketolase, N-terminal subunit [Carbohydrate tr 99.81
PRK07586514 hypothetical protein; Validated 99.8
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.8
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 99.8
KOG1185|consensus571 99.79
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.79
PF00456332 Transketolase_N: Transketolase, thiamine diphospha 99.79
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 99.78
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 99.78
cd02017386 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam 99.76
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.76
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 99.75
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 99.73
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 99.72
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 99.72
COG0021 663 TktA Transketolase [Carbohydrate transport and met 99.71
COG3960592 Glyoxylate carboligase [General function predictio 99.7
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 99.7
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.69
KOG0451|consensus 913 99.68
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.68
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 99.67
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 99.64
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.63
COG0567 906 SucA 2-oxoglutarate dehydrogenase complex, dehydro 99.63
KOG0450|consensus 1017 99.63
TIGR03186 889 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S 99.62
TIGR00759 885 aceE pyruvate dehydrogenase E1 component, homodime 99.62
KOG3461|consensus132 99.61
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 99.61
KOG0523|consensus 632 99.6
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 99.57
cd02011227 TPP_PK Thiamine pyrophosphate (TPP) family, Phosph 99.54
PRK13012 896 2-oxoacid dehydrogenase subunit E1; Provisional 99.53
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 99.53
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.52
COG3962617 Acetolactate synthase [Amino acid transport and me 99.49
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 99.48
PRK09405 891 aceE pyruvate dehydrogenase subunit E1; Reviewed 99.47
PRK05261 785 putative phosphoketolase; Provisional 99.32
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 99.11
KOG1184|consensus561 98.84
COG2609 887 AceE Pyruvate dehydrogenase complex, dehydrogenase 98.11
COG1013294 PorB Pyruvate:ferredoxin oxidoreductase and relate 98.06
smart0070438 ZnF_CDGSH CDGSH-type zinc finger. Function unknown 98.02
PF09364379 XFP_N: XFP N-terminal domain; InterPro: IPR018970 97.79
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 97.74
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 97.59
COG1165566 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car 97.55
cd03377365 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), 97.32
PF0936038 zf-CDGSH: Iron-binding zinc finger CDGSH type; Int 97.0
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 96.75
cd06586154 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of 96.73
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 96.71
cd07035155 TPP_PYR_POX_like Pyrimidine (PYR) binding domain o 96.59
COG336978 Zinc finger domain containing protein (CDGSH-type) 96.36
cd07039164 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX 96.23
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 96.22
cd07034160 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi 96.12
TIGR021761165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 95.64
TIGR03845157 sulfopyru_alph sulfopyruvate decarboxylase, alpha 95.44
COG3957 793 Phosphoketolase [Carbohydrate transport and metabo 95.39
cd07038162 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom 94.86
PF02776172 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter 94.68
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai 93.11
cd07037162 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2- 93.03
KOG4605|consensus129 92.7
PRK08659376 2-oxoglutarate ferredoxin oxidoreductase subunit a 92.39
PRK07524 535 hypothetical protein; Provisional 92.31
PRK11269 591 glyoxylate carboligase; Provisional 91.37
PRK07710 571 acetolactate synthase catalytic subunit; Reviewed 91.34
PRK07119352 2-ketoisovalerate ferredoxin reductase; Validated 91.11
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 91.06
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 91.02
PRK07525 588 sulfoacetaldehyde acetyltransferase; Validated 90.93
PRK08611 576 pyruvate oxidase; Provisional 90.92
TIGR03254 554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 90.87
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 90.63
COG0028 550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 90.61
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 90.41
PRK06457 549 pyruvate dehydrogenase; Provisional 90.34
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 90.26
PRK08266 542 hypothetical protein; Provisional 90.16
TIGR03457 579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 89.85
PRK07064 544 hypothetical protein; Provisional 89.54
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 89.48
PRK08322 547 acetolactate synthase; Reviewed 89.36
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 89.2
PLN02470 585 acetolactate synthase 89.19
PF01855230 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta 89.13
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding 89.12
PRK06456 572 acetolactate synthase catalytic subunit; Reviewed 89.05
PRK09259 569 putative oxalyl-CoA decarboxylase; Validated 88.96
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 88.95
PRK06276 586 acetolactate synthase catalytic subunit; Reviewed 88.93
PRK08199 557 thiamine pyrophosphate protein; Validated 88.7
PRK09107 595 acetolactate synthase 3 catalytic subunit; Validat 88.62
PRK08155 564 acetolactate synthase catalytic subunit; Validated 88.56
PRK07586 514 hypothetical protein; Validated 88.56
PRK06882 574 acetolactate synthase 3 catalytic subunit; Validat 88.2
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 88.1
PRK05858 542 hypothetical protein; Provisional 88.0
PRK06048 561 acetolactate synthase 3 catalytic subunit; Reviewe 87.87
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subuni 87.47
PRK08979 572 acetolactate synthase 3 catalytic subunit; Validat 87.42
TIGR03710562 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s 87.36
TIGR02418 539 acolac_catab acetolactate synthase, catabolic. Ace 87.17
PRK08366 390 vorA 2-ketoisovalerate ferredoxin oxidoreductase s 87.1
TIGR03394 535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 86.99
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 86.97
PRK12474 518 hypothetical protein; Provisional 86.69
PRK06112 578 acetolactate synthase catalytic subunit; Validated 86.66
PTZ00089661 transketolase; Provisional 86.46
PRK08617 552 acetolactate synthase; Reviewed 86.24
PLN02573 578 pyruvate decarboxylase 85.89
TIGR00232653 tktlase_bact transketolase, bacterial and yeast. T 85.62
PRK09622 407 porA pyruvate flavodoxin oxidoreductase subunit al 85.28
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 84.98
TIGR02720 575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 84.65
KOG4605|consensus129 84.55
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 84.36
PRK08367 394 porA pyruvate ferredoxin oxidoreductase subunit al 84.29
PRK06154 565 hypothetical protein; Provisional 84.29
PRK08273 597 thiamine pyrophosphate protein; Provisional 84.12
PRK06965 587 acetolactate synthase 3 catalytic subunit; Validat 83.64
PRK06546 578 pyruvate dehydrogenase; Provisional 82.92
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 82.71
PRK08327 569 acetolactate synthase catalytic subunit; Validated 82.62
PF02779178 Transket_pyr: Transketolase, pyrimidine binding do 82.4
TIGR00173 432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 82.17
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 81.96
PRK09124 574 pyruvate dehydrogenase; Provisional 81.89
TIGR00204617 dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s 81.12
PRK07092 530 benzoylformate decarboxylase; Reviewed 80.9
COG3958312 Transketolase, C-terminal subunit [Carbohydrate tr 80.7
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-54  Score=432.25  Aligned_cols=265  Identities=36%  Similarity=0.551  Sum_probs=221.3

Q ss_pred             cccccccCCCC-----CCCHHHHHHHHHhhccCCeEEeCCCCccccccccccccccccCCeeeecCCC-CCCcHHHHHHH
Q psy4881         131 PNRSITYPTPS-----TMSDSQVDKAIDKYVKENEYSQDSDENMTNQLVTVTNQLVTVTNQLVTVTNQ-LVTVPLGVGIA  204 (423)
Q Consensus       131 ~~r~~~~~~~~-----~~~p~~vi~~l~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~~~~~~~sg~-~g~l~~A~GaA  204 (423)
                      ||....|+++.     -+.+..++..+.  .+.+....+.|..|+  +.....+       ++..++. ++|+|.|+|+|
T Consensus        81 D~i~~~YR~h~~~l~~G~~~~~~~a~~~--G~~~g~~kGr~~~~h--~~~~~~~-------~~~~~~iVg~Q~~~AaG~A  149 (358)
T COG1071          81 DWIFPTYRDHGHLLARGVPLKEIMAELL--GKATGPCKGRGGSMH--YSDKEKG-------FLGGSGIVGTQIPLAAGAA  149 (358)
T ss_pred             CEeecccCccccceecCCCHHHHHHHHh--ccccCCCCCCCCccc--ccccccc-------cCCCCceecccccHHHHHH
Confidence            66655453332     255666654332  133344433444444  4433222       2223333 46799999999


Q ss_pred             HHHHhcCCC-CEEEEEeCCCccchhhHHHHHHHhHhcCCCEEEEEecCCcccccccccccCCchhhhh--cCCCCeEEee
Q psy4881         205 LAAKYSGTK-GVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYTR--GDYIPGIWVD  281 (423)
Q Consensus       205 ~a~k~~~~~-~~vv~~~GDGa~~~G~~~EaLn~A~~~~LPvi~Vv~NN~~gi~~~~~~~~~~~~~~~~--a~G~~~~~Vd  281 (423)
                      +|.|+++.+ ++++|++|||++++|.|||+||+|+.|+|||||||+||+|+||++..+++..+.++.|  +||+|+++||
T Consensus       150 ~a~k~~~~~~~Va~~~~GDGat~qG~FhEalN~A~v~klPvvf~ieNN~yAiSvp~~~q~~~~~~~~ra~aygipgv~VD  229 (358)
T COG1071         150 LALKYRGTKDGVAVAFFGDGATNQGDFHEALNFAAVWKLPVVFVIENNQYAISVPRSRQTAAEIIAARAAAYGIPGVRVD  229 (358)
T ss_pred             HHHHHhCCCCcEEEEEecCCccccchHHHHHHHHHHhcCCEEEEEecCCceeecchhhcccchhHHhhhhccCCCeEEEC
Confidence            999999955 4999999999999999999999999999999999999999999777666665566644  5799999999


Q ss_pred             CCCHHHHHHHHHHHHHHhhCCCCcEEEEEEEecCCCCCCCCCCCCcCChhHHHHHHhcCChHHHHHHHHHHcCCCCHHHH
Q psy4881         282 GMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEEL  361 (423)
Q Consensus       282 G~d~~~v~~al~~A~~~ar~~~gP~lIev~t~R~~gH~~~D~~~~YR~~~e~~~~~~~~DPi~~~~~~L~~~g~~~~~~~  361 (423)
                      |+|+.++++++++|+++||+++||+|||+.|||+.|||++|++++||+++|+++|+ .+|||.+++++|++.|++|++++
T Consensus       230 G~D~~avy~~~~~A~e~AR~g~GPtLIE~~tYR~~~HS~sDd~~~YRskeE~~~~~-~~DPi~r~~~~L~~~g~~see~~  308 (358)
T COG1071         230 GNDVLAVYEAAKEAVERARAGEGPTLIEAVTYRYGGHSTSDDPSKYRSKEEVEEWK-KRDPIVRLRKYLIEAGILSEEEL  308 (358)
T ss_pred             CcCHHHHHHHHHHHHHHHHcCCCCEEEEEEEeecCCCCCCCCccccCCHHHHHHHh-ccChHHHHHHHHHHcCCCCHHHH
Confidence            99999999999999999999999999999999999999999988999999999998 59999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHcCCCCChhhhhhccccCCCccccccCC
Q psy4881         362 KKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTT  407 (423)
Q Consensus       362 ~~i~~e~~~~v~~a~~~A~~~p~p~~~~~~~~vy~~~~~~~~~~~~  407 (423)
                      ++|+++++++|++|+++|+++|.|++++++++||++.++++.++..
T Consensus       309 ~~i~~e~~~~V~ea~e~a~~~p~P~~~~~~~~Vy~~~~~~l~~q~~  354 (358)
T COG1071         309 EAIEAEAKAEVDEAVEFAEASPYPDVSELFEDVYAEGPPHLEEQRE  354 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCCChhHhhhcccccCChhHHHHHH
Confidence            9999999999999999999999999999999999999988876654

>KOG0225|consensus Back     alignment and domain information
>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>KOG1182|consensus Back     alignment and domain information
>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B Back     alignment and domain information
>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism] Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK12754 transketolase; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK12753 transketolase; Reviewed Back     alignment and domain information
>PLN02790 transketolase Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>KOG1185|consensus Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2 Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>COG0021 TktA Transketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG0451|consensus Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0450|consensus Back     alignment and domain information
>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase Back     alignment and domain information
>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type Back     alignment and domain information
>KOG3461|consensus Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>KOG0523|consensus Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O Back     alignment and domain information
>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed Back     alignment and domain information
>PRK05261 putative phosphoketolase; Provisional Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion] Back     alignment and domain information
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion] Back     alignment and domain information
>smart00704 ZnF_CDGSH CDGSH-type zinc finger Back     alignment and domain information
>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes Back     alignment and domain information
>PF09360 zf-CDGSH: Iron-binding zinc finger CDGSH type; InterPro: IPR018967 This entry represents iron-sulphur domain containing proteins that have a CDGSH sequence motif (although the Ser residue can also be an Ala or Thr), and is found in proteins from a wide range of organisms with the exception of fungi Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins Back     alignment and domain information
>COG3369 Zinc finger domain containing protein (CDGSH-type) [Function unknown] Back     alignment and domain information
>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit Back     alignment and domain information
>COG3957 Phosphoketolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins Back     alignment and domain information
>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins Back     alignment and domain information
>KOG4605|consensus Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PTZ00089 transketolase; Provisional Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>TIGR00232 tktlase_bact transketolase, bacterial and yeast Back     alignment and domain information
>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>KOG4605|consensus Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2 Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>COG3958 Transketolase, C-terminal subunit [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-77
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 3e-77
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 8e-77
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 1e-76
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 5e-76
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 1e-73
3duf_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 1e-23
1w85_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1 1e-23
1w88_A368 The Crystal Structure Of Pyruvate Dehydrogenase E1( 2e-23
3dva_A369 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 3e-23
1dtw_A400 Human Branched-Chain Alpha-Keto Acid Dehydrogenase 4e-19
2bff_A400 Reactivity Modulation Of Human Branched-Chain Alpha 7e-19
2j9f_A400 Human Branched-Chain Alpha-Ketoacid Dehydrogenase- 8e-19
1x7y_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-18
1x7w_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-18
1um9_A367 Branched-chain 2-oxo Acid Dehydrogenase (e1) From T 1e-18
2bfe_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-18
1x7x_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-18
1x80_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-18
1x7z_A400 Crystal Structure Of The Human Mitochondrial Branch 1e-18
1olu_A400 Roles Of His291-Alpha And His146-Beta' In The Reduc 6e-18
1v16_A400 Crosstalk Between Cofactor Binding And The Phosphor 1e-17
2bfc_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-17
2bfb_A400 Reactivity Modulation Of Human Branched-Chain Alpha 1e-17
2bfd_A400 Reactivity Modulation Of Human Branched-Chain Alpha 2e-17
1v11_A400 Crosstalk Between Cofactor Binding And The Phosphor 4e-17
1v1m_A400 Crosstalk Between Cofactor Binding And The Phosphor 1e-16
2bp7_A410 New Crystal Form Of The Pseudomonas Putida Branched 2e-14
1qs0_A407 Crystal Structure Of Pseudomonas Putida 2-Oxoisoval 4e-14
3fnv_A83 Crystal Structure Of Miner1: The Redox-Active 2fe-2 1e-09
2qd0_A81 Crystal Structure Of Mitoneet Length = 81 7e-09
4ezf_A77 The Crystal Structure Of A Human Mitoneet Mutant Wi 7e-09
4f2c_A76 The Crystal Structure Of A Human Mitoneet Double Mu 7e-09
3ree_A84 Crystal Structure Of Mitoneet Length = 84 8e-09
3ew0_A80 The Novel 2fe-2s Outer Mitochondrial Protein Mitone 8e-09
2r13_A79 Crystal Structure Of Human Mitoneet Reveals A Novel 1e-08
3s2q_A83 The Crystal Structure Of At5g51720 (At-Neet) Length 1e-08
2qh7_A76 Mitoneet Is A Uniquely Folded 2fe-2s Outer Mitochon 1e-08
4f1e_A76 The Crystal Structure Of A Human Mitoneet Mutant Wi 1e-08
3lpq_A79 Human Mitoneet With 2fe-2s Coordinating Ligand His 1e-08
4f28_A76 The Crystal Structure Of A Human Mitoneet Mutant Wi 3e-08
3s2r_A83 Atchloroneet (H87c Mutant) Length = 83 2e-07
2v3w_A528 Crystal Structure Of The Benzoylformate Decarboxyla 5e-05
2fwn_A528 Phosphorylation Of An Active Site Serine In A Thdp- 7e-05
1yno_A527 High Resolution Structure Of Benzoylformate Decarbo 7e-05
1pi3_A528 E28q Mutant Benzoylformate Decarboxylase From Pseud 7e-05
3fzn_A534 Intermediate Analogue In Benzoylformate Decarboxyla 7e-05
2fn3_A528 High Resolution Structure Of S26a Mutant Of Benzoyl 7e-05
1mcz_A528 Benzoylformate Decarboxylase From Pseudomonas Putid 7e-05
1po7_A528 High Resolution Structure Of E28a Mutant Benzoylfor 8e-05
3f6b_X525 Crystal Structure Of Benzoylformate Decarboxylase I 8e-05
>pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure 
Iteration: 1

 Score =  285 bits (729), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 135/212 (63%), Positives = 161/212 (75%)
Query: 198 PLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGT 257
           PLG GIALA KY+G   VC  LYGDGAANQGQ+FE YN+A LW +PCIF+CENN YGMGT
Sbjct: 164 PLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGT 223
Query: 258 SSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSG 317
           S ERA+AS DYY RGD+IPG+ VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY G
Sbjct: 224 SVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHG 283
Query: 318 HSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVIK 377
           HSMSDPG SYRTR+EIQEVR   DPI  LKD+++N++L + EELK+ID EV+ EI+   +
Sbjct: 284 HSMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQ 343
Query: 378 KARADPEVGLDELTGDIYAVPLETDIRGTTPF 409
            A ADPE  L+EL   IY+     ++RG   +
Sbjct: 344 FATADPEPPLEELGYHIYSSDPPFEVRGANQW 375
>pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure
>pdb|3DUF|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|1W85|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1 Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|1W88|A Chain A, The Crystal Structure Of Pyruvate Dehydrogenase E1(D180n, E183q) Bound To The Peripheral Subunit Binding Domain Of E2 Length = 368 Back     alignment and structure
>pdb|3DVA|A Chain A, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 369 Back     alignment and structure
>pdb|1DTW|A Chain A, Human Branched-Chain Alpha-Keto Acid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|2BFF|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2J9F|A Chain A, Human Branched-Chain Alpha-Ketoacid Dehydrogenase- Decarboxylase E1b Length = 400 Back     alignment and structure
>pdb|1X7Y|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7W|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1UM9|A Chain A, Branched-chain 2-oxo Acid Dehydrogenase (e1) From Thermus Thermophilus Hb8 In Apo-form Length = 367 Back     alignment and structure
>pdb|2BFE|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1X7X|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X80|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1X7Z|A Chain A, Crystal Structure Of The Human Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1OLU|A Chain A, Roles Of His291-Alpha And His146-Beta' In The Reductive Acylation Reaction Catalyzed By Human Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 400 Back     alignment and structure
>pdb|1V16|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BFC|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFB|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|2BFD|A Chain A, Reactivity Modulation Of Human Branched-Chain Alpha- Ketoacid Dehydrogenase By An Internal Molecular Switch Length = 400 Back     alignment and structure
>pdb|1V11|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|1V1M|A Chain A, Crosstalk Between Cofactor Binding And The Phosphorylation Loop Conformation In The Bckd Machine Length = 400 Back     alignment and structure
>pdb|2BP7|A Chain A, New Crystal Form Of The Pseudomonas Putida Branched-Chain Dehydrogenase (E1) Length = 410 Back     alignment and structure
>pdb|1QS0|A Chain A, Crystal Structure Of Pseudomonas Putida 2-Oxoisovalerate Dehydrogenase (Branched-Chain Alpha-Keto Acid Dehydrogenase, E1b) Length = 407 Back     alignment and structure
>pdb|3FNV|A Chain A, Crystal Structure Of Miner1: The Redox-Active 2fe-2s Protein Causative In Wolfram Syndrome 2 Length = 83 Back     alignment and structure
>pdb|2QD0|A Chain A, Crystal Structure Of Mitoneet Length = 81 Back     alignment and structure
>pdb|4EZF|A Chain A, The Crystal Structure Of A Human Mitoneet Mutant With An Ala Inserted Between Asp 67 And Lys 68 Length = 77 Back     alignment and structure
>pdb|4F2C|A Chain A, The Crystal Structure Of A Human Mitoneet Double Mutant In Which Gly 66 Are Asp 67 Are Both Replaced With Ala Residues Length = 76 Back     alignment and structure
>pdb|3REE|A Chain A, Crystal Structure Of Mitoneet Length = 84 Back     alignment and structure
>pdb|3EW0|A Chain A, The Novel 2fe-2s Outer Mitochondrial Protein Mitoneet Displays Conformational Flexibility In Its N-Terminal Cytoplasmic Tethering Domain Length = 80 Back     alignment and structure
>pdb|2R13|A Chain A, Crystal Structure Of Human Mitoneet Reveals A Novel [2fe- 2s] Cluster Coordination Length = 79 Back     alignment and structure
>pdb|3S2Q|A Chain A, The Crystal Structure Of At5g51720 (At-Neet) Length = 83 Back     alignment and structure
>pdb|2QH7|A Chain A, Mitoneet Is A Uniquely Folded 2fe-2s Outer Mitochondrial Membrane Protein Stabilized By Pioglitazone Length = 76 Back     alignment and structure
>pdb|4F1E|A Chain A, The Crystal Structure Of A Human Mitoneet Mutant With Asp 67 Replaced By A Gly Length = 76 Back     alignment and structure
>pdb|3LPQ|A Chain A, Human Mitoneet With 2fe-2s Coordinating Ligand His 87 Replaced With Cys Length = 79 Back     alignment and structure
>pdb|4F28|A Chain A, The Crystal Structure Of A Human Mitoneet Mutant With Met 62 Replaced By A Gly Length = 76 Back     alignment and structure
>pdb|3S2R|A Chain A, Atchloroneet (H87c Mutant) Length = 83 Back     alignment and structure
>pdb|2V3W|A Chain A, Crystal Structure Of The Benzoylformate Decarboxylase Variant L461a From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|2FWN|A Chain A, Phosphorylation Of An Active Site Serine In A Thdp- Dependent Enzyme By Phosphonate Inactivation Length = 528 Back     alignment and structure
>pdb|1YNO|A Chain A, High Resolution Structure Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 527 Back     alignment and structure
>pdb|1PI3|A Chain A, E28q Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3FZN|A Chain A, Intermediate Analogue In Benzoylformate Decarboxylase Length = 534 Back     alignment and structure
>pdb|2FN3|A Chain A, High Resolution Structure Of S26a Mutant Of Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With Thiamine Thiazolone Diphosphate Length = 528 Back     alignment and structure
>pdb|1MCZ|A Chain A, Benzoylformate Decarboxylase From Pseudomonas Putida Complexed With An Inhibitor, R-Mandelate Length = 528 Back     alignment and structure
>pdb|1PO7|A Chain A, High Resolution Structure Of E28a Mutant Benzoylformate Decarboxylase From Pseudomonas Putida Length = 528 Back     alignment and structure
>pdb|3F6B|X Chain X, Crystal Structure Of Benzoylformate Decarboxylase In Complex With The Pyridyl Inhibitor Paa Length = 525 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query423
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 1e-127
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 4e-74
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 8e-69
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 2e-65
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 4e-62
3s2r_A83 AT5G51720/MIO24_14; redox, Fe-S cluster, metal bin 1e-14
3fnv_A83 CDGSH iron sulfur domain-containing protein 2; dia 1e-14
3ew0_A80 Mitoneet, CDGSH iron sulfur domain-containing prot 6e-14
3tbm_A69 Putative uncharacterized protein; iron-sulfur, CDG 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3tbo_A60 Zinc finger, CDGSH-type domain protein; iron-sulfu 9e-06
3tbn_A87 Putative uncharacterized protein; CDGSH, iron-sulf 4e-04
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Length = 365 Back     alignment and structure
 Score =  372 bits (957), Expect = e-127
 Identities = 135/218 (61%), Positives = 162/218 (74%)

Query: 197 VPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMG 256
           VPLG GIALA KY+G   VC  LYGDGAANQGQ+FE YN+A LW +PCIF+CENN YGMG
Sbjct: 146 VPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMG 205

Query: 257 TSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYS 316
           TS ERA+AS DYY RGD+IPG+ VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY 
Sbjct: 206 TSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH 265

Query: 317 GHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVI 376
           GH MSDPG SYRTR+EIQEVR   DPI  LKD+++N++L + EELK+ID EV+ EI+   
Sbjct: 266 GHEMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA 325

Query: 377 KKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPH 414
           + A ADPE  L+EL   IY+     ++RG   +  +  
Sbjct: 326 QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKS 363
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Length = 368 Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>3s2r_A AT5G51720/MIO24_14; redox, Fe-S cluster, metal binding protein; 1.14A {Arabidopsis thaliana} PDB: 3s2q_A Length = 83 Back     alignment and structure
>3fnv_A CDGSH iron sulfur domain-containing protein 2; diabetes, membrane bound, thiazolidinedione, oxidative stres endoplasmic reticulum, membrane; 2.10A {Homo sapiens} Length = 83 Back     alignment and structure
>3ew0_A Mitoneet, CDGSH iron sulfur domain-containing protein 1; mitochondrial outer membrane, 2Fe-2S proteins, isotopic LABE highyield expression; 1.40A {Homo sapiens} PDB: 2r13_A 2qd0_A 3ree_A 2qh7_A 3lpq_A Length = 80 Back     alignment and structure
>3tbm_A Putative uncharacterized protein; iron-sulfur, CDGSH, metal binding protein; HET: 2PE TLA; 1.80A {Ralstonia solanacearum} Length = 69 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tbo_A Zinc finger, CDGSH-type domain protein; iron-sulfur, metal binding protein; 1.50A {Pyrobaculum calidifontis} Length = 60 Back     alignment and structure
>3tbn_A Putative uncharacterized protein; CDGSH, iron-sulfur, miner2, metal binding protein; 1.15A {Magnetospirillum magneticum} Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 100.0
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 100.0
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 100.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 100.0
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 100.0
2yic_A 868 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.9 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
2jgd_A 933 2-oxoglutarate dehydrogenase E1 component; flavopr 100.0
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 99.97
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.91
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 99.91
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 99.9
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 99.9
1r9j_A 673 Transketolase; domains, EACH of the alpha/beta typ 99.9
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 99.89
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.89
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.89
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.89
3rim_A 700 Transketolase, TK; TPP, transferase; HET: TPP; 2.4 99.89
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 99.89
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 99.89
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 99.88
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 99.88
3uk1_A 711 Transketolase; structural genomics, seattle struct 99.88
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 99.88
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 99.88
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 99.88
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 99.87
3l84_A 632 Transketolase; TKT, structural genomics, center fo 99.86
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 99.86
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 99.86
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 99.86
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 99.85
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 99.85
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 99.85
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 99.84
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.84
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.84
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 99.83
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 99.83
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 99.82
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.81
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 99.79
2qtc_A 886 Pyruvate dehydrogenase E1 component; thiamin dipho 99.79
3fnv_A83 CDGSH iron sulfur domain-containing protein 2; dia 99.58
3s2r_A83 AT5G51720/MIO24_14; redox, Fe-S cluster, metal bin 99.56
4ezf_A77 Mitoneet, CDGSH iron-sulfur domain-containing prot 99.55
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 99.31
3ahc_A 845 Phosphoketolase, xylulose 5-phosphate/fructose 6-p 99.24
3ew0_A80 Mitoneet, CDGSH iron sulfur domain-containing prot 99.21
3tbn_A87 Putative uncharacterized protein; CDGSH, iron-sulf 97.12
3tbo_A60 Zinc finger, CDGSH-type domain protein; iron-sulfu 96.67
3tbm_A69 Putative uncharacterized protein; iron-sulfur, CDG 96.61
3tbn_A87 Putative uncharacterized protein; CDGSH, iron-sulf 96.37
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alph 91.97
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 91.51
2pgn_A 589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 91.38
3kom_A663 Transketolase; rossmann fold, csgid, transferase, 91.2
1ybh_A 590 Acetolactate synthase, chloroplast; acetohydroxyac 90.64
2wvg_A 568 PDC, pyruvate decarboxylase; thiamine diphosphate, 90.37
2uz1_A 563 Benzaldehyde lyase; thiamine diphosphate, thiamine 90.2
2iht_A 573 Carboxyethylarginine synthase; thiamin diphosphate 89.68
2vbi_A 566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 89.38
1t9b_A 677 Acetolactate synthase, mitochondrial; acetohydroxy 89.24
3mos_A616 Transketolase, TK; thiamin diphosphate TPP THDP en 89.18
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calc 88.8
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 88.64
1v5e_A 590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 88.58
2e6k_A651 Transketolase; structural genomics, NPPSFA, nation 88.17
4feg_A 603 Pyruvate oxidase; carbanion, structure activity re 87.63
2pan_A 616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 87.18
2c31_A 568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 87.16
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine py 87.13
2q28_A 564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 86.75
3l84_A632 Transketolase; TKT, structural genomics, center fo 86.58
1gpu_A680 Transketolase; transferase(ketone residues); HET: 86.2
2nxw_A 565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 86.11
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 84.94
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subun 84.67
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 84.64
1r9j_A673 Transketolase; domains, EACH of the alpha/beta typ 84.49
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, t 82.58
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 81.76
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heter 80.57
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 80.46
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, o 80.11
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
Probab=100.00  E-value=6.6e-49  Score=397.09  Aligned_cols=220  Identities=61%  Similarity=1.039  Sum_probs=207.0

Q ss_pred             cCCCCC-CcHHHHHHHHHHHhcCCCCEEEEEeCCCccchhhHHHHHHHhHhcCCCEEEEEecCCcccccccccccCCchh
Q psy4881         190 VTNQLV-TVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDY  268 (423)
Q Consensus       190 ~sg~~g-~l~~A~GaA~a~k~~~~~~~vv~~~GDGa~~~G~~~EaLn~A~~~~LPvi~Vv~NN~~gi~~~~~~~~~~~~~  268 (423)
                      .+|.+| ++|+|+|+|+|.++++++++|||++|||++++|.++|+||+|+.|+||+||||+||+|||+++..+.+..++|
T Consensus       138 ~~g~~G~~lp~A~G~A~A~~~~~~~~~vv~~~GDGa~~~G~~~Ealn~A~~~~lpvi~vv~NN~~g~~t~~~~~~~~~~~  217 (365)
T 2ozl_A          138 GNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDY  217 (365)
T ss_dssp             CCCSTTTHHHHHHHHHHHHHHHTCCCCEEEEEETTGGGCHHHHHHHHHHHHTTCCEEEEEEECSEETTEEHHHHCSCCCG
T ss_pred             CcchhhhhhHHHHHHHHHHHhcCCCceEEEEECchhhhccHHHHHHHHHHHHCcCEEEEEECCCcccCCCcccccCCCCH
Confidence            345555 5999999999999999999999999999999999999999999999999999999999999987776667889


Q ss_pred             hhhcCCCCeEEeeCCCHHHHHHHHHHHHHHhhCCCCcEEEEEEEecCCCCCCCCCCCCcCChhHHHHHHhcCChHHHHHH
Q psy4881         269 YTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKD  348 (423)
Q Consensus       269 ~~~a~G~~~~~VdG~d~~~v~~al~~A~~~ar~~~gP~lIev~t~R~~gH~~~D~~~~YR~~~e~~~~~~~~DPi~~~~~  348 (423)
                      +++++|+++++|||+|+++|++++++|++++|+++||+|||+.|||++||+++|++..||+++|++.|++.+||+.+|++
T Consensus       218 ~~ra~g~p~~~VdG~D~~av~~a~~~A~~~~r~~~gP~lIe~~t~R~~gHs~~D~~~~Yr~~~e~~~~~~~~dpi~~~~~  297 (365)
T 2ozl_A          218 YKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPGVSYRTREEIQEVRSKSDPIMLLKD  297 (365)
T ss_dssp             GGTTTTSCEEEEETTCHHHHHHHHHHHHHHHHTTCCCEEEEEECCCSSCSSTTCCSCSSSCHHHHHHHHHHHCHHHHHHH
T ss_pred             HHHhCCCCEEEEeCCCHHHHHHHHHHHHHHHHhCCCCEEEEEEeecCCCCCCCCCCcccCCHHHHHHHHhCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999988789999999999866899999999


Q ss_pred             HHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHcCCCCChhhhhhccccCCCccccccCCCC
Q psy4881         349 KILNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPF  409 (423)
Q Consensus       349 ~L~~~g~~~~~~~~~i~~e~~~~v~~a~~~A~~~p~p~~~~~~~~vy~~~~~~~~~~~~~~  409 (423)
                      +|+++|++|++++++|+++++++|++++++|+++|.|+++++|+|||++.++...+++.+|
T Consensus       298 ~L~~~g~~~~~~~~~i~~~~~~~v~~a~~~a~~~p~p~~~~~~~~vy~~~~~~~~~~~~~~  358 (365)
T 2ozl_A          298 RMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQW  358 (365)
T ss_dssp             HHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHSCCCCGGGTTCSSSSSCCCEEEECSBTT
T ss_pred             HHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHhhhcCCCChhhhcccchh
Confidence            9999999999999999999999999999999999999999999999999888777777666
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>2yic_A 2-oxoglutarate decarboxylase; lyase; HET: TPP; 1.96A {Mycobacterium smegmatis} PDB: 2xta_A* 2y0p_A* 2xt9_A* 2yid_A* Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>3rim_A Transketolase, TK; TPP, transferase; HET: TPP; 2.49A {Mycobacterium tuberculosis} Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>2qtc_A Pyruvate dehydrogenase E1 component; thiamin diphosphate, glycolysis, MAG metal-binding, oxidoreductase, thiamine pyrophosphate; HET: TDK; 1.77A {Escherichia coli} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2qta_A* 1l8a_A* 1rp7_A* 2g25_A* 2g28_A* 2g67_A 2iea_A* 3lpl_A* 3lq2_A* 3lq4_A* Back     alignment and structure
>3fnv_A CDGSH iron sulfur domain-containing protein 2; diabetes, membrane bound, thiazolidinedione, oxidative stres endoplasmic reticulum, membrane; 2.10A {Homo sapiens} Back     alignment and structure
>3s2r_A AT5G51720/MIO24_14; redox, Fe-S cluster, metal binding protein; 1.14A {Arabidopsis thaliana} PDB: 3s2q_A Back     alignment and structure
>4ezf_A Mitoneet, CDGSH iron-sulfur domain-containing protein 1; 2Fe-2S proteins, membrane, mitochondrion, signal-anchor, transmembrane; 1.19A {Homo sapiens} PDB: 2qd0_A 3ree_A 2r13_A 3ew0_A 2qh7_A 4f1e_A 4f2c_A 4f28_A 3lpq_A Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>3ahc_A Phosphoketolase, xylulose 5-phosphate/fructose 6-phosphate phospho; thiamine diphosphate-dependent enzyme, alpha-beta fold; HET: TPP 2PE; 1.70A {Bifidobacterium breve} PDB: 3ahd_A* 3ahe_A* 3ahf_A* 3ahj_A* 3ahi_A* 3ahh_A* 3ahg_A* 3ai7_A* Back     alignment and structure
>3ew0_A Mitoneet, CDGSH iron sulfur domain-containing protein 1; mitochondrial outer membrane, 2Fe-2S proteins, isotopic LABE highyield expression; 1.40A {Homo sapiens} PDB: 2r13_A 2qd0_A 3ree_A 2qh7_A 3lpq_A Back     alignment and structure
>3tbn_A Putative uncharacterized protein; CDGSH, iron-sulfur, miner2, metal binding protein; 1.15A {Magnetospirillum magneticum} Back     alignment and structure
>3tbo_A Zinc finger, CDGSH-type domain protein; iron-sulfur, metal binding protein; 1.50A {Pyrobaculum calidifontis} Back     alignment and structure
>3tbm_A Putative uncharacterized protein; iron-sulfur, CDGSH, metal binding protein; HET: 2PE TLA; 1.80A {Ralstonia solanacearum} Back     alignment and structure
>3tbn_A Putative uncharacterized protein; CDGSH, iron-sulfur, miner2, metal binding protein; 1.15A {Magnetospirillum magneticum} Back     alignment and structure
>1yd7_A 2-keto acid:ferredoxin oxidoreductase subunit alpha; structural genomics, southeast collaboratory for structural genomics, secsg; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>1r9j_A Transketolase; domains, EACH of the alpha/beta type, thiamine diphosphate binding domain, transferase; HET: TPP; 2.22A {Leishmania mexicana mexicana} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 423
d2ozla1361 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate de 3e-49
d2bfda1395 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid 6e-33
d1w85a_365 c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, Pd 9e-32
d1qs0a_407 c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B 2e-30
d1umda_362 c.36.1.11 (A:) Branched-chain alpha-keto acid dehy 3e-30
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: E1-beta subunit of pyruvate dehydrogenase (PP module)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  168 bits (427), Expect = 3e-49
 Identities = 135/218 (61%), Positives = 162/218 (74%)

Query: 197 VPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMG 256
           VPLG GIALA KY+G   VC  LYGDGAANQGQ+FE YN+A LW +PCIF+CENN YGMG
Sbjct: 142 VPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMG 201

Query: 257 TSSERASASVDYYTRGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYS 316
           TS ERA+AS DYY RGD+IPG+ VDGMDIL VREA RFA  +CRS KGPIL+E  TYRY 
Sbjct: 202 TSVERAAASTDYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH 261

Query: 317 GHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKILNASLVTPEELKKIDTEVKAEIDAVI 376
           GH MSDPG SYRTR+EIQEVR   DPI  LKD+++N++L + EELK+ID EV+ EI+   
Sbjct: 262 GHEMSDPGVSYRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAA 321

Query: 377 KKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYPH 414
           + A ADPE  L+EL   IY+     ++RG   +  +  
Sbjct: 322 QFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFKS 359
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Length = 395 Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Length = 365 Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Length = 407 Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query423
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.92
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.91
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.91
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.88
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.88
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.87
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.87
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.87
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.85
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.84
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.81
d2r8oa2331 Transketolase (TK), PP module {Escherichia coli [T 99.77
d1r9ja2336 Transketolase (TK), PP module {Leishmania mexicana 99.76
d1gpua1335 Transketolase (TK), PP module {Baker's yeast (Sacc 99.7
d1itza1338 Transketolase (TK), PP module {Maize (Zea mays) [T 99.65
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 99.49
d2c42a2447 Pyruvate-ferredoxin oxidoreductase, PFOR, domains 98.02
d1ozha2181 Catabolic acetolactate synthase {Klebsiella pneumo 95.79
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.68
d2djia2184 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 95.68
d1zpda2186 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 95.62
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.26
d1t9ba2175 Acetohydroxyacid synthase catalytic subunit {Baker 94.96
d1pvda2180 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 94.87
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 94.71
d2ihta2186 Carboxyethylarginine synthase {Streptomyces clavul 94.52
d2ez9a2174 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 94.32
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 93.87
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 93.83
d2ji7a2188 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 93.71
d1q6za2180 Benzoylformate decarboxylase {Pseudomonas putida [ 93.41
d1ybha2195 Acetohydroxyacid synthase catalytic subunit {Thale 93.38
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 93.02
d2c42a1257 Pyruvate-ferredoxin oxidoreductase, PFOR, domain I 92.16
d2r8oa1195 Transketolase (TK), Pyr module {Escherichia coli [ 92.16
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 88.62
d1r9ja1190 Transketolase (TK), Pyr module {Leishmania mexican 86.89
d1gpua2197 Transketolase (TK), Pyr module {Baker's yeast (Sac 85.97
d1ovma2178 Indole-3-pyruvate decarboxylase {Enterobacter cloa 83.65
d1umdb1186 Branched-chain alpha-keto acid dehydrogenase, Pyr 82.1
d1qs0b1204 2-oxoisovalerate dehydrogenase (E1B), Pyr module { 81.67
d2ozlb1192 E1-beta subunit of pyruvate dehydrogenase, Pyr mod 80.53
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiamin diphosphate-binding fold (THDP-binding)
superfamily: Thiamin diphosphate-binding fold (THDP-binding)
family: Branched-chain alpha-keto acid dehydrogenase PP module
domain: E1-beta subunit of pyruvate dehydrogenase (PP module)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.7e-51  Score=413.06  Aligned_cols=223  Identities=61%  Similarity=1.022  Sum_probs=208.7

Q ss_pred             CCCCCCcHHHHHHHHHHHhcCCCCEEEEEeCCCccchhhHHHHHHHhHhcCCCEEEEEecCCcccccccccccCCchhhh
Q psy4881         191 TNQLVTVPLGVGIALAAKYSGTKGVCFALYGDGAANQGQVFEVYNIAKLWNIPCIFVCENNGYGMGTSSERASASVDYYT  270 (423)
Q Consensus       191 sg~~g~l~~A~GaA~a~k~~~~~~~vv~~~GDGa~~~G~~~EaLn~A~~~~LPvi~Vv~NN~~gi~~~~~~~~~~~~~~~  270 (423)
                      +..++++|.|+|+|+|.|+++.+++|+|++|||++++|.|||+||+|+.|+||+||||+||+|+++++...++...+.++
T Consensus       136 ~ivg~~~p~A~G~A~a~k~~~~~~v~~~~~GDGa~~eG~f~Ealn~A~~~~lPvifv~eNN~yaist~~~~~~~~~~~~~  215 (361)
T d2ozla1         136 GIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYK  215 (361)
T ss_dssp             CSTTTHHHHHHHHHHHHHHHTCCCCEEEEEETTGGGCHHHHHHHHHHHHTTCCEEEEEEECSEETTEEHHHHCSCCCGGG
T ss_pred             ccccccchhHHHHHHHhhhccCCCeEEEEecCCCccCcchhhhhhhhhhccCceEEEEEeCCcccCCCchhccccccccc
Confidence            33445699999999999999999999999999999999999999999999999999999999999999987777777888


Q ss_pred             hcCCCCeEEeeCCCHHHHHHHHHHHHHHhhCCCCcEEEEEEEecCCCCCCCCCCCCcCChhHHHHHHhcCChHHHHHHHH
Q psy4881         271 RGDYIPGIWVDGMDILAVREAARFAVNHCRSDKGPILLETATYRYSGHSMSDPGTSYRTRDEIQEVRQTRDPISSLKDKI  350 (423)
Q Consensus       271 ~a~G~~~~~VdG~d~~~v~~al~~A~~~ar~~~gP~lIev~t~R~~gH~~~D~~~~YR~~~e~~~~~~~~DPi~~~~~~L  350 (423)
                      +++|+++++|||+|+.++++++++|++++|+++||+|||+.|||++||+.+|++..||+++|+++|++++|||.+++++|
T Consensus       216 ~~~~~~~~~vdGnD~~av~~a~~~A~~~~R~g~gP~liE~~TyR~~gHs~~D~~~~YR~~~Ei~~~~~k~DPi~~~~~~L  295 (361)
T d2ozla1         216 RGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPGVSYRTREEIQEVRSKSDPIMLLKDRM  295 (361)
T ss_dssp             TTTTSCEEEEETTCHHHHHHHHHHHHHHHHTTCCCEEEEEECCCSSCSSTTCCSCSSSCHHHHHHHHHHHCHHHHHHHHH
T ss_pred             cccccceEEeccCCchHHHHHHHHHHHHHhccCCCEEEEEeeecCCCCcccccccccCCHHHHHhhhhcCCHHHHHHHHH
Confidence            88999999999999999999999999999999999999999999999999998878999999998876689999999999


Q ss_pred             HHcCCCCHHHHHHHHHHHHHHHHHHHHHHHcCCCCChhhhhhccccCCCccccccCCCCCCCC
Q psy4881         351 LNASLVTPEELKKIDTEVKAEIDAVIKKARADPEVGLDELTGDIYAVPLETDIRGTTPFNSYP  413 (423)
Q Consensus       351 ~~~g~~~~~~~~~i~~e~~~~v~~a~~~A~~~p~p~~~~~~~~vy~~~~~~~~~~~~~~~~~~  413 (423)
                      +++|++|++++++|+++++++|++|+++|+++|.|++++++++||++.+|.+.++.-.|--.+
T Consensus       296 i~~g~~se~e~~~i~~ei~~~V~~A~~~A~~sp~P~~~~l~~~VYa~~~p~~~~~~~~~~~~~  358 (361)
T d2ozla1         296 VNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYSSDPPFEVRGANQWIKFK  358 (361)
T ss_dssp             HHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHSCCCCGGGTTCSSSSSCCCEEEECSBTTCEEE
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHhCCCcCHHHHHhcccCCCChHHHHhHHHHhhcc
Confidence            999999999999999999999999999999999999999999999998887777776664433
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r8oa2 c.36.1.10 (A:2-332) Transketolase (TK), PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1gpua1 c.36.1.10 (A:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itza1 c.36.1.10 (A:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a2 c.36.1.12 (A:786-1232) Pyruvate-ferredoxin oxidoreductase, PFOR, domains VI {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1ozha2 c.36.1.5 (A:7-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d2djia2 c.36.1.5 (A:3-186) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1zpda2 c.36.1.5 (A:2-187) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1t9ba2 c.36.1.5 (A:89-263) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ez9a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1q6za2 c.36.1.5 (A:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2r8oa1 c.36.1.6 (A:333-527) Transketolase (TK), Pyr module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1r9ja1 c.36.1.6 (A:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]} Back     information, alignment and structure
>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ovma2 c.36.1.5 (A:3-180) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1umdb1 c.36.1.7 (B:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qs0b1 c.36.1.7 (B:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ozlb1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure