Psyllid ID: psy4960

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MKSSQCDHQETNTEQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEYYGTSGSSDRSPQEILQRTGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
cccccccccccccccEEEEEccccHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHcccEEEEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccEEc
ccccccccccccccccEEEEEEcHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHccccHHHHHHHHccccccccHcccccccccccccccccccccccccccHHHccccccccccEccccccHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHcccccHHHcccHHHHHHHHHHHcEcEcccccccccccccccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEEccccEEEcccEEcccccccccccccEEEEEEEEEEccccEEEEEEccEcccccEccEEEEEccccccccccccEEEEEc
mkssqcdhqetnteQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNrtytddneiKTRFEYFKqdgketdeyygtsgssdrspqEILQRTGLRLTGKEKERLEADRERVKKFLNErkkgplpksldwrqskvkvlnpvesqgrcgscwAFATTAILESQVALLKKTLyplsksqlvecdhgnlncnggniDVAFEYVKQYglesqadypyrnkenitfRCTYEKEKAKVFVQDTWVTSGVDHMMHLLqsgpigvylnhrliesydgnpirrndwacnphkldHAVAIVGYGEKNGILTWIVRnswgdigpdhgyfqierganacgiESYAYLASVK
mkssqcdhqetnteqvtynVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWnrtytddneiktRFEYFKQDGKETDEYygtsgssdrspqeilqrtglrltgkekerleadreRVKKflnerkkgplpksldwrqsKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGlesqadypyrnKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
MKSSQCDHQETNTEQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEYYGTSGSSDRSPQEILQRTGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
***************VTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFK********************************************************************VKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLA***
*************EQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEYYGTSGSSDRSPQEILQRTGL***********************RKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
************TEQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETD**************EILQRTGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
************TEQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEYYGTSGSSDRSPQEILQRTGLRLT**********************KGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSSQCDHQETNTEQVTYNVNTDSAIYVWRDLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEYYGTSGSSDRSPQEILQRTGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYAYLASVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q91CL9324 Viral cathepsin OS=Anther N/A N/A 0.841 0.885 0.346 4e-38
P41715324 Viral cathepsin OS=Choris N/A N/A 0.841 0.885 0.330 1e-37
Q9PYY5346 Viral cathepsin OS=Xestia N/A N/A 0.850 0.838 0.308 8e-37
Q6VTL7324 Viral cathepsin OS=Choris N/A N/A 0.841 0.885 0.333 3e-36
Q9YMP9356 Viral cathepsin OS=Lymant N/A N/A 0.800 0.766 0.333 6e-36
Q8V5U0367 Viral cathepsin OS=Heliot N/A N/A 0.800 0.743 0.306 7e-36
Q9WGE0324 Viral cathepsin OS=Hyphan N/A N/A 0.856 0.901 0.331 1e-35
Q91GE3323 Viral cathepsin OS=Epiphy N/A N/A 0.835 0.882 0.313 1e-35
O10364324 Viral cathepsin OS=Orgyia N/A N/A 0.832 0.876 0.316 2e-35
Q9VN93614 Putative cysteine protein no N/A 0.826 0.459 0.320 4e-35
>sp|Q91CL9|CATV_NPVAP Viral cathepsin OS=Antheraea pernyi nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function desciption
 Score =  158 bits (400), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 166/312 (53%), Gaps = 25/312 (8%)

Query: 33  AYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKE--------TDEYYGTSGSS 84
           AYD +K    F+ ++ K+N+ Y+ ++E   RF+ F+ + +E        T   Y  +  S
Sbjct: 18  AYDLLKAPSYFEEFLHKFNKNYSSESEKLRRFKIFQHNLEEIINKNQNDTSAQYEINKFS 77

Query: 85  DRSPQEILQR-TGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPV 143
           D S  E + + TGL L  +++   E     V        KGPL    DWR  ++  +  V
Sbjct: 78  DLSKDETISKYTGLSLPLQKQNFCE-----VVVLDRPPDKGPL--EFDWR--RLNKVTSV 128

Query: 144 ESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVK 203
           ++QG CG+CWAFAT   LESQ A+    L  LS+ QL++CD  ++ C+GG +  A+E V 
Sbjct: 129 KNQGMCGACWAFATLGSLESQFAIKHDQLINLSEQQLIDCDFVDVGCDGGLLHTAYEAVM 188

Query: 204 QY-GLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVDHMMHLLQ-SGPIGVYL 261
              G++++ DYPY    N   R    K   +V     +VT   + +  LL+  GPI V +
Sbjct: 189 NMGGIQAENDYPYE-ANNGPCRVNAAKFVVRVKKCYRYVTLFEEKLKDLLRIVGPIPVAI 247

Query: 262 NHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQ 321
           +   I  Y    IR     C  H L+HAV +VGYG +NGI  WI++N+WG    + GYF+
Sbjct: 248 DASDIVGYKRGIIRY----CENHGLNHAVLLVGYGVENGIPFWILKNTWGADWGEQGYFR 303

Query: 322 IERGANACGIES 333
           +++  NACGI++
Sbjct: 304 VQQNINACGIKN 315
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system.
Antheraea pernyi (taxid: 7119)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 5EC: 0
>sp|P41715|CATV_NPVCF Viral cathepsin OS=Choristoneura fumiferana nuclear polyhedrosis virus GN=Vcath PE=3 SV=1 Back     alignment and function description
>sp|Q9PYY5|CATV_GVXN Viral cathepsin OS=Xestia c-nigrum granulosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q6VTL7|CATV_NPVCD Viral cathepsin OS=Choristoneura fumiferana defective polyhedrosis virus GN=Vcath PE=3 SV=1 Back     alignment and function description
>sp|Q9YMP9|CATV_NPVLD Viral cathepsin OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9WGE0|CATV_NPVHC Viral cathepsin OS=Hyphantria cunea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q91GE3|CATV_NPVEP Viral cathepsin OS=Epiphyas postvittana nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|O10364|CATV_NPVOP Viral cathepsin OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
350421176 884 PREDICTED: hypothetical protein LOC10074 0.862 0.332 0.341 1e-40
328788558 881 PREDICTED: putative cysteine proteinase 0.868 0.335 0.344 5e-38
380025691 881 PREDICTED: putative cysteine proteinase 0.859 0.332 0.336 3e-37
332026794 774 Putative cysteine proteinase [Acromyrmex 0.859 0.378 0.323 3e-37
307175778 887 Putative cysteine proteinase CG12163 [Ca 0.862 0.331 0.313 4e-37
307200028 1032 Putative cysteine proteinase CG12163 [Ha 0.838 0.277 0.331 7e-37
186688051 475 cathepsin F [Paralichthys olivaceus] 0.862 0.618 0.323 2e-36
224555777 475 cathepsin F [Paralichthys olivaceus] 0.862 0.618 0.323 2e-36
96979798324 cathepsin [Antheraea pernyi nucleopolyhe 0.841 0.885 0.346 3e-36
405977658 715 Cathepsin F [Crassostrea gigas] 0.838 0.4 0.331 5e-36
>gi|350421176|ref|XP_003492760.1| PREDICTED: hypothetical protein LOC100745708 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  173 bits (438), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 168/325 (51%), Gaps = 31/325 (9%)

Query: 35  DSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEY---------YGTSGSSD 85
           + IK    F+ +I K+ +TY   +E   RF+ FKQ+ K  +E          YG +  +D
Sbjct: 571 EEIKDETLFEAFIKKFGKTYNSADEKLDRFKIFKQNLKIIEELQTFERGTAEYGVTMFAD 630

Query: 86  RSPQEILQR-TGLRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVE 144
            +P+E   R  GLR   K +  +      +           LP   DWR   V  + PV+
Sbjct: 631 LTPKEFKARYLGLRPELKHENEIPLPEAEIPDV-------SLPLKFDWRDHSV--VTPVK 681

Query: 145 SQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQ 204
            QG+CGSCWAF+ T  +E Q A+    L  LS+ +LV+CD  +  CNGG+++ A++ +++
Sbjct: 682 DQGQCGSCWAFSVTGNVEGQYAIKHNQLLSLSEQELVDCDSLDEGCNGGDMENAYKAIER 741

Query: 205 Y-GLESQADYPYRNKENITFRCTYEKEKAKV-FVQDTWVTSGVDHMMH-LLQSGPIGVYL 261
             GLE ++DYPY  K+    +C + + KAKV  V    +TS    M   L+++GPI V +
Sbjct: 742 LGGLELESDYPYDAKDE---KCHFLQNKAKVQVVSAVNITSDEKRMAQWLVKNGPISVGI 798

Query: 262 NHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILT------WIVRNSWGDIGP 315
           N   ++ Y G      ++ CNP  LDH V IVGYG     L       WI++NSWG    
Sbjct: 799 NANAMQFYFGGVSHPLNFLCNPKNLDHGVLIVGYGISKYPLFHKELPYWIIKNSWGPRWG 858

Query: 316 DHGYFQIERGANACGIESYAYLASV 340
           + GY+++ RG   CG+ + A  A V
Sbjct: 859 ERGYYRVYRGDGTCGVNTMATSAVV 883

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328788558|ref|XP_392381.3| PREDICTED: putative cysteine proteinase CG12163-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380025691|ref|XP_003696602.1| PREDICTED: putative cysteine proteinase CG12163-like [Apis florea] Back     alignment and taxonomy information
>gi|332026794|gb|EGI66903.1| Putative cysteine proteinase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307175778|gb|EFN65613.1| Putative cysteine proteinase CG12163 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307200028|gb|EFN80374.1| Putative cysteine proteinase CG12163 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|186688051|gb|ACC86111.1| cathepsin F [Paralichthys olivaceus] Back     alignment and taxonomy information
>gi|224555777|gb|ACN56478.1| cathepsin F [Paralichthys olivaceus] Back     alignment and taxonomy information
>gi|96979798|ref|YP_611001.1| cathepsin [Antheraea pernyi nucleopolyhedrovirus] gi|37077647|sp|Q91CL9.1|CATV_NPVAP RecName: Full=Viral cathepsin; Short=V-cath; AltName: Full=Cysteine proteinase; Short=CP; Flags: Precursor gi|16041073|dbj|BAB69773.1| cathepsin [Antheraea pernyi nucleopolyhedrovirus] gi|94983331|gb|ABF50271.1| cathepsin [Antheraea pernyi nucleopolyhedrovirus] gi|146229694|gb|ABQ12259.1| cathepsin [Antheraea pernyi nucleopolyhedrovirus] Back     alignment and taxonomy information
>gi|405977658|gb|EKC42097.1| Cathepsin F [Crassostrea gigas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
MGI|MGI:1338045371 Ctsw "cathepsin W" [Mus muscul 0.771 0.708 0.273 1.3e-36
UNIPROTKB|E2RR02460 CTSF "Uncharacterized protein" 0.850 0.630 0.328 3.5e-36
WB|WBGene00019986383 R09F10.1 [Caenorhabditis elega 0.885 0.788 0.305 3.5e-36
UNIPROTKB|F7B939336 CTSH "Uncharacterized protein" 0.868 0.880 0.307 4.4e-36
RGD|2447333 Ctsh "cathepsin H" [Rattus nor 0.615 0.630 0.390 7.2e-36
RGD|1309354371 Ctsw "cathepsin W" [Rattus nor 0.762 0.700 0.269 9.2e-36
UNIPROTKB|F1MHV4375 CTSW "Uncharacterized protein" 0.724 0.658 0.292 9.2e-36
UNIPROTKB|F1RU48460 CTSF "Uncharacterized protein" 0.844 0.626 0.333 1.2e-35
UNIPROTKB|F7BRD4336 CTSH "Uncharacterized protein" 0.835 0.848 0.313 1.2e-35
UNIPROTKB|Q9UBX1484 CTSF "Cathepsin F" [Homo sapie 0.850 0.599 0.331 1.5e-35
MGI|MGI:1338045 Ctsw "cathepsin W" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 305 (112.4 bits), Expect = 1.3e-36, Sum P(2) = 1.3e-36
 Identities = 75/274 (27%), Positives = 137/274 (50%)

Query:    41 DAFKTYIVKWNRTYTDDNEIKTRFEYFK----QDGKETDEYYGTSGSSDRSPQEILQRTG 96
             + FK + +++NR+Y +  E   R   F     Q  +   E  GT+   +    ++ +   
Sbjct:    38 EVFKLFQIRFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFSDLTEEEF 97

Query:    97 LRLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFA 156
              +L G+E+   E      KK  +      +P++ DWR++K  +++ V++QG C  CWA A
Sbjct:    98 GQLYGQERSP-ERTPNMTKKVESNTWGESVPRTCDWRKAK-NIISSVKNQGSCKCCWAMA 155

Query:   157 TTAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNI-DVAFEYVKQYGLESQADYPY 215
                 +++   +  +    +S  +L++C+     CNGG + D     +   GL S+ DYP+
Sbjct:   156 AADNIQALWRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPF 215

Query:   216 RNKENITFRCTYEKEKAKVFVQD-TWVTSGVDHMMHLLQ-SGPIGVYLNHRLIESYDGNP 273
             +       RC  +K K   ++QD T +++    + H L   GPI V +N +L++ Y    
Sbjct:   216 QGDRK-PHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGV 274

Query:   274 IRRNDWACNPHKLDHAVAIVGYG-EKNGILTWIV 306
             I+    +C+P ++DH+V +VG+G EK G+ T  V
Sbjct:   275 IKATPSSCDPRQVDHSVLLVGFGKEKEGMQTGTV 308
GO:0006508 "proteolysis" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00019986 R09F10.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F7B939 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
RGD|2447 Ctsh "cathepsin H" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1309354 Ctsw "cathepsin W" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHV4 CTSW "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F7BRD4 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBX1 CTSF "Cathepsin F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00786CATH_RAT3, ., 4, ., 2, 2, ., 1, 60.39010.61580.6306yesN/A
P09668CATH_HUMAN3, ., 4, ., 2, 2, ., 1, 60.31340.80640.8208yesN/A
P49935CATH_MOUSE3, ., 4, ., 2, 2, ., 1, 60.38110.61580.6306yesN/A
Q3T0I2CATH_BOVIN3, ., 4, ., 2, 2, ., 1, 60.32710.84750.8626yesN/A
O46427CATH_PIG3, ., 4, ., 2, 2, ., 1, 60.31770.84750.8626yesN/A
P43296RD19A_ARATH3, ., 4, ., 2, 2, ., -0.30210.81520.7554yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.220.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 3e-64
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 2e-60
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 2e-47
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 3e-42
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 2e-33
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 2e-32
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 5e-31
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 1e-25
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 2e-24
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 2e-24
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 6e-14
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 1e-08
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 2e-06
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 2e-05
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information 
 Score =  202 bits (515), Expect = 3e-64
 Identities = 90/215 (41%), Positives = 119/215 (55%), Gaps = 12/215 (5%)

Query: 127 PKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECD-H 185
           P+S+DWR  +   + PV+ QG CGSCWAF+T   LE   A+    L  LS+ QLV+C   
Sbjct: 1   PESVDWR--EKGAVTPVKDQGSCGSCWAFSTVGALEGAYAIKTGKLVSLSEQQLVDCSTS 58

Query: 186 GNLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQD-TWVTSG 244
           GN  CNGGN D AFEYVK  GL S++DYPY  K+     C Y   K    +   + V  G
Sbjct: 59  GNNGCNGGNPDNAFEYVKNGGLASESDYPYTGKDG---TCKYNSSKVGAKITGYSNVPPG 115

Query: 245 VDH--MMHLLQSGPIGVYLN-HRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGI 301
            +      L   GP+ V ++     + Y G     +   C+   L+HAV +VGYG +NG+
Sbjct: 116 DEEALKAALANYGPVSVAIDASSSFQFYKGGIY--SGPCCSNTNLNHAVLLVGYGTENGV 173

Query: 302 LTWIVRNSWGDIGPDHGYFQIERGANACGIESYAY 336
             WIV+NSWG    + GY +I RG+N CGI SYA 
Sbjct: 174 DYWIVKNSWGTSWGEKGYIRIARGSNLCGIASYAS 208

Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
KOG1542|consensus372 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
KOG1543|consensus325 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
PTZ00462 1004 Serine-repeat antigen protein; Provisional 100.0
KOG1544|consensus470 100.0
COG4870372 Cysteine protease [Posttranslational modification, 99.96
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.92
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 99.76
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.44
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 99.18
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 99.08
KOG4128|consensus 457 97.63
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 96.41
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 96.28
PF09778212 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP 83.63
>KOG1542|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-83  Score=590.37  Aligned_cols=298  Identities=36%  Similarity=0.685  Sum_probs=265.5

Q ss_pred             cccccchhHHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHhhh---------hccccccCCCCCHHHHHHh-ccccCC
Q psy4960          31 DLAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETD---------EYYGTSGSSDRSPQEILQR-TGLRLT  100 (341)
Q Consensus        31 ~~~~~~~~~~~~f~~f~~~~~K~Y~~~~e~~~R~~iF~~n~~~I~---------~~yg~N~fsD~t~eE~~~~-l~~~~~  100 (341)
                      ++....+..++.|..|+.+|+|+|.+.+|...|+.||+.|++.++         +.||+|+|||||+|||+++ |+.+..
T Consensus        59 ~~~~~~l~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~  138 (372)
T KOG1542|consen   59 DLNPRGLGLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRR  138 (372)
T ss_pred             ccCCcccchHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccc
Confidence            556666667899999999999999999999999999999999997         5679999999999999999 654442


Q ss_pred             CchhhhhhhhhhhhhhhhcccCCCCCCCeeeccccCccccccccccCCccchHHHHHHHHHHHHHHHHhCCCCcCChhHH
Q psy4960         101 GKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQL  180 (341)
Q Consensus       101 ~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~~~v~pV~dQg~cGsCwAfA~~~~le~~~~~~~~~~~~lS~q~l  180 (341)
                      ...   ........+    ..+..+||++||||++|  .||||||||+||||||||+++++|++++|++|+.++||||+|
T Consensus       139 ~~~---~~~~~~~~~----~~~~~~lP~~fDWR~kg--aVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeL  209 (372)
T KOG1542|consen  139 GSK---LPGDAAEAP----IEPGESLPESFDWRDKG--AVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQEL  209 (372)
T ss_pred             ccc---CccccccCc----CCCCCCCCcccchhccC--CccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhh
Confidence            110   000000000    12345699999999999  999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCCCCCCcHHHHHHHHHHc-CCCCCCCCCCcCCCCCccccccccccceeeeccceeechH--H-HHHHHHhcCC
Q psy4960         181 VECDHGNLNCNGGNIDVAFEYVKQY-GLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGV--D-HMMHLLQSGP  256 (341)
Q Consensus       181 ~dc~~~~~gC~GG~~~~a~~~~~~~-Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i~~~y~~~~~--d-ik~~l~~~gP  256 (341)
                      +||+..++||+||.+..|++|+++. |+..|.+|||.++.+.  .|...+....+.|++ |..++.  + |.+.|.++||
T Consensus       210 vDCD~~d~gC~GGl~~nA~~~~~~~gGL~~E~dYPY~g~~~~--~C~~~~~~~~v~I~~-f~~l~~nE~~ia~wLv~~GP  286 (372)
T KOG1542|consen  210 VDCDSCDNGCNGGLMDNAFKYIKKAGGLEKEKDYPYTGKKGN--QCHFDKSKIVVSIKD-FSMLSNNEDQIAAWLVTFGP  286 (372)
T ss_pred             hcccCcCCcCCCCChhHHHHHHHHhCCccccccCCccccCCC--ccccchhhceEEEec-cEecCCCHHHHHHHHHhcCC
Confidence            9999999999999999999997666 9999999999998774  899999999999999 999987  3 9999999999


Q ss_pred             eEEEEeccccccCCCCcccCCCCCCCCCCCCeEEEEEEEeecC-CeeEEEEEcCCCCCCCCCcEEEEEeCCCcccccCce
Q psy4960         257 IGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKN-GILTWIVRNSWGDIGPDHGYFQIERGANACGIESYA  335 (341)
Q Consensus       257 v~v~~~~~~f~~y~~Gv~~~~~~~~~~~~~~Hav~iVGyg~~~-g~~ywivkNSWG~~WG~~GY~~i~r~~n~Cgi~~~~  335 (341)
                      |+|+|++..++.|++||+.+....|++..++|||+|||||... .++|||||||||++|||+||+||.||.|.|||++++
T Consensus       287 i~vgiNa~~mQ~YrgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mv  366 (372)
T KOG1542|consen  287 LSVGINAKPMQFYRGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMV  366 (372)
T ss_pred             eEEEEchHHHHHhcccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccch
Confidence            9999999999999999999977799988899999999999887 899999999999999999999999999999999999


Q ss_pred             eEEee
Q psy4960         336 YLASV  340 (341)
Q Consensus       336 ~~~~~  340 (341)
                      ..+++
T Consensus       367 ss~~v  371 (372)
T KOG1542|consen  367 SSAAV  371 (372)
T ss_pred             hhhhc
Confidence            98875

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4128|consensus Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information
>PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 3e-32
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 9e-31
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 5e-30
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 6e-29
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 2e-28
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 4e-27
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 1e-26
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 2e-26
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 2e-26
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 2e-26
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 3e-26
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 3e-26
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 3e-26
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 4e-26
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 6e-26
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 6e-26
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 7e-26
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 9e-26
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 1e-25
3hwn_A258 Cathepsin L With Az13010160 Length = 258 1e-25
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 2e-25
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 2e-25
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 2e-25
3of8_A221 Structural Basis For Reversible And Irreversible In 2e-25
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 2e-25
3h89_A220 A Combined Crystallographic And Molecular Dynamics 2e-25
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 2e-25
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 3e-25
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 3e-25
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 4e-25
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 4e-25
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 1e-24
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 2e-24
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 2e-24
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 2e-24
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 2e-24
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 3e-24
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 4e-24
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 4e-24
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 4e-24
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 4e-24
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 5e-24
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 5e-24
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 8e-24
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 9e-24
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 1e-23
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 1e-23
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 3e-23
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 3e-23
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 2e-22
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 3e-22
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 4e-22
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 8e-22
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 1e-21
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 1e-21
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 1e-21
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 3e-21
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 5e-21
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 8e-21
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 8e-21
1pci_A322 Procaricain Length = 322 1e-20
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 2e-20
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 3e-20
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 3e-20
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 4e-20
2vhs_A217 Cathsilicatein, A Chimera Length = 217 5e-20
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 6e-20
1ppo_A216 Determination Of The Structure Of Papaya Protease O 1e-19
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 4e-19
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 4e-19
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 5e-19
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 5e-19
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 5e-19
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 5e-19
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 1e-18
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 2e-18
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 3e-18
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 3e-18
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 5e-18
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 5e-18
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 7e-18
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 8e-18
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 8e-17
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 9e-17
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 1e-16
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 2e-16
2act_A220 Crystallographic Refinement Of The Structure Of Act 5e-15
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 6e-15
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 8e-15
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 5e-13
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 6e-13
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 3e-12
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 4e-12
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 4e-12
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 4e-12
1mir_A322 Rat Procathepsin B Length = 322 8e-12
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 5e-11
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 2e-10
1k3b_B164 Crystal Structure Of Human Dipeptidyl Peptidase I ( 8e-10
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 5e-09
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 1e-06
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 1e-06
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 1e-06
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 1e-06
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 3e-06
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 4e-06
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (340), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 126/217 (58%), Gaps = 13/217 (5%)
Query: 127 PKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVEC--D 184
           P S+DWR+ K   ++PV++QG CGSCW F+TT  LES VA+    +  L++ QLV+C  +
Sbjct: 2   PPSMDWRK-KGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQN 60
Query: 185 HGNLNCNGGNIDVAFEYVK-QYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTS 243
             N  C GG    AFEY++   G+  +  YPY+ +++    C ++ +KA  FV+D    +
Sbjct: 61  FNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDD---HCKFQPDKAIAFVKDVANIT 117
Query: 244 GVDHMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDW---ACN--PHKLDHAVAIVGYGEK 298
             D    ++++  +   ++     + D    R+  +   +C+  P K++HAV  VGYGE+
Sbjct: 118 MNDEEA-MVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEE 176
Query: 299 NGILTWIVRNSWGDIGPDHGYFQIERGANACGIESYA 335
           NGI  WIV+NSWG     +GYF IERG N CG+ + A
Sbjct: 177 NGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACA 213
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 2e-66
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 1e-64
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 1e-63
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 4e-63
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 4e-63
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 4e-62
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 5e-62
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 2e-61
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 3e-61
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 1e-59
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 2e-59
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 7e-59
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 2e-58
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-58
1cqd_A221 Protein (protease II); cysteine protease, glycopro 8e-58
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 9e-58
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 4e-57
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 8e-57
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 9e-57
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 1e-56
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 3e-56
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 3e-56
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 5e-56
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 1e-55
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 2e-55
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 2e-55
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 4e-55
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 6e-55
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 1e-53
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 1e-53
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 2e-53
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 9e-51
3u8e_A222 Papain-like cysteine protease; papain-like cystein 1e-48
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 2e-48
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 9e-48
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 2e-47
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 6e-47
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 4e-46
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 3e-41
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 8e-11
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
 Score =  210 bits (537), Expect = 2e-66
 Identities = 74/308 (24%), Positives = 118/308 (38%), Gaps = 25/308 (8%)

Query: 40  VDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETDEY-YGTSGSSDRSPQEILQR-TGL 97
           +  F+ Y   +N++Y    + +   + F +  K         +  SD S  E   R    
Sbjct: 5   IKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFKNRFLMS 64

Query: 98  RLTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFAT 157
               +  E L+   +   +       G  P  +D RQ +   + P+  QG CGS WAF+ 
Sbjct: 65  A---EAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRT--VTPIRMQGGCGSAWAFSG 119

Query: 158 TAILESQVALLKKTLYPLSKSQLVECDHGNLNCNGGNIDVAFEYVKQYGLESQADYPYRN 217
            A  ES     +     L++ +LV+C      C+G  I    EY++  G+  ++ Y Y  
Sbjct: 120 VAATESAYLAYRDQSLDLAEQELVDCA-SQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA 178

Query: 218 KENITFRCTYEKEKA---KVFVQDTWVTSG-VDHMMHLL--QSGPIGVYLNHRLIES--- 268
           +E     C     +      + Q   +     + +   L      I V +  + +++   
Sbjct: 179 REQ---SCRRPNAQRFGISNYCQ---IYPPNANKIREALAQTHSAIAVIIGIKDLDAFRH 232

Query: 269 YDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGANA 328
           YDG  I             HAV IVGY    G+  WIVRNSW     D+GY       + 
Sbjct: 233 YDGRTI--IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDL 290

Query: 329 CGIESYAY 336
             IE Y Y
Sbjct: 291 MMIEEYPY 298
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 100.0
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.53
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.46
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 97.61
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 97.41
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 97.1
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
Probab=100.00  E-value=4.9e-81  Score=594.82  Aligned_cols=299  Identities=31%  Similarity=0.570  Sum_probs=256.5

Q ss_pred             ccccchhHHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHhhh----------hcc--ccccCCCCCHHHHHHh-cccc
Q psy4960          32 LAYDSIKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETD----------EYY--GTSGSSDRSPQEILQR-TGLR   98 (341)
Q Consensus        32 ~~~~~~~~~~~f~~f~~~~~K~Y~~~~e~~~R~~iF~~n~~~I~----------~~y--g~N~fsD~t~eE~~~~-l~~~   98 (341)
                      ....+..++.+|++|+++|+|.|.+.+|+.+|+.||++|+++|+          .+|  |+|+|+|||.|||+++ ++.+
T Consensus        11 ~~~~~~~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~~~~~   90 (331)
T 3qj3_A           11 SALPSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEMKAYTHGLI   90 (331)
T ss_dssp             --CCHHHHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHHHHHHSCCC
T ss_pred             CCCCCHHHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHHHHHhcccc
Confidence            33445566789999999999999998899999999999999998          357  9999999999999997 5544


Q ss_pred             CCCchhhhhhhhhhhhhhhhcccCCCCCCCeeeccccCccccccccccCCccchHHHHHHHHHHHHHHHHhCC--CCcCC
Q psy4960          99 LTGKEKERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKT--LYPLS  176 (341)
Q Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~~~v~pV~dQg~cGsCwAfA~~~~le~~~~~~~~~--~~~lS  176 (341)
                      .+...  ...........-.......+||++||||++|  +||||||||.||||||||++++||++++++++.  .+.||
T Consensus        91 ~~~~~--~~~~~~~~~~~~~~~~~~~~lP~s~DwR~~g--~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~~~LS  166 (331)
T 3qj3_A           91 MPADL--HKNGIPIKTREDLGLNASVRYPASFDWRDQG--MVSPVKNQGSCGSSWAFSSTGAIESQMKIANGAGYDSSVS  166 (331)
T ss_dssp             CCSST--TTTCEEECSGGGGTCCSSCCCCSSEEGGGGT--CSCCCCBCCSSCCHHHHHHHHHHHHHHHHHHCTTSCCCBC
T ss_pred             ccccc--cccCcccccccccccccccCCCcceecccCC--ccCCCccCcccchhhHHHHHHHHHHHHHHHhCCCcccCcC
Confidence            32210  0000000000000000123599999999999  999999999999999999999999999999998  89999


Q ss_pred             hhHHhhcCCCCCCCCCCcHHHHHHHHHHc-CCCCCCCCCCcCCCCCccccccccccceeeeccceeechH---H-HHHHH
Q psy4960         177 KSQLVECDHGNLNCNGGNIDVAFEYVKQY-GLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGV---D-HMMHL  251 (341)
Q Consensus       177 ~q~l~dc~~~~~gC~GG~~~~a~~~~~~~-Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i~~~y~~~~~---d-ik~~l  251 (341)
                      +|+|+||+..+.||+||++..|++|+.++ ||++|++|||.+..+   .|........+++.+ |..++.   + |+++|
T Consensus       167 eQ~LvdC~~~~~GC~GG~~~~a~~yi~~~~Gi~~e~~yPY~~~~~---~C~~~~~~~~~~i~~-~~~v~~~~e~~lk~al  242 (331)
T 3qj3_A          167 EQQLVDCVPNALGCSGGWMNDAFTYVAQNGGIDSEGAYPYEMADG---NCHYDPNQVAARLSG-YVYLSGPDENMLADMV  242 (331)
T ss_dssp             HHHHHHHCTTSCGGGCCCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCTTSEEECCSE-EEEESSCCHHHHHHHH
T ss_pred             HHHHhhhccCCCCCCCCCHHHHHHHHHHcCCcCcccccCccCCCC---CCCCCcccceeEeeE-EEEeCCCCHHHHHHHH
Confidence            99999999878999999999999999999 999999999999888   999887777889999 998874   2 99999


Q ss_pred             HhcCCeEEEEec-cccccCCCCcccCCCCCCCCCCCCeEEEEEEEeecCCeeEEEEEcCCCCCCCCCcEEEEEeCC-Ccc
Q psy4960         252 LQSGPIGVYLNH-RLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIVRNSWGDIGPDHGYFQIERGA-NAC  329 (341)
Q Consensus       252 ~~~gPv~v~~~~-~~f~~y~~Gv~~~~~~~~~~~~~~Hav~iVGyg~~~g~~ywivkNSWG~~WG~~GY~~i~r~~-n~C  329 (341)
                      +++|||+|+|++ .+|++|++|||..  +.|+...++|||+|||||+++|++|||||||||++||++|||||+|+. |.|
T Consensus       243 ~~~GPV~v~i~a~~~f~~Y~~Gvy~~--~~c~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~GY~~i~r~~~n~C  320 (331)
T 3qj3_A          243 ATKGPVAVAFDADDPFGSYSGGVYYN--PTCETNKFTHAVLIVGYGNENGQDYWLVKNSWGDGWGLDGYFKIARNANNHC  320 (331)
T ss_dssp             HHHCCEEEEECCCTTGGGEEEEEECC--TTCCSSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECSSSSGG
T ss_pred             HhCCCEEEEEEcccccccccCceEeC--CCCCCCcCCEEEEEEEEeccCCceEEEEEcCCCCCcCCCCEEEEEcCCCCcc
Confidence            999999999999 5699999999998  578766799999999999999999999999999999999999999998 999


Q ss_pred             cccCceeEEee
Q psy4960         330 GIESYAYLASV  340 (341)
Q Consensus       330 gi~~~~~~~~~  340 (341)
                      ||++.++||+|
T Consensus       321 gI~~~~~~p~v  331 (331)
T 3qj3_A          321 GIAGVASVPTL  331 (331)
T ss_dssp             GTTTSCEEEEC
T ss_pred             CcCCceeeeeC
Confidence            99999999986
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 6e-46
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 2e-41
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 6e-41
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-40
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 4e-40
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 5e-40
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 1e-39
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1e-39
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 2e-39
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 8e-39
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 5e-38
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 5e-38
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 4e-37
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 5e-37
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 5e-36
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 3e-35
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 5e-35
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 5e-35
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 1e-33
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 8e-32
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 1e-05
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 2e-04
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Cathepsin F
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  153 bits (387), Expect = 6e-46
 Identities = 68/214 (31%), Positives = 104/214 (48%), Gaps = 2/214 (0%)

Query: 127 PKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVECDHG 186
           P   DWR      +  V+ QG CGSCWAF+ T  +E Q  L + TL  LS+ +L++CD  
Sbjct: 2   PPEWDWR--SKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKM 59

Query: 187 NLNCNGGNIDVAFEYVKQYGLESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGVD 246
           +  C GG    A+  +K  G     D         + + + EK K  +        +   
Sbjct: 60  DKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCQFSAEKAKVYIQDSVELSQNEQK 119

Query: 247 HMMHLLQSGPIGVYLNHRLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEKNGILTWIV 306
               L + GPI V +N   ++ Y     R     C+P  +DHAV +VGYG+++ +  W +
Sbjct: 120 LAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGQRSDVPFWAI 179

Query: 307 RNSWGDIGPDHGYFQIERGANACGIESYAYLASV 340
           +NSWG    + GY+ + RG+ ACG+ + A  A V
Sbjct: 180 KNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVV 213
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.8
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.75
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 96.35
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 96.1
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.7e-75  Score=547.66  Aligned_cols=285  Identities=31%  Similarity=0.540  Sum_probs=242.2

Q ss_pred             hhHHHHHHHHHHHhCCccCChHHHHHHHHHHHHHHHhhh----------hcc--ccccCCCCCHHHHHHh-ccccCCCch
Q psy4960          37 IKQVDAFKTYIVKWNRTYTDDNEIKTRFEYFKQDGKETD----------EYY--GTSGSSDRSPQEILQR-TGLRLTGKE  103 (341)
Q Consensus        37 ~~~~~~f~~f~~~~~K~Y~~~~e~~~R~~iF~~n~~~I~----------~~y--g~N~fsD~t~eE~~~~-l~~~~~~~~  103 (341)
                      ..++.+|++||++|+|.|++. |+.+|+.||++|++.|+          .+|  |+|+|+|||+|||.++ +........
T Consensus         6 ~~l~~~F~~f~~~~~K~Y~~~-ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~~~   84 (316)
T d1cs8a_           6 HSLEAQWTKWKAMHNRLYGMN-EEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRKPR   84 (316)
T ss_dssp             GGGHHHHHHHHHHTTCCCCTT-HHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCCCS
T ss_pred             HHHHHHHHHHHHHhCCcCCCH-HHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccccc
Confidence            345779999999999999875 67889999999999998          256  9999999999999998 433322210


Q ss_pred             hhhhhhhhhhhhhhhcccCCCCCCCeeeccccCccccccccccCCccchHHHHHHHHHHHHHHHHhCCCCcCChhHHhhc
Q psy4960         104 KERLEADRERVKKFLNERKKGPLPKSLDWRQSKVKVLNPVESQGRCGSCWAFATTAILESQVALLKKTLYPLSKSQLVEC  183 (341)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~~~v~pV~dQg~cGsCwAfA~~~~le~~~~~~~~~~~~lS~q~l~dc  183 (341)
                        . . ...      ......+||++||||+.|  +|+||||||.||||||||+++++|++++++++..+.||+|+|+||
T Consensus        85 --~-~-~~~------~~~~~~~lP~s~Dwr~~g--~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC  152 (316)
T d1cs8a_          85 --K-G-KVF------QEPLFYEAPRSVDWREKG--YVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDC  152 (316)
T ss_dssp             --C-C-EEC------CCCTTCCCCSCEEGGGGT--CCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHH
T ss_pred             --c-C-ccc------cCcccccCCCceECCcCC--cccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhc
Confidence              0 0 000      011234599999999999  999999999999999999999999999999999999999999999


Q ss_pred             CC--CCCCCCCCcHHHHHHHHHHcC-CCCCCCCCCcCCCCCccccccccccceeeeccceeechH---HHHHHHHhcCCe
Q psy4960         184 DH--GNLNCNGGNIDVAFEYVKQYG-LESQADYPYRNKENITFRCTYEKEKAKVFVQDTWVTSGV---DHMMHLLQSGPI  257 (341)
Q Consensus       184 ~~--~~~gC~GG~~~~a~~~~~~~G-i~~e~~yPY~~~~~~~~~C~~~~~~~~~~i~~~y~~~~~---dik~~l~~~gPv  257 (341)
                      +.  .+.+|.||.+..|+.|+..+| +..|..|||.+...   .|..........+.. +...+.   +|+++|+..|||
T Consensus       153 ~~~~~~~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~~~~~---~~~~~~~~~~~~~~~-~~~~~~~~~~l~~~l~~~gpv  228 (316)
T d1cs8a_         153 SGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEE---SCKYNPKYSVANDAG-FVDIPKQEKALMKAVATVGPI  228 (316)
T ss_dssp             CGGGTCCGGGCBCHHHHHHHHHHHTCEEBTTTSCCCSSCC---CCCCCGGGEEECCCC-EEECCSCHHHHHHHHHHHCCE
T ss_pred             cccccCCCCCCCchHHHHHHHHhcCccccccccccccccc---ccccccccccccccc-cccccCcHHHHHHHHHHhCCe
Confidence            84  477899999999999999995 77899999988877   777666666666666 665554   299999999999


Q ss_pred             EEEEec--cccccCCCCcccCCCCCCCCCCCCeEEEEEEEeec----CCeeEEEEEcCCCCCCCCCcEEEEEeCC-Cccc
Q psy4960         258 GVYLNH--RLIESYDGNPIRRNDWACNPHKLDHAVAIVGYGEK----NGILTWIVRNSWGDIGPDHGYFQIERGA-NACG  330 (341)
Q Consensus       258 ~v~~~~--~~f~~y~~Gv~~~~~~~~~~~~~~Hav~iVGyg~~----~g~~ywivkNSWG~~WG~~GY~~i~r~~-n~Cg  330 (341)
                      +|++++  .+|..|.+|||..  +.|+...++|||+|||||++    ++.+|||||||||++|||+|||||+|+. |+||
T Consensus       229 ~v~i~~~~~~f~~y~~Gi~~~--~~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~CG  306 (316)
T d1cs8a_         229 SVAIDAGHESFLFYKEGIYFE--PDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCG  306 (316)
T ss_dssp             EEEECCCSHHHHTEEEEEECC--TTCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGGG
T ss_pred             EEEEEeccchhccccCCcccC--CCCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcCc
Confidence            999998  6799999999987  57877779999999999954    6899999999999999999999999996 8999


Q ss_pred             ccCceeEEee
Q psy4960         331 IESYAYLASV  340 (341)
Q Consensus       331 i~~~~~~~~~  340 (341)
                      |++.++||+|
T Consensus       307 I~~~~~yP~v  316 (316)
T d1cs8a_         307 IASAASYPTV  316 (316)
T ss_dssp             TTTSCEEECC
T ss_pred             cCCeeeeeeC
Confidence            9999999986
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure