Psyllid ID: psy4990


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCTREKAKKKMGVYEISGVSTSAL
cccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHHccEEccEEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccEEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHccccccccccccccEEEccccccccccEHHHHHccc
MIISNVTDEEMQEHYDNFFEDVFVECEDkygeieemnvcdnlgdhlvgnvyikfrrEEDAEKAVNDLnnrwfggrpvyaelspvtdfrEACCRQYEMVLEtknadpvctrekAKKKMGVYEIsgvstsal
miisnvtdeemqehYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNdlnnrwfggrpvYAELSPVTDFREACCRQYEMvletknadpvctrekakkkmgvyeisgvstsal
MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCTREKAKKKMGVYEISGVSTSAL
*************HYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCT*********************
MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLE***********KAKKKMGVY**********
MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCTREKAKKKMGVYEI********
****NVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCTREKAKKKMGVYEISGVSTS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMVLETKNADPVCTREKAKKKMGVYEISGVSTSAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q94535264 Splicing factor U2af 38 k yes N/A 0.738 0.363 0.916 3e-49
Q9D883239 Splicing factor U2AF 35 k yes N/A 0.707 0.384 0.847 2e-42
Q01081240 Splicing factor U2AF 35 k yes N/A 0.707 0.383 0.847 2e-42
A1A4K8237 Splicing factor U2AF 35 k yes N/A 0.707 0.388 0.847 2e-42
Q7TP17220 Splicing factor U2AF 26 k no N/A 0.715 0.422 0.806 5e-41
Q8BGJ9220 Splicing factor U2AF 26 k no N/A 0.715 0.422 0.806 5e-41
Q3T127220 Splicing factor U2AF 26 k no N/A 0.715 0.422 0.806 1e-40
Q8WU68220 Splicing factor U2AF 26 k no N/A 0.715 0.422 0.763 8e-39
Q09176216 Splicing factor U2AF 23 k yes N/A 0.684 0.412 0.644 5e-31
Q6AUG0 304 Splicing factor U2af smal yes N/A 0.692 0.296 0.560 3e-26
>sp|Q94535|U2AF1_DROME Splicing factor U2af 38 kDa subunit OS=Drosophila melanogaster GN=U2af38 PE=1 SV=2 Back     alignment and function desciption
 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/96 (91%), Positives = 93/96 (96%)

Query: 2   IISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAE 61
           +++NV+DEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFR E DAE
Sbjct: 67  LVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAE 126

Query: 62  KAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEM 97
           KA NDLNNRWFGGRPVY+ELSPVTDFREACCRQYEM
Sbjct: 127 KAANDLNNRWFGGRPVYSELSPVTDFREACCRQYEM 162




Necessary for the splicing of pre-mRNA. Binds to the polypyrimidine tract of introns early during spliceosome assembly.
Drosophila melanogaster (taxid: 7227)
>sp|Q9D883|U2AF1_MOUSE Splicing factor U2AF 35 kDa subunit OS=Mus musculus GN=U2af1 PE=1 SV=4 Back     alignment and function description
>sp|Q01081|U2AF1_HUMAN Splicing factor U2AF 35 kDa subunit OS=Homo sapiens GN=U2AF1 PE=1 SV=3 Back     alignment and function description
>sp|A1A4K8|U2AF1_BOVIN Splicing factor U2AF 35 kDa subunit OS=Bos taurus GN=U2AF1 PE=2 SV=1 Back     alignment and function description
>sp|Q7TP17|U2AF4_RAT Splicing factor U2AF 26 kDa subunit OS=Rattus norvegicus GN=U2af1l4 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGJ9|U2AF4_MOUSE Splicing factor U2AF 26 kDa subunit OS=Mus musculus GN=U2af1l4 PE=1 SV=1 Back     alignment and function description
>sp|Q3T127|U2AF4_BOVIN Splicing factor U2AF 26 kDa subunit OS=Bos taurus GN=U2AF1L4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WU68|U2AF4_HUMAN Splicing factor U2AF 26 kDa subunit OS=Homo sapiens GN=U2AF1L4 PE=1 SV=2 Back     alignment and function description
>sp|Q09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.06 PE=1 SV=2 Back     alignment and function description
>sp|Q6AUG0|U2AFB_ORYSJ Splicing factor U2af small subunit B OS=Oryza sativa subsp. japonica GN=U2AF35B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
357618954227 putative U2 snrnp auxiliary factor, smal 0.746 0.427 0.948 5e-50
156543322 242 PREDICTED: splicing factor U2af 38 kDa s 0.738 0.396 0.958 6e-50
242014352 253 Splicing factor U2Af 38 kDa subunit, put 0.738 0.379 0.958 2e-49
307197303 240 Splicing factor U2af 38 kDa subunit [Har 0.738 0.4 0.947 2e-49
307172750 240 Splicing factor U2af 38 kDa subunit [Cam 0.738 0.4 0.947 2e-49
307170197 240 Splicing factor U2af 38 kDa subunit [Cam 0.738 0.4 0.947 3e-49
239790945214 ACYPI001339 [Acyrthosiphon pisum] 0.738 0.448 0.958 3e-49
328785395 241 PREDICTED: splicing factor U2af 38 kDa s 0.738 0.398 0.947 4e-49
91089827227 PREDICTED: similar to AGAP002956-PA [Tri 0.738 0.422 0.947 4e-49
307202736 240 Splicing factor U2af 38 kDa subunit [Har 0.738 0.4 0.947 4e-49
>gi|357618954|gb|EHJ71738.1| putative U2 snrnp auxiliary factor, small subunit [Danaus plexippus] Back     alignment and taxonomy information
 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 92/97 (94%), Positives = 97/97 (100%)

Query: 1   MIISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDA 60
           ++++NV+DEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDA
Sbjct: 67  LVVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDA 126

Query: 61  EKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEM 97
           EKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEM
Sbjct: 127 EKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEM 163




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156543322|ref|XP_001606160.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242014352|ref|XP_002427855.1| Splicing factor U2Af 38 kDa subunit, putative [Pediculus humanus corporis] gi|212512324|gb|EEB15117.1| Splicing factor U2Af 38 kDa subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307197303|gb|EFN78595.1| Splicing factor U2af 38 kDa subunit [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307172750|gb|EFN64036.1| Splicing factor U2af 38 kDa subunit [Camponotus floridanus] gi|307174220|gb|EFN64865.1| Splicing factor U2af 38 kDa subunit [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307170197|gb|EFN62583.1| Splicing factor U2af 38 kDa subunit [Camponotus floridanus] gi|332029584|gb|EGI69473.1| Splicing factor U2af 38 kDa subunit [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|239790945|dbj|BAH72001.1| ACYPI001339 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328785395|ref|XP_397281.4| PREDICTED: splicing factor U2af 38 kDa subunit [Apis mellifera] gi|340723033|ref|XP_003399903.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Bombus terrestris] gi|350423714|ref|XP_003493568.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Bombus impatiens] gi|380029135|ref|XP_003698237.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Apis florea] gi|383858860|ref|XP_003704917.1| PREDICTED: splicing factor U2af 38 kDa subunit-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91089827|ref|XP_969424.1| PREDICTED: similar to AGAP002956-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307202736|gb|EFN82027.1| Splicing factor U2af 38 kDa subunit [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0017457264 U2af38 "U2 small nuclear ribop 0.738 0.363 0.916 9.8e-48
UNIPROTKB|Q98SE2237 U2AF1 "U2snRNP auxiliary facto 0.707 0.388 0.847 8.4e-42
UNIPROTKB|A1A4K8237 U2AF1 "Splicing factor U2AF 35 0.707 0.388 0.847 8.4e-42
UNIPROTKB|F1PUP0240 U2AF1 "Uncharacterized protein 0.707 0.383 0.847 8.4e-42
UNIPROTKB|J9P492240 U2AF1 "Uncharacterized protein 0.707 0.383 0.847 8.4e-42
UNIPROTKB|Q01081240 U2AF1 "Splicing factor U2AF 35 0.707 0.383 0.847 8.4e-42
MGI|MGI:98884239 U2af1 "U2 small nuclear ribonu 0.707 0.384 0.847 8.4e-42
ZFIN|ZDB-GENE-020419-1250 u2af1 "U2(RNU2) small nuclear 0.730 0.38 0.8 5.9e-41
UNIPROTKB|F1PU17220 U2AF1L4 "Uncharacterized prote 0.715 0.422 0.806 3.3e-40
UNIPROTKB|F1RM65232 U2AF1L4 "Uncharacterized prote 0.715 0.400 0.806 3.3e-40
FB|FBgn0017457 U2af38 "U2 small nuclear riboprotein auxiliary factor 38" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 499 (180.7 bits), Expect = 9.8e-48, P = 9.8e-48
 Identities = 88/96 (91%), Positives = 93/96 (96%)

Query:     2 IISNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAE 61
             +++NV+DEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFR E DAE
Sbjct:    67 LVANVSDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRNEADAE 126

Query:    62 KAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEM 97
             KA NDLNNRWFGGRPVY+ELSPVTDFREACCRQYEM
Sbjct:   127 KAANDLNNRWFGGRPVYSELSPVTDFREACCRQYEM 162




GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;NAS;IMP
GO:0005686 "U2 snRNP" evidence=NAS;TAS
GO:0008187 "poly-pyrimidine tract binding" evidence=NAS;IDA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0005634 "nucleus" evidence=IC;NAS
GO:0003729 "mRNA binding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0008380 "RNA splicing" evidence=IMP
UNIPROTKB|Q98SE2 U2AF1 "U2snRNP auxiliary factor small subunit" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4K8 U2AF1 "Splicing factor U2AF 35 kDa subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUP0 U2AF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P492 U2AF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q01081 U2AF1 "Splicing factor U2AF 35 kDa subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98884 U2af1 "U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020419-1 u2af1 "U2(RNU2) small nuclear RNA auxiliary factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PU17 U2AF1L4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RM65 U2AF1L4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94535U2AF1_DROMENo assigned EC number0.91660.73840.3636yesN/A
Q01081U2AF1_HUMANNo assigned EC number0.84780.70760.3833yesN/A
A1A4K8U2AF1_BOVINNo assigned EC number0.84780.70760.3881yesN/A
Q09176U2AF1_SCHPONo assigned EC number0.64440.68460.4120yesN/A
Q6AUG0U2AFB_ORYSJNo assigned EC number0.56040.69230.2960yesN/A
Q9D883U2AF1_MOUSENo assigned EC number0.84780.70760.3849yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd12538104 cd12538, RRM_U2AF35, RNA recognition motif in U2 s 1e-57
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 6e-39
cd12539103 cd12539, RRM_U2AF35B, RNA recognition motif in spl 3e-33
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 6e-21
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 3e-15
smart0036170 smart00361, RRM_1, RNA recognition motif 4e-14
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 2e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-10
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 2e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 9e-08
smart0036073 smart00360, RRM, RNA recognition motif 1e-07
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 2e-06
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-06
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 4e-06
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 3e-05
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 4e-05
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 6e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 3e-04
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.001
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 0.002
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 0.003
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 0.003
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 0.003
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 0.004
>gnl|CDD|240982 cd12538, RRM_U2AF35, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) Back     alignment and domain information
 Score =  173 bits (440), Expect = 1e-57
 Identities = 66/80 (82%), Positives = 74/80 (92%)

Query: 4   SNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKA 63
             V+D E+QEH+D F+EDVFVE E+KYGEIEEMNVCDNLGDHLVGNVY+KFRREEDAEKA
Sbjct: 25  VKVSDVELQEHFDEFYEDVFVELEEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAEKA 84

Query: 64  VNDLNNRWFGGRPVYAELSP 83
           VNDLNNRWF G+P+YAELSP
Sbjct: 85  VNDLNNRWFNGQPIYAELSP 104


This subgroup corresponds to the RRM of U2AF35, also termed U2AF1, which is one of the small subunits of U2 small nuclear ribonucleoprotein (snRNP) auxiliary factor (U2AF). It has been implicated in the recruitment of U2 snRNP to pre-mRNAs and is a highly conserved heterodimer composed of large and small subunits. U2AF35 directly binds to the 3' splice site of the conserved AG dinucleotide and performs multiple functions in the splicing process in a substrate-specific manner. It promotes U2 snRNP binding to the branch-point sequences of introns through association with the large subunit of U2AF, U2AF65 (also termed U2AF2). U2AF35 contains two N-terminal zinc fingers, a central RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), and a C-terminal arginine/serine (SR)-rich segment interrupted by glycines. U2AF35 binds both U2AF65 and the pre-mRNA through its RRM domain. . Length = 104

>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|240983 cd12539, RRM_U2AF35B, RNA recognition motif in splicing factor U2AF 35 kDa subunit B (U2AF35B) Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG2202|consensus260 99.88
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.77
KOG0120|consensus500 99.73
KOG0147|consensus549 99.7
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.7
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.7
smart0036170 RRM_1 RNA recognition motif. 99.64
KOG1548|consensus382 99.62
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.55
KOG1996|consensus378 99.53
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.48
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.44
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.41
KOG0148|consensus 321 99.39
KOG0124|consensus544 99.36
KOG0107|consensus195 99.27
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.27
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.24
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.23
smart0036272 RRM_2 RNA recognition motif. 99.22
smart0036071 RRM RNA recognition motif. 99.22
KOG0113|consensus 335 99.17
KOG4207|consensus 256 99.17
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.16
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.14
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.14
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.14
PLN03120 260 nucleic acid binding protein; Provisional 99.1
KOG0127|consensus 678 99.08
KOG0122|consensus270 99.06
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.05
KOG0148|consensus321 99.05
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.04
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.02
KOG0144|consensus 510 99.0
KOG0125|consensus 376 98.99
KOG0114|consensus124 98.98
KOG0130|consensus170 98.98
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.94
PLN03121 243 nucleic acid binding protein; Provisional 98.92
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.91
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.9
PLN03213 759 repressor of silencing 3; Provisional 98.89
KOG0123|consensus 369 98.89
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.88
KOG0146|consensus 371 98.87
KOG0105|consensus 241 98.85
KOG0145|consensus 360 98.82
KOG4206|consensus221 98.81
KOG0145|consensus360 98.8
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.79
KOG0121|consensus153 98.78
KOG0108|consensus 435 98.76
KOG0126|consensus219 98.74
KOG0111|consensus 298 98.7
KOG0144|consensus 510 98.66
KOG0147|consensus 549 98.66
KOG0124|consensus 544 98.63
KOG0117|consensus 506 98.63
KOG0117|consensus 506 98.63
KOG0149|consensus 247 98.61
KOG4208|consensus214 98.59
KOG0131|consensus203 98.53
KOG0131|consensus203 98.52
KOG0109|consensus 346 98.51
KOG0110|consensus725 98.48
KOG0109|consensus 346 98.47
KOG0123|consensus 369 98.44
KOG0127|consensus 678 98.39
KOG0415|consensus 479 98.26
COG5175 480 MOT2 Transcriptional repressor [Transcription] 98.26
KOG0110|consensus725 98.25
KOG4661|consensus 940 98.15
KOG4212|consensus 608 98.07
KOG2314|consensus 698 98.04
KOG0153|consensus377 97.99
KOG0146|consensus371 97.92
KOG4212|consensus608 97.85
KOG0132|consensus 894 97.79
KOG4209|consensus231 97.74
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.69
KOG4660|consensus 549 97.68
KOG0533|consensus243 97.65
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.49
KOG1190|consensus492 97.44
KOG4454|consensus 267 97.3
KOG0226|consensus290 97.29
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.23
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.18
KOG0106|consensus216 97.17
KOG4205|consensus 311 97.02
KOG1548|consensus 382 96.81
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 96.79
KOG0116|consensus419 96.77
KOG0106|consensus216 96.5
KOG0151|consensus 877 96.48
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 96.42
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.15
KOG1365|consensus 508 96.09
KOG4205|consensus311 96.08
KOG2068|consensus 327 95.89
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.89
KOG1456|consensus 494 95.84
KOG4285|consensus350 95.66
KOG0120|consensus500 95.54
KOG4211|consensus 510 95.42
KOG1190|consensus 492 95.32
KOG1995|consensus 351 95.23
KOG1457|consensus 284 94.85
KOG4210|consensus285 94.53
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 94.27
KOG1456|consensus494 93.89
KOG4211|consensus 510 93.66
KOG1855|consensus 484 93.59
KOG4307|consensus944 93.44
KOG1457|consensus284 91.46
KOG0128|consensus881 91.45
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 91.38
KOG4676|consensus 479 90.69
KOG2416|consensus 718 90.48
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 88.85
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 87.73
KOG4206|consensus221 87.46
KOG2135|consensus526 86.65
KOG3152|consensus278 85.94
KOG1365|consensus 508 85.82
KOG0112|consensus 975 84.6
KOG0115|consensus 275 84.35
KOG2591|consensus 684 83.21
KOG0128|consensus881 82.68
KOG4213|consensus205 80.21
>KOG2202|consensus Back     alignment and domain information
Probab=99.88  E-value=5.7e-23  Score=159.03  Aligned_cols=121  Identities=60%  Similarity=0.949  Sum_probs=109.9

Q ss_pred             cCCCHHHHHHHHHHHHHHHHHHhhhccCCeeEEEEecCCCCCceeEEEEEecChHHHHHHHHHhCCcEeCCeeEEEEecc
Q psy4990           4 SNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSP   83 (130)
Q Consensus         4 ~~~s~~e~~~~~~~~~eDi~~e~~~kfG~I~~v~i~~~~~~~~~G~~fV~F~~~~~A~~Ai~~lnGr~f~Gr~I~v~~~~   83 (130)
                      ..+++++++.+|+++++||..|++.|||.|++++|..+...|..|+|||+|...++|++|+..|||+||+|++|.+.+.|
T Consensus        67 ~~~~de~~q~~~defyEd~f~E~~~kygEiee~~Vc~Nl~~hl~GNVYV~f~~Ee~ae~a~~~lnnRw~~G~pi~ae~~p  146 (260)
T KOG2202|consen   67 QFLTDEELQRHEDEFYEDVFTELEDKYGEIEELNVCDNLGDHLVGNVYVKFRSEEDAEAALEDLNNRWYNGRPIHAELSP  146 (260)
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhcccchhhhhhhhhhcccHHHHHHHHHHHcCccccCCcceeeecC
Confidence            35788999999999999999999449999999999999889999999999999999999999999999999999999999


Q ss_pred             CcchhhhhccccccccCCCCCCc------ccChhHHhhhhccccccC
Q psy4990          84 VTDFREACCRQYEMVLETKNADP------VCTREKAKKKMGVYEISG  124 (130)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~g~~~------~~~~~~~~~~~g~~~~~~  124 (130)
                      +++|++++|++++.+.|++|+.+      .+++..++.++|+.+.+.
T Consensus       147 vT~~rea~C~~~e~~~C~rG~~CnFmH~k~~sr~L~r~l~~~~~~~~  193 (260)
T KOG2202|consen  147 VTDFREAICGQFERTECSRGGACNFMHVKRLSRSLRRELYGRQRKRY  193 (260)
T ss_pred             cCchhhhhhcccccccCCCCCcCcchhhhhhhHHHHHHhhhhhhccc
Confidence            99999999999999999998774      356666777777776654



>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4213|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
1jmt_A104 X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER 2e-35
2dit_A112 Solution Structure Of The Rrm_1 Domain Of Hiv Tat S 1e-05
2pe8_A105 Crystal Structure Of The Uhm Domain Of Human Spf45 2e-04
>pdb|1JMT|A Chain A, X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER Length = 104 Back     alignment and structure

Iteration: 1

Score = 143 bits (361), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 65/80 (81%), Positives = 73/80 (91%) Query: 4 SNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKA 63 S V+D EMQEHYD FFE+VF E E+KYGE+EEMNVCDNLGDHLVGNVY+KFRREEDAEKA Sbjct: 25 SAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKA 84 Query: 64 VNDLNNRWFGGRPVYAELSP 83 V DLNNRWF G+P++AELSP Sbjct: 85 VIDLNNRWFNGQPIHAELSP 104
>pdb|2DIT|A Chain A, Solution Structure Of The Rrm_1 Domain Of Hiv Tat Specific Factor 1 Variant Length = 112 Back     alignment and structure
>pdb|2PE8|A Chain A, Crystal Structure Of The Uhm Domain Of Human Spf45 (free Form) Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 3e-35
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 5e-26
2dit_A112 HIV TAT specific factor 1 variant; structural geno 7e-24
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 5e-23
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 3e-21
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 3e-18
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-15
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 7e-09
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-07
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-07
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-05
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-04
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 8e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-06
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 2e-06
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-05
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-05
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-05
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-05
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-04
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-05
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 4e-05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-05
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-05
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 9e-05
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-05
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-04
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-04
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-04
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-04
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-04
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-04
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-04
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-04
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-04
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-04
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-04
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-04
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-04
1x5p_A97 Negative elongation factor E; structure genomics, 2e-04
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 4e-04
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 4e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-04
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 7e-04
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 7e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 7e-04
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 7e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 7e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 8e-04
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 9e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 9e-04
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
 Score =  116 bits (292), Expect = 3e-35
 Identities = 64/78 (82%), Positives = 72/78 (92%)

Query: 6   VTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVN 65
           V+D EMQEHYD FFE+VF E E+KYGE+EEMNVCDNLGDHLVGNVY+KFRREEDAEKAV 
Sbjct: 27  VSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVI 86

Query: 66  DLNNRWFGGRPVYAELSP 83
           DLNNRWF G+P++AELSP
Sbjct: 87  DLNNRWFNGQPIHAELSP 104


>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.9
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.87
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.87
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.85
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.85
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.74
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.63
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.63
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.62
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.61
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.59
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.58
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.56
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.55
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.55
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.55
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.55
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.54
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.53
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.53
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.53
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.53
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.52
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.52
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.52
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.52
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.52
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.52
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.52
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.51
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.51
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.51
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.51
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.51
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.5
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.5
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.5
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.5
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.5
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.5
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.5
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.49
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.49
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.49
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.49
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.49
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.49
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.49
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.49
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.49
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.48
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.48
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.48
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.48
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.47
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.47
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.47
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.47
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.47
2div_A99 TRNA selenocysteine associated protein; structural 99.46
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.46
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.46
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.45
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.45
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.45
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.45
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.45
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.45
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.45
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.45
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.45
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.44
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.44
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.44
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.44
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.44
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.44
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.44
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.44
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.44
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.44
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.43
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.43
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.43
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.43
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.42
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.42
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.42
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.42
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.42
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.41
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.41
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.41
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.41
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.41
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.41
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.4
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.4
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.4
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.4
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.4
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.39
1x5p_A97 Negative elongation factor E; structure genomics, 99.39
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.39
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.39
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.39
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.39
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.39
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.39
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.39
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.39
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.39
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.38
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.38
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.38
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.38
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.38
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.38
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.38
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.38
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.37
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.37
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.37
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.37
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.37
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.37
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.37
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.36
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.36
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.36
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.36
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.36
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.36
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.35
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.35
2dis_A109 Unnamed protein product; structural genomics, RRM 99.35
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.35
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.35
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.35
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.35
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.35
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.34
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.34
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.34
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.34
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.34
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.33
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.33
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.33
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.33
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.33
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.32
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.32
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.31
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.31
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.98
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.3
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.3
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.3
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.29
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.29
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.28
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.28
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.27
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.27
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.27
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.27
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.27
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.27
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.26
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.26
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.26
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.25
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.25
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.25
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.24
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.24
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.24
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.22
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.22
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.2
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.2
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.2
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.16
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.16
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.16
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.14
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.14
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.11
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.11
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.1
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.07
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.06
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.01
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.98
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.97
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.94
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.9
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.36
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.94
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.61
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.44
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.81
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.97
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 95.91
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 91.04
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 90.04
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 85.4
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 80.32
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
Probab=99.90  E-value=6.8e-24  Score=144.46  Aligned_cols=88  Identities=26%  Similarity=0.492  Sum_probs=80.1

Q ss_pred             cccCCCHHHHH--HHHHHHHHHHHHHhhhccCCeeEEEEecCCCC---CceeEEEEEecChHHHHHHHHHhCCcEeCCee
Q psy4990           2 IISNVTDEEMQ--EHYDNFFEDVFVECEDKYGEIEEMNVCDNLGD---HLVGNVYIKFRREEDAEKAVNDLNNRWFGGRP   76 (130)
Q Consensus         2 ~~~~~s~~e~~--~~~~~~~eDi~~e~~~kfG~I~~v~i~~~~~~---~~~G~~fV~F~~~~~A~~Ai~~lnGr~f~Gr~   76 (130)
                      +.|+++++++.  .+|+++++||+++| ++||+|.+|+|+++..+   +++|++||+|++.++|.+|++.|||++|+||+
T Consensus        10 L~Nm~~~~~l~~d~~~~~~~~dl~~~f-~k~G~V~~v~i~~~~~~~~~~~~G~~fV~f~~~~~A~~Ai~~lnG~~f~GR~   88 (105)
T 3v4m_A           10 LMNMVLPEELLDDEEYEEIVEDVRDEC-SKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRV   88 (105)
T ss_dssp             EESSCCGGGSSSHHHHHHHHHHHHHHH-HTTSCEEEEECCCCBTTBCCTTTTEEEEEESSHHHHHHHHHHHTTCEETTEE
T ss_pred             EECCCCHHHccChHHHHHHHHHHHHHH-HccCCEEEEEEeccCCCCCcCCcEEEEEEECCHHHHHHHHHHhCCCEeCCCE
Confidence            57899999874  58999999999999 79999999999987543   57899999999999999999999999999999


Q ss_pred             EEEEeccCcchhhh
Q psy4990          77 VYAELSPVTDFREA   90 (130)
Q Consensus        77 I~v~~~~~~~~~~~   90 (130)
                      |+|.|++.++|...
T Consensus        89 i~v~~~~~~~f~~~  102 (105)
T 3v4m_A           89 VVTKYCDPDSYHRR  102 (105)
T ss_dssp             CEEEEECHHHHHTT
T ss_pred             EEEEEeCHHHHhhc
Confidence            99999999998764



>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-21
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-15
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-07
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-07
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-06
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 6e-06
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-05
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-05
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 2e-05
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-05
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-05
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-05
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 8e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-05
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-04
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-04
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-04
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 7e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-04
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 8e-04
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.001
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 0.002
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.002
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 0.002
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.003
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Splicing factor U2AF subunits
domain: U2AF35 (35 KDa subunit)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 80.5 bits (198), Expect = 1e-21
 Identities = 65/80 (81%), Positives = 73/80 (91%)

Query: 4   SNVTDEEMQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKA 63
           S V+D EMQEHYD FFE+VF E E+KYGE+EEMNVCDNLGDHLVGNVY+KFRREEDAEKA
Sbjct: 25  SAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKA 84

Query: 64  VNDLNNRWFGGRPVYAELSP 83
           V DLNNRWF G+P++AELSP
Sbjct: 85  VIDLNNRWFNGQPIHAELSP 104


>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.88
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.86
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.82
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.68
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.65
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.62
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.61
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.61
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.59
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.59
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.58
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.58
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.57
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.57
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.56
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.56
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.56
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.56
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.55
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.55
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.55
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.55
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.55
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.54
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.54
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.54
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.54
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.53
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.53
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.53
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.52
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.52
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.51
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.5
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.5
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.49
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.49
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.49
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.49
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.48
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.48
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.47
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.47
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.47
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.47
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.47
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.46
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.45
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.44
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.44
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.43
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.42
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.42
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.42
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.41
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.4
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.4
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.39
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.39
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.38
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.38
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.37
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.37
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.37
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.36
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.34
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.33
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.32
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.31
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.3
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.28
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.27
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.27
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.25
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.25
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.23
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.18
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.16
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.12
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.12
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.04
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.96
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.7
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.35
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.98
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 80.57
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=2.1e-23  Score=140.20  Aligned_cols=88  Identities=26%  Similarity=0.490  Sum_probs=79.2

Q ss_pred             cccCCCHHHH--HHHHHHHHHHHHHHhhhccCCeeEEEEecCCC---CCceeEEEEEecChHHHHHHHHHhCCcEeCCee
Q psy4990           2 IISNVTDEEM--QEHYDNFFEDVFVECEDKYGEIEEMNVCDNLG---DHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRP   76 (130)
Q Consensus         2 ~~~~~s~~e~--~~~~~~~~eDi~~e~~~kfG~I~~v~i~~~~~---~~~~G~~fV~F~~~~~A~~Ai~~lnGr~f~Gr~   76 (130)
                      +.|+|+++++  +.+|+++.+||+++| ++||.|++|.|+++..   .+..|++||+|.+.++|.+|++.|||++|+||+
T Consensus         9 l~N~~~~~~l~~~~~~~~i~edi~~e~-~k~G~v~~v~I~~~~~~~~~~~~g~vfV~f~~~e~A~~A~~~l~Gr~f~gR~   87 (104)
T d1o0pa_           9 LMNMVLPEELLDDEEYEEIVEDVRDEC-SKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRV   87 (104)
T ss_dssp             EESSCCTTTTTSHHHHHHHHHHHHHHH-TTTSCEEEEECCCCTTSSSCTTCCEEEEEESCHHHHHHHHHHHSSCCSSSSC
T ss_pred             EeCCCCHHHcCCchhHHHHHHHHHHHh-cccCceEEEEEeecCCCCccCCceEEEEEECCHHHHHHHHHHHCCCEECCeE
Confidence            5788999987  468999999999999 6999999999987643   346799999999999999999999999999999


Q ss_pred             EEEEeccCcchhhh
Q psy4990          77 VYAELSPVTDFREA   90 (130)
Q Consensus        77 I~v~~~~~~~~~~~   90 (130)
                      |.|.|++.++|...
T Consensus        88 v~v~f~~~~~y~~~  101 (104)
T d1o0pa_          88 VVTKYCDPDSYHRR  101 (104)
T ss_dssp             CEEEEECHHHHHHT
T ss_pred             EEEEEcCHHHhhhc
Confidence            99999999888764



>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure