Psyllid ID: psy499

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MAEPFLETHPKDTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGNRARLIV
ccccccccccccccccccccccccccccccHHHHHHHccccHHHHHccccccccEEccccccccHHHHHHHHHHHHHHHHHHccccccEEccccHHHHHEEHHHcccccEEEcccccccccc
ccHHHHccccHHccccccccccccccccccHHHHHHHccccEEEEEccccEEcEEEcccccccccEHHHHHHEHHHHHHHHHcccccccEcccccHEEEEEHHccccccEEccccccEEEEc
maepflethpkdtfdpdpsykgnsfsFIFYQETAKelrpntiramygrnsvenavhvtdlpedaffeFGKQCKLLKITLKLtekrplwtfespigqVLSLSLtclqnpmkivpngnrarliv
maepflethpkdtfdpdpsykgNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTclqnpmkivpngnrarliv
MAEPFLETHPKDTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCkllkitlkltekRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGNRARLIV
***********************SFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIV**********
*AEP**************SYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGN*ARLIV
********HPKDTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGNRARLIV
*AEPFLETHPKDTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGNRARLIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEPFLETHPKDTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFEFGKQCKLLKITLKLTEKRPLWTFESPIGQVLSLSLTCLQNPMKIVPNGNRARLIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q9QXL8395 Nucleoside diphosphate ki yes N/A 0.295 0.091 0.583 9e-07
Q5E9Y9377 Nucleoside diphosphate ki yes N/A 0.295 0.095 0.555 1e-06
Q9Y5B8376 Nucleoside diphosphate ki yes N/A 0.295 0.095 0.555 1e-06
Q9QXL7395 Nucleoside diphosphate ki yes N/A 0.295 0.091 0.583 2e-06
>sp|Q9QXL8|NDK7_MOUSE Nucleoside diphosphate kinase 7 OS=Mus musculus GN=Nme7 PE=2 SV=1 Back     alignment and function desciption
 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 32  ETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
           E A+ LRP T+RA++G+  V+NAVH TDLPED   E
Sbjct: 350 EIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLE 385
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|Q5E9Y9|NDK7_BOVIN Nucleoside diphosphate kinase 7 OS=Bos taurus GN=NME7 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5B8|NDK7_HUMAN Nucleoside diphosphate kinase 7 OS=Homo sapiens GN=NME7 PE=1 SV=1 Back     alignment and function description
>sp|Q9QXL7|NDK7_RAT Nucleoside diphosphate kinase 7 OS=Rattus norvegicus GN=Nme7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
318893171 374 nucleoside diphosphate kinase 7 [Ictalur 0.295 0.096 0.638 1e-06
432856042 378 PREDICTED: nucleoside diphosphate kinase 0.360 0.116 0.568 3e-06
327268910 369 PREDICTED: nucleoside diphosphate kinase 0.352 0.116 0.534 4e-06
42633264683 PREDICTED: nucleoside diphosphate kinase 0.327 0.481 0.5 8e-06
395530789 618 PREDICTED: nucleoside diphosphate kinase 0.295 0.058 0.583 9e-06
29436421 374 Ndpkz4 protein [Danio rerio] 0.295 0.096 0.583 1e-05
47218898 378 unnamed protein product [Tetraodon nigro 0.295 0.095 0.611 1e-05
56207590 374 nucleoside diphosphate kinase-Z4 [Danio 0.295 0.096 0.583 1e-05
449283928 365 Nucleoside diphosphate kinase 7, partial 0.295 0.098 0.583 1e-05
363728450 376 PREDICTED: nucleoside diphosphate kinase 0.295 0.095 0.583 1e-05
>gi|318893171|ref|NP_001187287.1| nucleoside diphosphate kinase 7 [Ictalurus punctatus] gi|308322625|gb|ADO28450.1| nucleoside diphosphate kinase 7 [Ictalurus punctatus] Back     alignment and taxonomy information
 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/36 (63%), Positives = 28/36 (77%)

Query: 32  ETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
           E A+ LRP T+RA+YG+N V+NAVH TDLPED   E
Sbjct: 329 EIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLE 364

Source: Ictalurus punctatus

Species: Ictalurus punctatus

Genus: Ictalurus

Family: Ictaluridae

Order: Siluriformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|432856042|ref|XP_004068341.1| PREDICTED: nucleoside diphosphate kinase 7-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|327268910|ref|XP_003219238.1| PREDICTED: nucleoside diphosphate kinase 7-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|426332646|ref|XP_004027910.1| PREDICTED: nucleoside diphosphate kinase 7-like [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|395530789|ref|XP_003767470.1| PREDICTED: nucleoside diphosphate kinase 7 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|29436421|gb|AAH49398.1| Ndpkz4 protein [Danio rerio] Back     alignment and taxonomy information
>gi|47218898|emb|CAG05664.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|56207590|emb|CAI21297.1| nucleoside diphosphate kinase-Z4 [Danio rerio] Back     alignment and taxonomy information
>gi|449283928|gb|EMC90522.1| Nucleoside diphosphate kinase 7, partial [Columba livia] Back     alignment and taxonomy information
>gi|363728450|ref|XP_003640505.1| PREDICTED: nucleoside diphosphate kinase 7 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
UNIPROTKB|E1C3P8376 NME7 "Uncharacterized protein" 0.459 0.148 0.428 2e-07
MGI|MGI:2449121395 Nme7 "NME/NM23 family member 7 0.295 0.091 0.583 1.3e-06
UNIPROTKB|Q9Y5B8376 NME7 "Nucleoside diphosphate k 0.295 0.095 0.555 1.5e-06
UNIPROTKB|Q5E9Y9377 NME7 "Nucleoside diphosphate k 0.295 0.095 0.555 1.5e-06
UNIPROTKB|F1LNL9382 Nme7 "Nucleoside diphosphate k 0.295 0.094 0.583 2.5e-06
RGD|619880395 Nme7 "NME/NM23 family member 7 0.295 0.091 0.583 2.7e-06
UNIPROTKB|F1PMF2376 NME7 "Uncharacterized protein" 0.295 0.095 0.527 3.2e-06
FB|FBgn0028997387 nmdyn-D7 "nmdyn-D7" [Drosophil 0.295 0.093 0.583 4.3e-06
ZFIN|ZDB-GENE-000210-35374 nme7 "non-metastatic cells 7, 0.295 0.096 0.527 6.3e-05
UNIPROTKB|E1C3P8 NME7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 2.0e-07, P = 2.0e-07
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query:    12 DTFDPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
             +   P+P      F      E A+ LRP T+RA++G+N ++NAVH TDLPED   E
Sbjct:   311 EIIQPEPPKVFRDFCGPSDPEIARHLRPGTLRAVFGKNKIQNAVHCTDLPEDGLLE 366
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0003351 "epithelial cilium movement" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0007368 "determination of left/right symmetry" evidence=IEA
GO:0007420 "brain development" evidence=IEA
GO:0042073 "intraflagellar transport" evidence=IEA
GO:0060830 "ciliary receptor clustering involved in smoothened signaling pathway" evidence=IEA
GO:0060972 "left/right pattern formation" evidence=IEA
MGI|MGI:2449121 Nme7 "NME/NM23 family member 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5B8 NME7 "Nucleoside diphosphate kinase 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9Y9 NME7 "Nucleoside diphosphate kinase 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNL9 Nme7 "Nucleoside diphosphate kinase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|619880 Nme7 "NME/NM23 family member 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMF2 NME7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0028997 nmdyn-D7 "nmdyn-D7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000210-35 nme7 "non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 2e-12
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 7e-06
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 8e-06
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 3e-05
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 2e-04
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 3e-04
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 4e-04
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 0.004
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information 
 Score = 59.2 bits (144), Expect = 2e-12
 Identities = 23/33 (69%), Positives = 28/33 (84%)

Query: 32  ETAKELRPNTIRAMYGRNSVENAVHVTDLPEDA 64
           E AK+LRPNT+RA YG++ V+NAVH TDLPED 
Sbjct: 94  EIAKQLRPNTLRARYGKDKVQNAVHCTDLPEDG 126

The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner. Length = 134
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PLN02931177 nucleoside diphosphate kinase family protein 99.93
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 99.93
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 99.92
PRK14542137 nucleoside diphosphate kinase; Provisional 99.92
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 99.92
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 99.92
PRK14541140 nucleoside diphosphate kinase; Provisional 99.92
PRK14545139 nucleoside diphosphate kinase; Provisional 99.92
PRK14543169 nucleoside diphosphate kinase; Provisional 99.92
PLN02619238 nucleoside-diphosphate kinase 99.91
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 99.91
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 99.91
PRK14540134 nucleoside diphosphate kinase; Provisional 99.91
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 99.91
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 99.9
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 99.9
KOG0888|consensus156 99.9
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 99.89
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 99.89
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 99.87
PRK14544183 nucleoside diphosphate kinase; Provisional 99.84
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information 
Probab=99.93  E-value=1.9e-26  Score=177.89  Aligned_cols=84  Identities=26%  Similarity=0.215  Sum_probs=77.1

Q ss_pred             CCcchhhhCCCCCC-------------------CCCchHhhhhccCCCChhhhhhcCCCchhhhhccCCCcceEEecCCH
Q psy499            1 MAEPFLETHPKDTF-------------------DPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLP   61 (122)
Q Consensus         1 ~~~~~~~~~~~~~~-------------------G~NAV~~wR~liGptdp~~Ak~~~P~SIRa~fG~d~~rNaVHgSDs~   61 (122)
                      +|++||++|..++|                   |+|||+.||++|||+||..|+...|+|||++||++.++|+||||||+
T Consensus        72 ~a~~fY~~h~gk~ff~~Lv~~mtSGP~vam~L~g~naV~~~R~liGptdp~~A~~~~P~sIRa~fG~~~~rN~vHgSDs~  151 (177)
T PLN02931         72 RASLFYAEHSSRSFFPSLVKYMTSGPVLVMVLEKENAVSDWRTLIGPTDARKAKISHPNSIRAMCGLDSEKNCVHGSDSP  151 (177)
T ss_pred             HHHHHHHHhCCCccHHHHHHHHHhCCeEEEEEecCCHHHHHHHHhCCCChhhhccCCCCCchHHhcCcccccceECCCCH
Confidence            47899999999888                   99999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCCccchhhhhcc
Q psy499           62 EDAFFEFGKQCKLLKITLKLTEK   84 (122)
Q Consensus        62 EsA~rEi~fFFp~~~~~~~~~~~   84 (122)
                      ++|.+||+|||+.+...+...+.
T Consensus       152 e~A~~Ei~~fF~~~~~~~~~~~~  174 (177)
T PLN02931        152 ESAEREISFFFGDVSSGDVASQH  174 (177)
T ss_pred             HHHHHHHHHhCCccccccccccc
Confidence            99999999999987765444333

>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 3e-04
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure 
Iteration: 1

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)
Query: 32  ETAKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
           E A+++ PN+IRA +G +  +NA+H +D PE A +E
Sbjct: 96  EEARKVAPNSIRAQFGTDKGKNAIHASDSPESAQYE 131

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 5e-04
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
 Score = 36.4 bits (85), Expect = 5e-04
 Identities = 15/34 (44%), Positives = 25/34 (73%)

Query: 34  AKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
           A+++ PN+IRA +G +  +NA+H +D PE A +E
Sbjct: 98  ARKVAPNSIRAQFGTDKGKNAIHASDSPESAQYE 131

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 99.95
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 99.95
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 99.95
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 99.94
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 99.94
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 99.94
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 99.94
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 99.94
3js9_A156 Nucleoside diphosphate kinase family protein; niai 99.94
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 99.94
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 99.94
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 99.94
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 99.94
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 99.94
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 99.94
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 99.93
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 99.93
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 99.93
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 99.93
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 99.93
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 99.93
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 99.93
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 99.93
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 99.93
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 99.93
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 99.92
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 99.92
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 99.92
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 99.86
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.28
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
Probab=99.95  E-value=4.2e-29  Score=189.13  Aligned_cols=88  Identities=18%  Similarity=0.103  Sum_probs=83.2

Q ss_pred             CcchhhhCCCCCC-------------------CCCchHhhhhccCCCChhhhhhcCCCchhhhhccCCCcceEEecCCHH
Q psy499            2 AEPFLETHPKDTF-------------------DPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPE   62 (122)
Q Consensus         2 ~~~~~~~~~~~~~-------------------G~NAV~~wR~liGptdp~~Ak~~~P~SIRa~fG~d~~rNaVHgSDs~E   62 (122)
                      |++||.+|..++|                   |+|||+.||+|||||||.+|   .|+|||++||++..+|+||||||+|
T Consensus        55 a~~fY~~h~~kpff~~Lv~~mtSGPvvamvleg~naV~~~R~l~GpTdp~~A---~PgTIR~~fg~~~~~N~vHgSDs~e  131 (161)
T 4fkx_A           55 AKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADS---LPGTIRGDFAVDVGRNVCHGSDSVE  131 (161)
T ss_dssp             HHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSGGGC---CTTSHHHHHCCBTTBCCEEECSSHH
T ss_pred             HHHHHHHHcCCccHHHHHHHHhCCCcEEEEEeccChHHHHHHHhcCCChhhc---CCCChhHhhCCCccceeEEeCCCHH
Confidence            7899999999999                   99999999999999999988   8999999999999999999999999


Q ss_pred             HHHHHHHhcCCCccchhhhhccCCcceeeCC
Q psy499           63 DAFFEFGKQCKLLKITLKLTEKRPLWTFESP   93 (122)
Q Consensus        63 sA~rEi~fFFp~~~~~~~~~~~~~~~~~~~~   93 (122)
                      +|.+||+|||+..+++ .|......|.|+++
T Consensus       132 sA~rEI~~fF~~~e~~-~~~~~~~~~~ye~~  161 (161)
T 4fkx_A          132 SAKREIAFWFKAEELV-SWTSHSVKQIYERA  161 (161)
T ss_dssp             HHHHHHHHHCCGGGSC-CCCCTTHHHHCSCC
T ss_pred             HHHHHHHHcCChhhcc-cccccchhheecCC
Confidence            9999999999998888 78888889998863
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-07
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-06
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 4e-06
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 2e-05
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 4e-05
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-04
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-04
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-04
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 5e-04
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 8e-04
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 0.001
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 0.002
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 0.002
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 0.003
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 44.2 bits (104), Expect = 2e-07
 Identities = 11/34 (32%), Positives = 15/34 (44%)

Query: 34  AKELRPNTIRAMYGRNSVENAVHVTDLPEDAFFE 67
            +   P TIR  +   +  N VH +D  E A  E
Sbjct: 94  VQAAAPGTIRGDFALETQFNLVHGSDSAESAQRE 127
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 99.94
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 99.94
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 99.94
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 99.94
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 99.94
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 99.94
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 99.94
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 99.93
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 99.93
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 99.93
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 99.93
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 99.93
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 99.92
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 99.92
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 99.9
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 99.89
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]

Probab=99.94  E-value=2.2e-28  Score=180.47  Aligned_cols=85  Identities=18%  Similarity=0.145  Sum_probs=78.8

Q ss_pred             CcchhhhCCCCCC-------------------CCCchHhhhhccCCCChhhhhhcCCCchhhhhccCCCcceEEecCCHH
Q psy499            2 AEPFLETHPKDTF-------------------DPDPSYKGNSFSFIFYQETAKELRPNTIRAMYGRNSVENAVHVTDLPE   62 (122)
Q Consensus         2 ~~~~~~~~~~~~~-------------------G~NAV~~wR~liGptdp~~Ak~~~P~SIRa~fG~d~~rNaVHgSDs~E   62 (122)
                      |++||++|..++|                   |+|||..||+|||||||.+|   .|+|||++||.+.++|+||||||++
T Consensus        45 a~~~Y~~~~~k~ff~~lv~~mtsGp~v~~~l~~~nav~~~R~l~Gptdp~~a---~~~siR~~fg~~~~~N~vHgSds~e  121 (149)
T d1xiqa_          45 LKEHYKELSDQPFFKNLVAYISKGPVVAMVWEGVDMVKQGRKLIGETNPLTS---NTGTIRGDFCLEVSKNVIHGSDSVA  121 (149)
T ss_dssp             HHHHTGGGSSSSSCTTHHHHHTTSCEEEEEEESTTHHHHHHHHHCCSSTTTS---CTTSHHHHHCCBTTBCSEEECSSHH
T ss_pred             HHHHHHHHccccccchhhhhcccCCEEEEEeccchhhHHHHHhccCCCcccC---CCCCccccceecccccceECCCCHH
Confidence            7899999999999                   89999999999999999999   6999999999999999999999999


Q ss_pred             HHHHHHHhcCCCccchhhhhccCCccee
Q psy499           63 DAFFEFGKQCKLLKITLKLTEKRPLWTF   90 (122)
Q Consensus        63 sA~rEi~fFFp~~~~~~~~~~~~~~~~~   90 (122)
                      +|.+||+||||+.++. +|......|.|
T Consensus       122 ~A~rEi~~fF~~~ei~-~~~~~~~~~~~  148 (149)
T d1xiqa_         122 SANKEINIWFKAEELT-QWKHHMKEWIC  148 (149)
T ss_dssp             HHHHHHHHHCCGGGSC-CCCCGGGGGTC
T ss_pred             HHHHHHHHcCChhhcc-cCccCcHhhhc
Confidence            9999999999998888 66666666665
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure