Psyllid ID: psy4900

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----
MLYFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
ccEEEcccccccccccEEEccccccEEcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEccccccccccccccccccccccccccccccEEEccccccccEEEEccccccccccccccccccccccccEEEccccEEccccccccccccccccccccccccccccccEEccccEEEcccEEEccccccccccccccccccccccccccEEEEEccccccccEEEEccccccccccccccEEEcccccccEEEEEEcccccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccc
ccccccccccccccccEEcccccccEEccEEEEcccccccccccccccccccccccccccEEcccccEEccccEEEcccccccccccccccccccccccccEcccccEccccEEcccccccccccccccccccccccccccccccccccccEEccccEEccccccccccccccccccccccccccEEccccccccEEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEccccccEccccEEEcccccccccccccccccccccccEEEcccccEEEHHHcccccccccccHHHccccccccccccEEEcccEEccccEEEcccccccccccccccEEEEEEcccccEEEEEccccccccEEEEEccccEEEEEcccHEEEEcccccccEEEEEcccccccEEEEEccccEEEEEEccccEEEEEEccccccEEEEEcccc
mlyfqvpnfrkcspgdfecdpphgicipkdkrcdgyydcrnrkdeegcpattglscdldqfrcangqkcidaklkcnyhndcgdnsdeekcnftachvgqfkcanslcipvsyhcdgyrdcidgsdetnctsiacpnnkflcpmgaaggkpkcipkaqvcdgrkdcednadeetvccdcsllnceftcqasptggvcqcpegqkvandsrTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKvrklpttaepqspnpcgsnnggcehMCIITRAsgnalgykcacdigyrlsvngnncnqptcapgefqcasgrcvpstfkcdaendcgdysdetgcvnvtcslsqfacengrcvpstwkcdsendcgdgsdegdfcsektcAYFQFHAIVlgsnltnptdlaldptsglmfvadSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
mlyfqvpnfrkcspgdfecdpphgicipkdkrCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAvrsstvsshvklVLLEVYVNVLKVRKlpttaepqspnpcgsnnGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
MLYFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
**YFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKL****************GGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLIL*****
MLYFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRF*IL*****
MLYFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
****QVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYFQVPNFRKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWKCDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query485 2.2.26 [Sep-21-2011]
Q04833 4753 Low-density lipoprotein r yes N/A 0.872 0.088 0.294 9e-46
Q07954 4544 Prolow-density lipoprotei yes N/A 0.680 0.072 0.342 3e-35
Q91ZX7 4545 Prolow-density lipoprotei yes N/A 0.680 0.072 0.342 3e-35
O75096 1905 Low-density lipoprotein r no N/A 0.604 0.153 0.342 4e-34
P98157 4543 Low-density lipoprotein r no N/A 0.678 0.072 0.335 5e-34
A2ARV4 4660 Low-density lipoprotein r no N/A 0.907 0.094 0.280 1e-33
P98155 873 Very low-density lipoprot no N/A 0.639 0.355 0.329 2e-33
P98156 873 Very low-density lipoprot no N/A 0.639 0.355 0.324 8e-33
P98166 873 Very low-density lipoprot no N/A 0.639 0.355 0.324 1e-32
P35953 873 Very low-density lipoprot no N/A 0.632 0.351 0.324 2e-32
>sp|Q04833|LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans GN=lrp-1 PE=1 SV=1 Back     alignment and function desciption
 Score =  185 bits (469), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 141/478 (29%), Positives = 208/478 (43%), Gaps = 55/478 (11%)

Query: 26  CIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDN 85
           C    K+CDG YDCR+  DE+   +    +C   QFRCA+  +CI     C+   DC D 
Sbjct: 152 CFDVSKKCDGKYDCRDLSDEKDSCSRNHTACFQYQFRCADKTQCIQKSWVCDGSKDCADG 211

Query: 86  SDE-EKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPM 144
           SDE + C F  C   +F+C N  C P  + CD Y DC D SDE  C    CP  K+ CP 
Sbjct: 212 SDEPDTCEFKKCTANEFQCKNKRCQPRKFRCDYYDDCGDNSDEDECGEYRCPPGKWNCP- 270

Query: 145 GAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCD-CSLLNCEFTCQASPTGGVCQCPEGQ 203
               G   CI + ++CDG KDC D ADE+    + C  L C+  C  SP GG C CP G 
Sbjct: 271 ----GTGHCIDQLKLCDGSKDCADGADEQQCSQNLCPSLGCQAGCHPSPHGGECTCPSGY 326

Query: 204 KVAND-SRTCLLYMKNNLKQAVR----SSTVSSHVKLVLLEVYVN--VLKVRKLPTTAEP 256
           K+ +   RTC     +++ +           ++H          +   L++   P     
Sbjct: 327 KLDDRFHRTC-----SDINECAEFGYCDQLCANHRPGFTCSCLGDCFTLQMEHGPGKDNL 381

Query: 257 QSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCA- 315
                C SNN     + +  R               YRL+    +      A GEF    
Sbjct: 382 TMRGYCVSNNADKMKLFVARREG------------LYRLNPKNPDEEVKKLASGEFIYGI 429

Query: 316 -----------SGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFACENGRCVPSTWK 364
                      + R   S F  D         D+ G ++    LS  +    RC+   W 
Sbjct: 430 DFDYGDRKIFWTDRLAHSAFSADV--------DDEGEISQIKKLSLKSLVYPRCLAVDWI 481

Query: 365 CDSENDCGDGSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQIL 424
            ++      GS   D  S       +   ++L   LT P D+ALDP  G MF  +  ++ 
Sbjct: 482 TNTLYIIESGSRRIDVSSYDG----ERRTVLLADGLTLPLDIALDPLRGEMFFTNQLKLE 537

Query: 425 RTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRG 482
              MDGT   ++V+   ++ SG+ +DI AKR++W D  +D +E++DY+G +R ++ +G
Sbjct: 538 AAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYWVDPKVDRLESIDYQGNDRRIVAQG 595
May act as a receptor for the endocytosis of extracellular ligands such as chylomicron remnants, protease-inhibitor complexes and vitellogenin.
Caenorhabditis elegans (taxid: 6239)
>sp|Q07954|LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q91ZX7|LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus GN=Lrp1 PE=1 SV=1 Back     alignment and function description
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function description
>sp|P98157|LRP1_CHICK Low-density lipoprotein receptor-related protein 1 OS=Gallus gallus GN=LRP1 PE=2 SV=1 Back     alignment and function description
>sp|A2ARV4|LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus GN=Lrp2 PE=1 SV=1 Back     alignment and function description
>sp|P98155|VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens GN=VLDLR PE=1 SV=1 Back     alignment and function description
>sp|P98156|VLDLR_MOUSE Very low-density lipoprotein receptor OS=Mus musculus GN=Vldlr PE=1 SV=1 Back     alignment and function description
>sp|P98166|VLDLR_RAT Very low-density lipoprotein receptor OS=Rattus norvegicus GN=Vldlr PE=2 SV=1 Back     alignment and function description
>sp|P35953|VLDLR_RABIT Very low-density lipoprotein receptor OS=Oryctolagus cuniculus GN=VLDLR PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
198471567 4543 GA11430 [Drosophila pseudoobscura pseudo 0.865 0.092 0.446 1e-105
194769742 4648 GF21799 [Drosophila ananassae] gi|190622 0.865 0.090 0.444 1e-105
312381670 4689 hypothetical protein AND_05975 [Anophele 0.863 0.089 0.447 1e-104
195393330 4631 GJ18862 [Drosophila virilis] gi|19414981 0.865 0.090 0.443 1e-104
157124457 4525 low-density lipoprotein receptor (ldl) [ 0.865 0.092 0.445 1e-104
281360654 4769 megalin, isoform A [Drosophila melanogas 0.865 0.088 0.443 1e-104
195049411 4576 GH24913 [Drosophila grimshawi] gi|193893 0.861 0.091 0.441 1e-103
347963623 4655 AGAP000331-PA [Anopheles gambiae str. PE 0.863 0.090 0.442 1e-103
195132161 4555 GI15973 [Drosophila mojavensis] gi|19390 0.865 0.092 0.444 1e-103
195481687 3879 GE15450 [Drosophila yakuba] gi|194189263 0.865 0.108 0.443 1e-103
>gi|198471567|ref|XP_001355664.2| GA11430 [Drosophila pseudoobscura pseudoobscura] gi|198145975|gb|EAL32723.2| GA11430 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 231/517 (44%), Positives = 288/517 (55%), Gaps = 97/517 (18%)

Query: 9   FRKCSPGDFECDPPHGI-----------CIPKDKRCDGYYDCRNRKDEEGCPATTGLSCD 57
           +RKC   D  C+ P+G            C+PK+KRCDGY DCR  +DE+GC    G++C 
Sbjct: 12  YRKCQHTDVFCNAPNGAAPAEGTRLAGPCVPKEKRCDGYLDCRTGRDEDGC---NGVACR 68

Query: 58  LDQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDG 117
           LDQFRCANG KCIDA LKCN+ +DCGDNSDE+ CNF  CH  QF+C N+LCIP ++HCDG
Sbjct: 69  LDQFRCANGHKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTNALCIPYNFHCDG 128

Query: 118 YRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVC- 176
           Y DC D SDE NCT+IACP+NKFLCP G   G PKCI K+Q+CDG++DCED +DEET C 
Sbjct: 129 YHDCADKSDEANCTAIACPDNKFLCPRGGVNGAPKCILKSQLCDGKRDCEDGSDEETNCS 188

Query: 177 -CDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKL 235
              C  L+CEF C  S TGGVC C  GQ +A D+RTC+                      
Sbjct: 189 IASCPALSCEFKCGPSLTGGVCYCRPGQSLAPDNRTCV---------------------- 226

Query: 236 VLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRL 295
                         L   AE           G C+ +C  T  S     Y C C  GY L
Sbjct: 227 -------------DLDECAE----------WGHCDQLCTNTLGS-----YTCQCAQGYTL 258

Query: 296 SVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCS-------- 347
            +N + C  P     +   A  R +   F   A  D    ++ T    V+          
Sbjct: 259 -INESKCIAPNANNLQLIFAHDRAIMRMFAHGA--DPRILANATAAAGVSFHYARNTLYW 315

Query: 348 ---------------LSQFACENGRCVPSTWK--CDSENDCGDGSDEGDFCSEKTCAYF- 389
                          L++      + +P TW     + +  GD     D   +K   +  
Sbjct: 316 SDIKTRKVQSLPLNPLNKGLSSFDQTLPGTWAPVALAVDWVGDKIYVADLVGQKIDVFEL 375

Query: 390 --QFHAIVLGSNLTNPTDLALDPTSGLMFVADSNQILRTNMDGTMAMSIVSEAAYKASGV 447
             Q+HA+VLGSNLT+P DLALDPTSGLMFVAD  Q+LR +MDGT A SIVSEAAYKASGV
Sbjct: 376 SGQWHAVVLGSNLTSPADLALDPTSGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGV 435

Query: 448 ALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQ 484
            +DI +KR+FWCD+LLDYIE+VDYEG +R ++LRG Q
Sbjct: 436 TVDIISKRVFWCDSLLDYIESVDYEGAHRVMVLRGQQ 472

Source: Drosophila pseudoobscura pseudoobscura

Species: Drosophila pseudoobscura

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194769742|ref|XP_001966960.1| GF21799 [Drosophila ananassae] gi|190622755|gb|EDV38279.1| GF21799 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|312381670|gb|EFR27366.1| hypothetical protein AND_05975 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195393330|ref|XP_002055307.1| GJ18862 [Drosophila virilis] gi|194149817|gb|EDW65508.1| GJ18862 [Drosophila virilis] Back     alignment and taxonomy information
>gi|157124457|ref|XP_001660469.1| low-density lipoprotein receptor (ldl) [Aedes aegypti] gi|108873980|gb|EAT38205.1| AAEL009869-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|281360654|ref|NP_001096924.2| megalin, isoform A [Drosophila melanogaster] gi|272506047|gb|ABW09371.2| megalin, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195049411|ref|XP_001992716.1| GH24913 [Drosophila grimshawi] gi|193893557|gb|EDV92423.1| GH24913 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|347963623|ref|XP_310784.4| AGAP000331-PA [Anopheles gambiae str. PEST] gi|333467112|gb|EAA06237.5| AGAP000331-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195132161|ref|XP_002010512.1| GI15973 [Drosophila mojavensis] gi|193908962|gb|EDW07829.1| GI15973 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195481687|ref|XP_002101739.1| GE15450 [Drosophila yakuba] gi|194189263|gb|EDX02847.1| GE15450 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query485
FB|FBgn0261260 4769 mgl "Megalin" [Drosophila mela 0.416 0.042 0.589 2.4e-137
RGD|68407 4660 Lrp2 "low density lipoprotein 0.719 0.074 0.331 3.5e-49
UNIPROTKB|P98158 4660 Lrp2 "Low-density lipoprotein 0.719 0.074 0.331 3.5e-49
WB|WBGene00003071 4753 lrp-1 [Caenorhabditis elegans 0.373 0.038 0.413 9.2e-83
UNIPROTKB|F1NJS9 4644 LRP2 "Uncharacterized protein" 0.727 0.076 0.338 2.7e-53
UNIPROTKB|F1NCT2 4645 LRP2 "Uncharacterized protein" 0.727 0.075 0.338 2.7e-53
MGI|MGI:95794 4660 Lrp2 "low density lipoprotein 0.725 0.075 0.321 1.2e-50
ZFIN|ZDB-GENE-050119-2 4673 lrp2a "low density lipoprotein 0.659 0.068 0.331 4.1e-48
UNIPROTKB|F1N6H1 4626 LRP2 "Uncharacterized protein" 0.729 0.076 0.325 5.7e-49
UNIPROTKB|P98164 4655 LRP2 "Low-density lipoprotein 0.727 0.075 0.331 1.2e-48
FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 739 (265.2 bits), Expect = 2.4e-137, Sum P(4) = 2.4e-137
 Identities = 128/217 (58%), Positives = 154/217 (70%)

Query:     9 FRKCSPGDFECDPPHGI----------CIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDL 58
             +RKC   D  C+ P G           C+PK+KRCDGY DCR  +DE GC   +G++C L
Sbjct:   238 YRKCQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYLDCRTGRDEVGC---SGVACRL 294

Query:    59 DQFRCANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGY 118
             DQFRCANG KCIDA LKCN+ +DCGDNSDE+ CNF  CH  QF+C N+LCIP ++HCDGY
Sbjct:   295 DQFRCANGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTNALCIPYNFHCDGY 354

Query:   119 RDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVC-- 176
              DC D SDE NCT+IACP+NK LCP G A G PKCI K+Q+CDG++DCED +DEET C  
Sbjct:   355 HDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILKSQLCDGKRDCEDGSDEETNCSI 414

Query:   177 CDCSLLNCEFTCQASPTGGVCQCPEGQKVANDSRTCL 213
               C  L+CEF C  S TGGVC C  GQ +A D+RTC+
Sbjct:   415 ASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTCV 451
GO:0005041 "low-density lipoprotein receptor activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0030100 "regulation of endocytosis" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0040003 "chitin-based cuticle development" evidence=IMP
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IMP
RGD|68407 Lrp2 "low density lipoprotein receptor-related protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P98158 Lrp2 "Low-density lipoprotein receptor-related protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00003071 lrp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJS9 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NCT2 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:95794 Lrp2 "low density lipoprotein receptor-related protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050119-2 lrp2a "low density lipoprotein receptor-related protein 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6H1 LRP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P98164 LRP2 "Low-density lipoprotein receptor-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-09
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 2e-09
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 2e-09
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-09
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 1e-08
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 4e-08
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 5e-08
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 6e-08
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-07
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-07
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 2e-06
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 5e-06
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 5e-06
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-05
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 1e-05
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 3e-05
pfam12999176 pfam12999, PRKCSH-like, Glucosidase II beta subuni 1e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 3e-04
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 7e-04
pfam12999176 pfam12999, PRKCSH-like, Glucosidase II beta subuni 0.002
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information 
 Score = 53.4 bits (129), Expect = 1e-09
 Identities = 22/35 (62%), Positives = 28/35 (80%)

Query: 307 CAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGC 341
           C P EF+CA+GRC+PS++ CD E+DCGD SDE  C
Sbjct: 1   CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35

Length = 35
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>gnl|CDD|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|193472 pfam12999, PRKCSH-like, Glucosidase II beta subunit-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 485
KOG1215|consensus 877 100.0
KOG1214|consensus1289 99.96
KOG1214|consensus 1289 99.94
KOG1215|consensus 877 99.87
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 99.24
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.92
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.89
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 98.86
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.83
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 98.8
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 98.58
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.57
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.49
smart0019233 LDLa Low-density lipoprotein receptor domain class 98.44
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.35
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.32
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.23
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.2
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 98.14
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.06
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 97.98
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.96
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.86
PF1266224 cEGF: Complement Clr-like EGF-like 97.74
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.52
KOG4659|consensus 1899 97.49
PF1266224 cEGF: Complement Clr-like EGF-like 97.39
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.29
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.09
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 96.98
KOG1520|consensus 376 96.83
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 96.82
COG3386 307 Gluconolactonase [Carbohydrate transport and metab 96.79
KOG1520|consensus 376 96.75
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.61
KOG4659|consensus 1899 96.42
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.32
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.04
KOG4499|consensus310 95.91
COG3391 381 Uncharacterized conserved protein [Function unknow 95.59
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 95.57
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 95.47
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 95.35
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.31
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.21
PRK11028 330 6-phosphogluconolactonase; Provisional 95.19
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.1
KOG1219|consensus 4289 95.09
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.97
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 94.68
KOG2397|consensus480 94.61
PRK11028 330 6-phosphogluconolactonase; Provisional 94.5
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.41
KOG2397|consensus480 94.35
KOG3509|consensus 964 94.27
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 94.04
KOG3509|consensus 964 93.5
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.09
COG3391381 Uncharacterized conserved protein [Function unknow 93.04
smart0017939 EGF_CA Calcium-binding EGF-like domain. 93.03
smart0017939 EGF_CA Calcium-binding EGF-like domain. 92.94
KOG1219|consensus 4289 92.91
PRK04043419 tolB translocation protein TolB; Provisional 92.89
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 91.95
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 91.89
PRK04922433 tolB translocation protein TolB; Provisional 91.88
PRK04043419 tolB translocation protein TolB; Provisional 91.8
PRK04792448 tolB translocation protein TolB; Provisional 91.1
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 91.04
smart0018135 EGF Epidermal growth factor-like domain. 90.95
KOG4260|consensus350 90.9
PRK00178430 tolB translocation protein TolB; Provisional 90.57
PRK01029428 tolB translocation protein TolB; Provisional 90.54
smart0018135 EGF Epidermal growth factor-like domain. 90.47
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.45
PRK04792448 tolB translocation protein TolB; Provisional 90.44
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 90.43
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.25
PRK02889427 tolB translocation protein TolB; Provisional 90.08
PRK05137435 tolB translocation protein TolB; Provisional 89.93
KOG4260|consensus350 89.93
PRK04922433 tolB translocation protein TolB; Provisional 89.58
PRK03629429 tolB translocation protein TolB; Provisional 88.99
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 88.98
PRK05137435 tolB translocation protein TolB; Provisional 88.62
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 88.55
PF0906434 Tme5_EGF_like: Thrombomodulin like fifth domain, E 88.01
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 87.32
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 87.23
PRK02889427 tolB translocation protein TolB; Provisional 87.03
PRK00178430 tolB translocation protein TolB; Provisional 86.17
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 85.89
cd0005336 EGF Epidermal growth factor domain, found in epide 85.64
PF13449 326 Phytase-like: Esterase-like activity of phytase 84.75
PRK03629 429 tolB translocation protein TolB; Provisional 84.27
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 84.25
PRK01029428 tolB translocation protein TolB; Provisional 84.04
cd0005336 EGF Epidermal growth factor domain, found in epide 82.56
KOG4289|consensus 2531 81.98
COG2133 399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 81.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 81.1
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 80.5
PF0000832 EGF: EGF-like domain This is a sub-family of the P 80.11
>KOG1215|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.7e-33  Score=315.49  Aligned_cols=425  Identities=28%  Similarity=0.536  Sum_probs=285.9

Q ss_pred             CCCCCCcEEecCCCCceecCCcccCCcCCCCCCCcCCCCCCCCCCCCCCCCeecCCCCceecCcceeCCCCCCCCCCccc
Q psy4900          10 RKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEE   89 (485)
Q Consensus        10 ~~C~~~~f~C~c~~g~ci~~~~~Cd~~~dC~d~sdE~~C~~~~~~~C~~~~f~C~~g~~Ci~~~~~Cd~~~dC~d~sDe~   89 (485)
                      ..|...+|+|...++.||+..|+||+..+|.+|+||..|... ...+....|+|      |...++||...+|.+++|+.
T Consensus       136 ~~~~~~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de~~~~~~-~~~~~~~~~~~------~~~~~~~d~~~~~~~~~d~~  208 (877)
T KOG1215|consen  136 SHCCLDKFSCRTGSCKCIPGDWLCDGEADCPDGSDELNCAVR-RCEPRGASLDC------IVAIKVCDIQHDCADDYDES  208 (877)
T ss_pred             ccccCCCCCCcCccccCCCCceeCCCCCccccchhhhccccc-ccCcccccccc------ceeeeecCcccccccccccc
Confidence            456778899943389999999999999999999999998731 12334445666      88889999999999999998


Q ss_pred             CCCCCccC---CCcccCCC-CcccCccccCCCCCCCCCCCCCC--CCCCCCcCCCceecCCCCCCCCCcccCCCcccCCC
Q psy4900          90 KCNFTACH---VGQFKCAN-SLCIPVSYHCDGYRDCIDGSDET--NCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGR  163 (485)
Q Consensus        90 ~C~~~~C~---~~~f~C~~-~~Ci~~~~~Cdg~~dC~dgsDe~--~C~~~~c~~~~~~C~~g~~~~~~~Ci~~~~~Cdg~  163 (485)
                      .+....+.   ...++|.. ..||..+|+||+..||.+++||.  .|....|...++.|.++      .|++..++|+|.
T Consensus       209 ~~~~~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de~~~~~~~~~~~~~e~~~~~~------~~~~~~~~~~g~  282 (877)
T KOG1215|consen  209 EGRIYWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGPDEGVMNCSDATCEAPEIECADG------DCSDRQKLCDGD  282 (877)
T ss_pred             cCcccccCCcceeEEEecCCCcEEeehhccCCCcccccCCcCceeEeeccccCCcceeecCC------CCccceEEecCc
Confidence            87654444   46788986 49999999999999999999995  67777777778999888      999999999999


Q ss_pred             CCCCCCccccCcccCCCCCCc---cccccCC--CCCCeeeCCCCceeeCCCCCCCCcchhhhccccccccccccceehee
Q psy4900         164 KDCEDNADEETVCCDCSLLNC---EFTCQAS--PTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLL  238 (485)
Q Consensus       164 ~dC~d~sDe~~~C~~C~~~~C---~~~C~n~--~~~~~C~C~~G~~l~~~~~~C~d~~e~~~~~~~~~~~~~~~~~~~~~  238 (485)
                      .||++++||..    |....+   .+.|...  +....|  .. + .....+.|.......          ..+.+....
T Consensus       283 ~d~pdg~de~~----~~~~~~~~~~~d~~~~~i~~~~~~--~~-~-~~~~~~~~~~~~~~~----------~~~~~~~~v  344 (877)
T KOG1215|consen  283 LDCPDGLDEDY----CKKKLYWSMNVDGSGRRILLSKLC--HG-Y-WTDGLNECAERVLKC----------SHKCPDVSV  344 (877)
T ss_pred             cCCCCcccccc----cccceeeeeecccCCceeeecccC--cc-c-cccccccchhhcccc----------cCCCCcccc
Confidence            99999999974    332100   1111110  000000  00 0 000111111111000          000000000


Q ss_pred             heeeeeeecccCCCCCCCCCCCCCCCCCCCcccccc-ccccCCCCCCccccCCCCccccCCCCCCCC-CCCCCceEEcCC
Q psy4900         239 EVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCI-ITRASGNALGYKCACDIGYRLSVNGNNCNQ-PTCAPGEFQCAS  316 (485)
Q Consensus       239 ~~~~~~~~~~~~~~~~e~~~~~~C~~~~g~C~~~C~-n~~~~~~~g~~~C~C~~Gy~l~~d~~~C~~-~~C~~~~~~c~~  316 (485)
                      ...........+...... ..+.|...++.|+|+|+ +.+     +.|+|.|..||.+..++  |.. ....+.++.+..
T Consensus       345 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~g~Csq~C~~~~p-----~~~~c~c~~g~~~~~~~--c~~~~~~~~~l~~s~~  416 (877)
T KOG1215|consen  345 GPRCDCMGAKVLPLGART-DSNPCESDNGGCSQLCVPNSP-----GTFKCACSPGYELRLDK--CEASDQPEAFLLFSNR  416 (877)
T ss_pred             CCcccCCccceecccccc-cCCcccccCCccceeccCCCC-----CceeEecCCCcEeccCC--ceecCCCCcEEEEecC
Confidence            000000000000000000 11236657899999999 446     89999999999998876  644 224445555532


Q ss_pred             CCcccCceeec-------CC--------------CCCCCCCcCCCCCCcc-ccCCcccCCCCceeccccccCC--CCccC
Q psy4900         317 GRCVPSTFKCD-------AE--------------NDCGDYSDETGCVNVT-CSLSQFACENGRCVPSTWKCDS--ENDCG  372 (485)
Q Consensus       317 g~ci~~~~~cd-------~~--------------~dc~d~sde~~c~~~~-~~~~~~~~~~~~~i~~~~~~~~--~~~y~  372 (485)
                      ........-+.       ..              ....|.+++..+.... ......++.+|.+++..+.+++  +++||
T Consensus       417 ~~ir~~~~~~~~~~~p~~~~~~~~~~d~d~~~~~i~~~d~~~~~i~~~~~~~~~~~~~~~~g~~~~~~lavD~~~~~~y~  496 (877)
T KOG1215|consen  417 HDIRRISLDCSDVSRPLEGIKNAVALDFDVLNNRIYWADLSDEKICRASQDGSSECELCGDGLCIPEGLAVDWIGDNIYW  496 (877)
T ss_pred             ccceecccCCCcceEEccCCccceEEEEEecCCEEEEEeccCCeEeeeccCCCccceEeccCccccCcEEEEeccCCcee
Confidence            21111111111       00              0011111111111000 0111124566777777777776  89999


Q ss_pred             CCCC--CccccccCcccccceEEEEecCCCCCCccEEecCCCCeEEEeC---CCcEEEEEcCCCCcEEEEeCCCcccceE
Q psy4900         373 DGSD--EGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVAD---SNQILRTNMDGTMAMSIVSEAAYKASGV  447 (485)
Q Consensus       373 ~d~~--~I~~~~~~~c~~g~~~~~l~~~~~~~p~~iavD~~~~~lywtd---~~~I~r~~~dG~~~~~i~~~~~~~p~gl  447 (485)
                      +|..  .|.+..++    |+++.+|+..++..|+++++||..|+|||+|   .++|+|+.|||..+.+++..++.||+||
T Consensus       497 tDe~~~~i~v~~~~----g~~~~vl~~~~l~~~r~~~v~p~~g~~~wtd~~~~~~i~ra~~dg~~~~~l~~~~~~~p~gl  572 (877)
T KOG1215|consen  497 TDEGNCLIEVADLD----GSSRKVLVSKDLDLPRSIAVDPEKGLMFWTDWGQPPRIERASLDGSERAVLVTNGILWPNGL  572 (877)
T ss_pred             cccCCceeEEEEcc----CCceeEEEecCCCCccceeeccccCeeEEecCCCCchhhhhcCCCCCceEEEeCCccCCCcc
Confidence            9998  88889999    9999999999999999999999999999999   3589999999999999999999999999


Q ss_pred             EEeCCCCeEEEEeCCCC-cEEEEEccCCCeE
Q psy4900         448 ALDINAKRLFWCDNLLD-YIETVDYEGKNRF  477 (485)
Q Consensus       448 avD~~~~~lYW~D~~~~-~I~~~~~dG~~r~  477 (485)
                      ++|...+++||+|.... .|+.++++|+.|+
T Consensus       573 t~d~~~~~~yw~d~~~~~~i~~~~~~g~~r~  603 (877)
T KOG1215|consen  573 TIDYETDRLYWADAKLDYTIESANMDGQNRR  603 (877)
T ss_pred             eEEeecceeEEEcccCCcceeeeecCCCceE
Confidence            99999999999999998 8999999999998

>KOG1214|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 3e-27
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 5e-13
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 6e-08
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 5e-27
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 5e-13
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 3e-08
2fyj_A82 Nmr Solution Structure Of Calcium-Loaded Lrp Double 4e-17
2fcw_B80 Structure Of A Complex Between The Pair Of The Ldl 1e-12
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 2e-12
3s94_A 619 Crystal Structure Of Lrp6-E1e2 Length = 619 1e-10
4dg6_A 616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 2e-12
4dg6_A 616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 1e-10
3soq_A 318 The Structure Of The First Ywtd Beta Propeller Doma 8e-11
3sob_B 316 The Structure Of The First Ywtd Beta Propeller Doma 1e-10
1f5y_A85 Nmr Structure Of A Concatemer Of The First And Seco 3e-09
2xrc_A565 Human Complement Factor I Length = 565 5e-09
2xrc_A 565 Human Complement Factor I Length = 565 5e-08
2lgp_A94 Solution Structure Of La45 From Ldlr Length = 94 2e-08
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 8e-08
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 7e-07
3s8v_A623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 8e-08
3s8v_A 623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 8e-07
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 1e-07
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 7e-07
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 1e-07
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-07
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 1e-05
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 3e-07
1ijq_A 316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 1e-06
1j8e_A44 Crystal Structure Of Ligand-Binding Repeat Cr7 From 3e-06
1j8e_A44 Crystal Structure Of Ligand-Binding Repeat Cr7 From 1e-05
1d2j_A40 Ldl Receptor Ligand-Binding Module 6 Length = 40 6e-06
1f8z_A39 Nmr Structure Of The Sixth Ligand-Binding Module Of 6e-06
3v64_C 349 Crystal Structure Of Agrin And Lrp4 Length = 349 2e-05
1d2l_A45 Nmr Solution Structure Of Complement-Like Repeat Cr 4e-05
1d2l_A45 Nmr Solution Structure Of Complement-Like Repeat Cr 6e-04
3a7q_B44 Structural Basis For Specific Recognition Of Reelin 7e-05
2m0p_A52 Solution Structure Of The Tenth Complement Type Rep 2e-04
1cr8_A42 Low Density Lipoprotein Receptor-Related Protein Co 5e-04
1k7b_A47 Nmr Solution Structure Of Stva47, The Viral-Binding 8e-04
3t5o_A 913 Crystal Structure Of Human Complement Component C6 8e-04
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (298), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 141/503 (28%), Positives = 206/503 (40%), Gaps = 90/503 (17%)
Query: 12  CSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCID 71
           C  GDF C      CIP+  RCDG  DC N  DE+GCP  T   C  D+FRC +G KCI 
Sbjct: 47  CKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKT---CSQDEFRCHDG-KCIS 102
Query: 72  AKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDET--- 128
            +  C+   DC D SDE  C    C    F+C +S CIP  + CD   DC DGSDE    
Sbjct: 103 RQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQR 162
Query: 129 -------NCTSIACPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCSL 181
                     S  C   +F C  G      +CI  +  CDG  DC+D +DEE    +C++
Sbjct: 163 CRGLYVFQGDSSPCSAFEFHCLSG------ECIHSSWRCDGGPDCKDKSDEE----NCAV 212
Query: 182 LNC---EFTCQ-ASPTGGVCQCPEGQ--KVANDSRTCLLYMKNNLKQAVRSSTVSSHV-K 234
             C   EF C   +   G  QC      K  +D   C+     N+      +    H  +
Sbjct: 213 ATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCV-----NVTLCEGPNKFKCHSGE 267
Query: 235 LVLLEVYVNVLKVRKLPTTAEPQSP---NPCGSNNGGCEHMCIITRASGNALGYKCACDI 291
            + L+   N+ +  +   + EP      N C  NNGGC H+C   +     +GY+C C  
Sbjct: 268 CITLDKVCNMARDCR-DWSDEPIKECGTNECLDNNGGCSHVCNDLK-----IGYECLC-- 319
Query: 292 GYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQF 351
                            P  FQ  + R      +C   + C        CVN+     + 
Sbjct: 320 -----------------PDGFQLVAQRRCEDIDECQDPDTCSQL-----CVNLEGGY-KC 356
Query: 352 ACENG-RCVPSTWKCDSENDCGDGSDEGDFCSEK------TCAYFQFHAIVLGSNLTNPT 404
            CE G +  P T  C +      GS    F + +      T    ++ +++   NL N  
Sbjct: 357 QCEEGFQLDPHTKACKAV-----GSIAYLFFTNRHEVRKMTLDRSEYTSLI--PNLRNVV 409
Query: 405 DLALDPTSGLMFVADSNQ--ILRTNMDGTMAMS----IVSEAAYKASGVALDINAKRLFW 458
            L  +  S  ++ +D +Q  I  T +D    +S    ++S       G+A+D     ++W
Sbjct: 410 ALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYW 469
Query: 459 CDNLLDYIETVDYEGKNRFLILR 481
            D++L  +   D +G  R  + R
Sbjct: 470 TDSVLGTVSVADTKGVKRKTLFR 492
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 Back     alignment and structure
>pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|1J8E|A Chain A, Crystal Structure Of Ligand-Binding Repeat Cr7 From Lrp Length = 44 Back     alignment and structure
>pdb|1J8E|A Chain A, Crystal Structure Of Ligand-Binding Repeat Cr7 From Lrp Length = 44 Back     alignment and structure
>pdb|1D2J|A Chain A, Ldl Receptor Ligand-Binding Module 6 Length = 40 Back     alignment and structure
>pdb|1F8Z|A Chain A, Nmr Structure Of The Sixth Ligand-Binding Module Of The Ldl Receptor Length = 39 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 Back     alignment and structure
>pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 Back     alignment and structure
>pdb|3A7Q|B Chain B, Structural Basis For Specific Recognition Of Reelin By Its Receptors Length = 44 Back     alignment and structure
>pdb|2M0P|A Chain A, Solution Structure Of The Tenth Complement Type Repeat Of Human Megalin Length = 52 Back     alignment and structure
>pdb|1CR8|A Chain A, Low Density Lipoprotein Receptor-Related Protein Complement Repeat 8 Length = 42 Back     alignment and structure
>pdb|1K7B|A Chain A, Nmr Solution Structure Of Stva47, The Viral-Binding Domain Of Tva Length = 47 Back     alignment and structure
>pdb|3T5O|A Chain A, Crystal Structure Of Human Complement Component C6 Length = 913 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query485
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 2e-47
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-44
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 4e-44
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 3e-23
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 4e-14
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-07
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-46
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-45
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-44
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 7e-33
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-25
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 9e-23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-08
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 5e-05
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 4e-28
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 3e-24
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 1e-21
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-19
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 2e-12
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 5e-12
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-25
2fyj_A82 Low-density lipoprotein receptor-related protein 1 6e-23
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-18
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-11
2fyj_A82 Low-density lipoprotein receptor-related protein 1 9e-11
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 9e-21
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 1e-13
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-12
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 2e-04
3v65_B386 Low-density lipoprotein receptor-related protein; 8e-19
3v65_B 386 Low-density lipoprotein receptor-related protein; 8e-18
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 2e-18
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 6e-17
3p5b_L400 Low density lipoprotein receptor variant; B-propel 5e-05
2xrc_A565 Human complement factor I; immune system, hydrolas 9e-18
2xrc_A 565 Human complement factor I; immune system, hydrolas 9e-16
2xrc_A 565 Human complement factor I; immune system, hydrolas 4e-04
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 3e-16
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 3e-12
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 1e-10
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 8e-09
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-05
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 7e-16
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 8e-13
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 6e-10
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 3e-08
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 4e-06
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 6e-15
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 2e-04
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 9e-15
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 4e-09
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 5e-08
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-07
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 4e-05
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 3e-14
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 4e-10
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-09
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 9e-08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 2e-07
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 4e-05
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 1e-13
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 4e-09
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 6e-09
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-06
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-12
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-11
3a7q_B44 Low-density lipoprotein receptor-related protein; 1e-09
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 2e-05
3a7q_B44 Low-density lipoprotein receptor-related protein; 3e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-11
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-10
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 3e-09
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 1e-07
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 4e-05
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 5e-05
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 3e-11
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 8e-11
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 4e-09
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 7e-09
1j8e_A44 Low-density lipoprotein receptor-related protein 1 6e-11
1j8e_A44 Low-density lipoprotein receptor-related protein 1 8e-11
1j8e_A44 Low-density lipoprotein receptor-related protein 1 8e-09
1j8e_A44 Low-density lipoprotein receptor-related protein 1 6e-08
1j8e_A44 Low-density lipoprotein receptor-related protein 1 1e-04
1j8e_A44 Low-density lipoprotein receptor-related protein 1 2e-04
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 7e-11
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 3e-10
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-09
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 4e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 8e-06
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-04
2i1p_A48 Low-density lipoprotein receptor-related protein 2 4e-10
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-09
2i1p_A48 Low-density lipoprotein receptor-related protein 2 3e-09
2i1p_A48 Low-density lipoprotein receptor-related protein 2 9e-09
2i1p_A48 Low-density lipoprotein receptor-related protein 2 5e-06
2i1p_A48 Low-density lipoprotein receptor-related protein 2 2e-04
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-10
2knx_A50 Prolow-density lipoprotein receptor-related prote; 4e-09
2knx_A50 Prolow-density lipoprotein receptor-related prote; 5e-08
2knx_A50 Prolow-density lipoprotein receptor-related prote; 1e-07
2knx_A50 Prolow-density lipoprotein receptor-related prote; 7e-06
2knx_A50 Prolow-density lipoprotein receptor-related prote; 3e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 8e-10
1cr8_A42 Protein (LOW density lipoprotein receptor related 5e-09
1cr8_A42 Protein (LOW density lipoprotein receptor related 1e-08
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-07
1cr8_A42 Protein (LOW density lipoprotein receptor related 3e-06
1cr8_A42 Protein (LOW density lipoprotein receptor related 1e-04
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 2e-08
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 3e-08
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 6e-08
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 1e-07
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 4e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 1e-04
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-08
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 5e-08
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 3e-06
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 5e-06
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 6e-08
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 1e-07
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-07
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 3e-06
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-05
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 2e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 7e-08
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 1e-07
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-07
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 5e-07
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-05
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 4e-05
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 8e-08
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 2e-07
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 2e-04
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 5e-04
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 1e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 5e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 5e-07
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 3e-05
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 8e-05
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 2e-05
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 2e-05
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 3e-05
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 3e-05
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 1e-04
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 7e-04
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 9e-04
2wph_E59 Coagulation factor IXA light chain; serine proteas 4e-05
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 1e-04
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 1e-04
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 5e-04
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
 Score =  173 bits (440), Expect = 2e-47
 Identities = 105/503 (20%), Positives = 165/503 (32%), Gaps = 71/503 (14%)

Query: 10  RKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPAT-------TGLSCDLDQFR 62
             C P  F+C+     CIP+   CD   DC +  DE                 C   +F 
Sbjct: 125 LTCGPASFQCN--SSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFH 182

Query: 63  CANGQKCIDAKLKCNYHNDCGDNSDEEKCNFTACHVGQFKCANSLCIPVSYHCDGYRDCI 122
           C +G+ CI +  +C+   DC D SDEE C    C   +F+C++  CI  S  CD   DC 
Sbjct: 183 CLSGE-CIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCK 241

Query: 123 DGSDETNCTSIA--CPNNKFLCPMGAAGGKPKCIPKAQVCDGRKDCEDNADEETVCCDCS 180
           D SDE  C ++      NKF C  G      +CI   +VC+  +DC D +DE    C  +
Sbjct: 242 DMSDEVGCVNVTLCEGPNKFKCHSG------ECITLDKVCNMARDCRDWSDEPIKECGTN 295

Query: 181 LL-----NCEFTCQASPTGGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKL 235
                   C   C     G  C CP+G ++    R   +    +                
Sbjct: 296 ECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQD---------------- 339

Query: 236 VLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMCIITRASGNALGYKCACDIGYRL 295
                                     C +  GG +  C              A      L
Sbjct: 340 -------------------PDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYL 380

Query: 296 --SVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCVNVTCSLSQFAC 353
             +                              +  ++   +SD +  +  +  L +   
Sbjct: 381 FFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHG 440

Query: 354 ENGR-CVPSTWKCDSENDCGD-------GSDEGDFCSEKTCAYFQFHAIVLGSNLTNPTD 405
            +    V S      +    D        +D                  +     + P  
Sbjct: 441 VSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFREQGSKPRA 500

Query: 406 LALDPTSGLMFVADSNQ---ILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNL 462
           + +DP  G M+  D      I +  ++G    S+V+E     +G+ LD+ + RL+W D+ 
Sbjct: 501 IVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSK 560

Query: 463 LDYIETVDYEGKNRFLILRGSQN 485
           L  I ++D  G NR  IL   + 
Sbjct: 561 LHSISSIDVNGGNRKTILEDEKR 583
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Length = 51 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Length = 55 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.98
3v65_B386 Low-density lipoprotein receptor-related protein; 99.97
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 99.93
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 99.93
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.92
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 99.91
3v65_B 386 Low-density lipoprotein receptor-related protein; 99.91
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.79
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.79
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 99.78
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.77
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.76
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 99.74
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 99.74
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 99.73
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 99.68
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 99.65
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 99.63
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.5
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.48
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.27
2xrc_A565 Human complement factor I; immune system, hydrolas 99.25
2xrc_A565 Human complement factor I; immune system, hydrolas 99.18
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.17
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.15
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 99.08
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.99
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.96
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 98.95
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 98.95
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.9
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.89
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.89
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.89
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 98.88
1cr8_A42 Protein (LOW density lipoprotein receptor related 98.88
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.88
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.87
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.86
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 98.86
3a7q_B44 Low-density lipoprotein receptor-related protein; 98.86
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.85
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.85
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 98.84
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.84
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.84
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 98.84
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.78
2m0p_A52 Low-density lipoprotein receptor-related protein; 98.77
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.74
2i1p_A48 Low-density lipoprotein receptor-related protein 2 98.74
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.71
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.71
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.7
2knx_A50 Prolow-density lipoprotein receptor-related prote; 98.7
1j8e_A44 Low-density lipoprotein receptor-related protein 1 98.69
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 98.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.66
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.65
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.58
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.47
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.45
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 98.44
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.4
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.4
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.39
2gtl_N220 Extracellular hemoglobin linker L2 subunit; anneli 98.36
2vh0_B134 Activated factor XA light chain; serine protease, 98.35
2bou_A143 EGF-like module containing mucin-like hormone rece 98.35
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.34
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.34
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.27
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.25
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 98.23
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.22
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.22
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.18
3kya_A496 Putative phosphatase; structural genomics, joint c 98.17
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.15
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 98.15
2gtl_M217 Hemoglobin linker chain L1; annelid erythrocruorin 98.08
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.02
3kya_A 496 Putative phosphatase; structural genomics, joint c 98.02
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.01
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.01
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.0
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.0
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.94
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.92
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.91
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 97.89
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.87
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.87
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.86
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.86
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.86
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.82
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.8
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.79
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.77
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.77
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.76
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.73
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.71
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.7
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.69
2bou_A143 EGF-like module containing mucin-like hormone rece 97.67
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 97.67
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.65
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.65
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 97.63
3ojy_B537 Complement component C8 beta chain; macpf, lipocal 97.63
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.61
3ojy_A554 Complement component C8 alpha chain; macpf, lipoca 97.6
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.57
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.57
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.52
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.49
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.47
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.45
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.4
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.38
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.33
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.22
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.21
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.21
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.2
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.19
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.18
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.18
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 97.15
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.12
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.04
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.0
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.98
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 96.95
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.92
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.92
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.9
2qe8_A343 Uncharacterized protein; structural genomics, join 96.89
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.87
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.84
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.83
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.82
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.76
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.67
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.62
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.58
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.56
2vh0_B134 Activated factor XA light chain; serine protease, 96.55
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.43
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.42
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.41
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 96.34
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 96.24
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.24
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.2
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 96.19
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.17
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 96.16
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 96.15
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.1
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.97
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 95.78
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 95.75
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 95.72
1szb_A170 Mannose binding lectin-associated serine protease- 95.71
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.7
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 95.69
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 95.51
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.28
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.28
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.16
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.15
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.11
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.04
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.03
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.89
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.77
1szb_A170 Mannose binding lectin-associated serine protease- 94.69
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 94.63
1nzi_A159 Complement C1S component; calcium, innate immunity 94.41
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 94.34
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 94.2
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 94.12
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 93.77
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 93.43
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 93.36
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 93.3
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 93.22
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.21
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 93.01
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.83
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 92.53
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 92.51
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 92.47
1nzi_A159 Complement C1S component; calcium, innate immunity 92.23
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 92.09
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 92.01
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 92.01
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.7
2ece_A462 462AA long hypothetical selenium-binding protein; 91.02
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 90.54
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 90.53
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 90.34
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 90.25
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 90.25
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 90.15
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 89.9
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 89.41
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 89.15
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 89.05
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 88.94
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 88.71
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 88.31
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 88.27
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 88.24
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 87.97
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 87.96
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 87.89
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 87.71
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 87.5
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 86.16
2ece_A462 462AA long hypothetical selenium-binding protein; 85.76
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 85.68
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 85.35
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 85.2
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.95
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 83.32
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.08
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 82.69
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 82.25
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 82.01
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 81.87
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 81.63
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 81.14
2k2s_B61 Micronemal protein 6; microneme protein complex, c 80.49
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.2e-62  Score=539.73  Aligned_cols=402  Identities=28%  Similarity=0.559  Sum_probs=186.7

Q ss_pred             CCCCCCcEEecCCCCceecCCcccCCcCCCCCCCcCCCCCCCCCCCCCCCCeecCCCCceecCcceeCCCCCCCCCCccc
Q psy4900          10 RKCSPGDFECDPPHGICIPKDKRCDGYYDCRNRKDEEGCPATTGLSCDLDQFRCANGQKCIDAKLKCNYHNDCGDNSDEE   89 (485)
Q Consensus        10 ~~C~~~~f~C~c~~g~ci~~~~~Cd~~~dC~d~sdE~~C~~~~~~~C~~~~f~C~~g~~Ci~~~~~Cd~~~dC~d~sDe~   89 (485)
                      ..|.+++|+|  .+|.||+..|+|||+.||.|++||.+|..   ..|.+.+|+|.+|. ||+..|+|||..||.|+|||.
T Consensus       104 ~~C~~~~f~C--~~g~Ci~~~~~CDg~~dC~dgsDE~~C~~---~~C~~~~f~C~~~~-Ci~~~~~Cdg~~dC~dgsDE~  177 (791)
T 3m0c_C          104 KTCSQDEFRC--HDGKCISRQFVCDSDRDCLDGSDEASCPV---LTCGPASFQCNSST-CIPQLWACDNDPDCEDGSDEW  177 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccccCCeEEC--CCCCEECHHHcCCCcccCCCCcccccccc---cccccceeccCCCc-cccccccCCCCCcCCCCCCcc
Confidence            3688899999  88999999999999999999999999986   68999999999997 999999999999999999996


Q ss_pred             --CCC--------CCccCCCcccCCCCcccCccccCCCCCCCCCCCCCCCCCCCCcCCCceecCCCCCCCCCcccCCCcc
Q psy4900          90 --KCN--------FTACHVGQFKCANSLCIPVSYHCDGYRDCIDGSDETNCTSIACPNNKFLCPMGAAGGKPKCIPKAQV  159 (485)
Q Consensus        90 --~C~--------~~~C~~~~f~C~~~~Ci~~~~~Cdg~~dC~dgsDe~~C~~~~c~~~~~~C~~g~~~~~~~Ci~~~~~  159 (485)
                        +|.        ...|.+.+|+|.++.||+..|+|||..||.|++||.+|....|...+|+|.++      .||+..|+
T Consensus       178 ~~~C~~~~~~~~~~~~C~~~~f~C~~g~Ci~~~~~CDg~~dC~dgsDE~~C~~~~C~~~~f~C~~g------~Ci~~~~~  251 (791)
T 3m0c_C          178 PQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDG------NCIHGSRQ  251 (791)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccCCCccccCCCCCCCCCCcccccCCceeccccccCCCCCCCCCCCCCCccccccCCCcceecCC------ceEeccee
Confidence              673        35699999999999999999999999999999999999877787778999887      88888888


Q ss_pred             cCCCCCCCCCccccCc-----c-------------------------------------c--CCCC--CCccccccCCCC
Q psy4900         160 CDGRKDCEDNADEETV-----C-------------------------------------C--DCSL--LNCEFTCQASPT  193 (485)
Q Consensus       160 Cdg~~dC~d~sDe~~~-----C-------------------------------------~--~C~~--~~C~~~C~n~~~  193 (485)
                      |||..||.|++||.+.     |                                     .  +|..  ..|.+.|.++++
T Consensus       252 Cdg~~dC~dgsDE~~C~~~~~C~~~~~~~C~~G~Ci~~~~~Cd~~~dC~dgsDe~~~~C~~~~C~~~~~~C~~~C~~~~~  331 (791)
T 3m0c_C          252 CDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKI  331 (791)
T ss_dssp             ---------------------CCSTTCCCCTTSCCCCSSCCSCSSCCSSSSCSCCCTTBSCCSTTTGGGGCSSEEEECSB
T ss_pred             cCChhccccccccCcccccccccCCCccccCCCcccccccccCCccccccccCccccccccccccccccCccccccCCCC
Confidence            8888888888887431     1                                     0  1211  134567889999


Q ss_pred             CCeeeCCCCceeeCCCCCCCCcchhhhccccccccccccceeheeheeeeeeecccCCCCCCCCCCCCCCCCCCCccccc
Q psy4900         194 GGVCQCPEGQKVANDSRTCLLYMKNNLKQAVRSSTVSSHVKLVLLEVYVNVLKVRKLPTTAEPQSPNPCGSNNGGCEHMC  273 (485)
Q Consensus       194 ~~~C~C~~G~~l~~~~~~C~d~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~C~~~~g~C~~~C  273 (485)
                      +|.|.|++||.+ .+++.|.|++|                                            |. ..+.|+|.|
T Consensus       332 ~y~C~C~~Gy~l-~~g~~C~dide--------------------------------------------C~-~~~~C~~~C  365 (791)
T 3m0c_C          332 GYECLCPDGFQL-VAQRRCEDIDE--------------------------------------------CQ-DPDTCSQLC  365 (791)
T ss_dssp             SEEEECCTTCEE-ETTTEEECCCC--------------------------------------------CS-SSSSCTTTC
T ss_pred             CcccCCCCCCcc-CCCCccccCcc--------------------------------------------cC-CCCCCCCee
Confidence            999999999988 67888999888                                            87 567899999


Q ss_pred             cccccCCCCCCccccCCCCccccCCCCCCCCCCCCCceEEcCCCCcccCceeecCCCCCCCCCcCCCCC--Cc-------
Q psy4900         274 IITRASGNALGYKCACDIGYRLSVNGNNCNQPTCAPGEFQCASGRCVPSTFKCDAENDCGDYSDETGCV--NV-------  344 (485)
Q Consensus       274 ~n~~~~~~~g~~~C~C~~Gy~l~~d~~~C~~~~C~~~~~~c~~g~ci~~~~~cd~~~dc~d~sde~~c~--~~-------  344 (485)
                      +|++     |+|+|.|+.||.|..++++|++..-.+.+++.    ....+++.+....-........-.  .+       
T Consensus       366 ~n~~-----gsy~C~C~~Gy~l~~~~~~C~~~~~~p~Ll~a----n~~~Ir~i~l~~~~~~~l~~~~~~~~gl~~d~~~~  436 (791)
T 3m0c_C          366 VNLE-----GGYKCQCEEGFQLDPHTKACKAVGSIAYLFFT----NRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASN  436 (791)
T ss_dssp             CBCS-----SCBCCCCCSSEECCSSCCCCEETTSCCEEEEE----CBSSEEEECTTSCCCEEEECSCSSEEEEEEETTTT
T ss_pred             ecCC-----CCceeecCCCCEeCCCCceeeecccccccccc----cccceeEeeccCCcceeeecCCCceEEEeecccCC
Confidence            9999     99999999999999999999874333455555    334455555543211111110000  00       


Q ss_pred             ---------cccCCcccCCC-----C-ceec-ccccc-------CCCCccCCCCC--CccccccCcccccceEEEEecCC
Q psy4900         345 ---------TCSLSQFACEN-----G-RCVP-STWKC-------DSENDCGDGSD--EGDFCSEKTCAYFQFHAIVLGSN  399 (485)
Q Consensus       345 ---------~~~~~~~~~~~-----~-~~i~-~~~~~-------~~~~~y~~d~~--~I~~~~~~~c~~g~~~~~l~~~~  399 (485)
                               ..++...+.+.     . .++. ++..|       .+++|||+|..  +|.+++++    |+.+++|+...
T Consensus       437 ~lY~sD~~~~~I~~~~l~g~~~~~~~~~vi~~~l~~P~GLAvD~~~~~LY~tD~~~~~I~v~~ld----G~~~~~l~~~~  512 (791)
T 3m0c_C          437 RIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTK----GVKRKTLFREN  512 (791)
T ss_dssp             EEEEEETTTTEEEEEEC--------CEEEECSSCSCCCEEEEETTTTEEEEEETTTTEEEEEETT----SSSEEEEEECT
T ss_pred             eeEEeeccceeEEEEeccCCCCCcceeEEEecCCCCcceeeeeecCCcEEEEecCCCeEEEEeCC----CCeEEEEEeCC
Confidence                     01122222221     0 1222 22223       34799999987  89999999    99999999889


Q ss_pred             CCCCccEEecCCCCeEEEeC---CCcEEEEEcCCCCcEEEEeCCCcccceEEEeCCCCeEEEEeCCCCcEEEEEccCCCe
Q psy4900         400 LTNPTDLALDPTSGLMFVAD---SNQILRTNMDGTMAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNR  476 (485)
Q Consensus       400 ~~~p~~iavD~~~~~lywtd---~~~I~r~~~dG~~~~~i~~~~~~~p~glavD~~~~~lYW~D~~~~~I~~~~~dG~~r  476 (485)
                      +..|++|||||..|+|||||   .++|+|++|||+.+++|+...+.+|+|||||+..++|||+|++.++|++++++|+.|
T Consensus       513 l~~P~gIaVDp~~g~LYwtD~g~~~~I~~~~~dG~~~~~lv~~~l~~P~GLavD~~~~~LYwaD~~~~~I~~~d~dG~~~  592 (791)
T 3m0c_C          513 GSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNR  592 (791)
T ss_dssp             TCCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCCEEEEECSSCSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSC
T ss_pred             CCCcceEEEecCCCCEEEecCCCCCeEEEEecCCCceEEEEeCCCCCceEEEEecCCCeEEEEeCCCCcEEEEecCCCce
Confidence            99999999999999999999   378999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecC
Q psy4900         477 FLILRG  482 (485)
Q Consensus       477 ~~~~~~  482 (485)
                      ++|+.+
T Consensus       593 ~~v~~~  598 (791)
T 3m0c_C          593 KTILED  598 (791)
T ss_dssp             EEEEEC
T ss_pred             EEEecC
Confidence            999864
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 485
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 2e-11
d1npea_ 263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 2e-06
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 4e-04
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 8e-11
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-10
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-07
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-04
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 5e-10
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-09
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 3e-09
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 8e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 3e-04
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-09
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-07
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 7e-05
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-04
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-09
d1ijqa1 266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 1e-06
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 4e-05
d1ijqa1 266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 6e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-09
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 5e-09
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-08
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-04
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 3e-04
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-09
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-09
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-07
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-05
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-04
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 5e-09
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 6e-08
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-07
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-06
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 4e-06
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 2e-04
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-09
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 6e-09
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-08
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-06
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 4e-05
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 8e-09
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-08
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-06
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-04
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 6e-04
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-08
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 9e-08
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-07
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-05
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 5e-04
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-08
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 1e-07
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 3e-07
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-08
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 4e-08
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 3e-07
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 1e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 2e-06
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 7e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 2e-07
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 8e-07
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-06
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 1e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 7e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 5e-04
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 2e-07
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-07
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 3e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 3e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 4e-06
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 3e-04
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 4e-06
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 2e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 8e-05
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 1e-04
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 2e-06
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 3e-06
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 5e-06
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 3e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 7e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 8e-05
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 3e-06
d1rfnb_57 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d2bz6l153 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human 2e-05
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 3e-05
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 8e-05
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 1e-04
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 3e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.001
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 0.003
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Nidogen
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 61.8 bits (149), Expect = 2e-11
 Identities = 25/114 (21%), Positives = 43/114 (37%), Gaps = 4/114 (3%)

Query: 376 DEGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVADSN----QILRTNMDGT 431
           D      E          ++  + L NP  +  DP  G ++  D N    +I  ++MDGT
Sbjct: 97  DSQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDGT 156

Query: 432 MAMSIVSEAAYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRGSQN 485
               +  +     +G+  D  + +L W D      E ++     R  +L G Q 
Sbjct: 157 NRRILAQDNLGLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPGRRKVLEGLQY 210
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query485
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 99.82
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.81
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1ijqa1 266 Low density lipoprotein (LDL) receptor {Human (Hom 99.68
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.07
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.04
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.03
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.03
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.02
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.01
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.01
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.01
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 98.98
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.97
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.93
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 98.91
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.9
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 98.89
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 98.88
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.86
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 98.85
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.83
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.83
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 98.82
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 98.82
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.81
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.81
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 98.79
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 98.79
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.76
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.72
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.7
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.7
d1xfea244 Ligand-binding domain of low-density lipoprotein r 98.69
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 98.68
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 98.67
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.64
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.57
d1szba245 Mannose-binding protein associated serine protease 98.49
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.48
d1nt0a345 Mannose-binding protein associated serine protease 98.47
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.46
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 98.38
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 98.36
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.32
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.27
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 98.27
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1ijqa250 Low density lipoprotein (LDL) receptor, different 98.21
d1szba245 Mannose-binding protein associated serine protease 98.17
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1nt0a345 Mannose-binding protein associated serine protease 98.09
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.09
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.05
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.99
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.96
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 97.92
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.91
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.88
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.87
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1q7fa_ 279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.78
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.73
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.72
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.63
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.6
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.48
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.47
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.47
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.29
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.16
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.14
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.02
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.95
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.61
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.54
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.26
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.22
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.73
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 95.73
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.54
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 95.48
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 95.01
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.57
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 94.5
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 93.51
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 93.29
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 93.12
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.37
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.91
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.85
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 91.44
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 91.2
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 90.33
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 89.44
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 89.25
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.23
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.1
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 89.05
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 88.75
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 88.39
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 88.29
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 87.71
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 87.53
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 86.31
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 85.75
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 85.43
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 85.28
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 84.55
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 83.93
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 81.79
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 80.72
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 80.38
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 80.36
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 80.11
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Low density lipoprotein (LDL) receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.82  E-value=2.3e-20  Score=177.55  Aligned_cols=113  Identities=27%  Similarity=0.405  Sum_probs=106.1

Q ss_pred             CCCCccCCCCC--CccccccCcccccceEEEEecCCCCCCccEEecCCCCeEEEeC---CCcEEEEEcCCCCcEEEEeCC
Q psy4900         366 DSENDCGDGSD--EGDFCSEKTCAYFQFHAIVLGSNLTNPTDLALDPTSGLMFVAD---SNQILRTNMDGTMAMSIVSEA  440 (485)
Q Consensus       366 ~~~~~y~~d~~--~I~~~~~~~c~~g~~~~~l~~~~~~~p~~iavD~~~~~lywtd---~~~I~r~~~dG~~~~~i~~~~  440 (485)
                      .++++||++..  +|.+++++    |+...+++..++.+|++|+|||..|+|||++   .++|+|++|||+++++|+...
T Consensus        87 ~~~~lY~~d~~~~~I~v~~~~----g~~~~~~~~~~~~~P~~l~vd~~~g~ly~~~~~~~~~I~r~~~dGs~~~~l~~~~  162 (266)
T d1ijqa1          87 IHSNIYWTDSVLGTVSVADTK----GVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTEN  162 (266)
T ss_dssp             TTTEEEEEETTTTEEEEEETT----SSSEEEEEECTTCCEEEEEEETTTTEEEEEECSSSCEEEEEETTSCCEEEEECSS
T ss_pred             ccceEEEEecCCCEEEeEecC----CceEEEEEcCCCCCcceEEEEcccCeEEEeccCCCcceeEeccCCCceecccccc
Confidence            46899999877  89999999    9999999989999999999999999999999   468999999999999999989


Q ss_pred             CcccceEEEeCCCCeEEEEeCCCCcEEEEEccCCCeEEEecC
Q psy4900         441 AYKASGVALDINAKRLFWCDNLLDYIETVDYEGKNRFLILRG  482 (485)
Q Consensus       441 ~~~p~glavD~~~~~lYW~D~~~~~I~~~~~dG~~r~~~~~~  482 (485)
                      +.+|+|||||+.+++|||+|...++|+++++||++|++|+.+
T Consensus       163 ~~~p~gl~iD~~~~~lYw~d~~~~~I~~~~~dG~~~~~~~~~  204 (266)
T d1ijqa1         163 IQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILED  204 (266)
T ss_dssp             CSCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEEEEC
T ss_pred             cceeeEEEeeccccEEEEecCCcCEEEEEECCCCCEEEEEeC
Confidence            999999999999999999999999999999999999988765
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure