Psyllid ID: psy5004


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR
ccHHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEccccccccccEEEEEEEEccEEEEEHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccEEcccccccccEEEEEEcccccccHHHccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHcccEEEEEEEccccccccccccEEEEcccccccccccEEEEEEEcccEEEEcHHHHHHHHHHHcccccccccccccccccccHEEEEcccccHccccccccccccccEEEEcHHHHHHHHHHHccccccccccccccccccHHHEEEcccccHccccc
MKLLVLTLSLISFVSRCSALLCYQcvstqpgcgtpfkwlwypsiscpeedDICVKIIERkgaeeiitRDCLSTVKAfrtdipadryegcraaakdpklanyvnhsipeldvqrpselktgyteeiitRDCLSTVKAfrtdipadryegcraaakdpklanyvnhsipeldvqr
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIErkgaeeiitrdclstvkafrtdipadryeGCRAAakdpklanyvnhsipeldvqrpselktgyteeiitrdclstVKAFrtdipadryeGCRAaakdpklanyvnhsipeldvqr
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR
**LLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYV***********
*KLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSI*EL*V**
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPEL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQRPSELKTGYTEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
240848789161 uncharacterized protein LOC100168749 pre 0.641 0.689 0.684 6e-40
383852296154 PREDICTED: uncharacterized protein LOC10 0.687 0.772 0.576 5e-36
345487346155 PREDICTED: hypothetical protein LOC10012 0.624 0.696 0.657 1e-35
340709946160 PREDICTED: hypothetical protein LOC10065 0.647 0.7 0.598 2e-35
350421346160 PREDICTED: hypothetical protein LOC10074 0.647 0.7 0.589 3e-35
307185897154 hypothetical protein EAG_05804 [Camponot 0.653 0.733 0.601 6e-35
91077808155 PREDICTED: similar to conserved hypothet 0.687 0.767 0.586 2e-34
380022214155 PREDICTED: uncharacterized protein LOC10 0.549 0.612 0.694 9e-34
242008769145 conserved hypothetical protein [Pediculu 0.549 0.655 0.697 5e-33
332373252158 unknown [Dendroctonus ponderosae] 0.774 0.848 0.525 6e-33
>gi|240848789|ref|NP_001155799.1| uncharacterized protein LOC100168749 precursor [Acyrthosiphon pisum] gi|239788070|dbj|BAH70730.1| ACYPI009426 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (81%)

Query: 3   LLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGA 62
            L L +    FV   S LLCYQCVST PGCGTPFKWLW+ +ISCPEEDD+CVK+IE+ GA
Sbjct: 7   FLSLVIFSTIFVHAQSLLLCYQCVSTHPGCGTPFKWLWHKTISCPEEDDLCVKVIEKVGA 66

Query: 63  EEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR 113
           EE ITRDCLS++K FRTDIPAD+YEGCR ++ D KL +YVN+SIPELD++R
Sbjct: 67  EERITRDCLSSLKGFRTDIPADKYEGCRKSSVDVKLGHYVNNSIPELDIKR 117




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852296|ref|XP_003701664.1| PREDICTED: uncharacterized protein LOC100876421 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345487346|ref|XP_001606729.2| PREDICTED: hypothetical protein LOC100120756 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340709946|ref|XP_003393560.1| PREDICTED: hypothetical protein LOC100651313 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350421346|ref|XP_003492813.1| PREDICTED: hypothetical protein LOC100741951 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307185897|gb|EFN71724.1| hypothetical protein EAG_05804 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91077808|ref|XP_970231.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270001488|gb|EEZ97935.1| hypothetical protein TcasGA2_TC000323 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380022214|ref|XP_003694947.1| PREDICTED: uncharacterized protein LOC100864197 [Apis florea] Back     alignment and taxonomy information
>gi|242008769|ref|XP_002425172.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508874|gb|EEB12434.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332373252|gb|AEE61767.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
FB|FBgn0036198158 crim "crimpled" [Drosophila me 0.630 0.689 0.562 7.9e-30
FB|FBgn0036198 crim "crimpled" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
 Identities = 63/112 (56%), Positives = 77/112 (68%)

Query:     4 LVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKW--LWYPSISCPEEDDICVKIIERKG 61
             L+  L L + +   SA+ CY+C S  PGC   F W  + +    CPE DDICVK+ ER+G
Sbjct:     7 LIAALLLAALIHEGSAIWCYRCTSATPGCAEKFNWRGIGFLGEHCPEPDDICVKVTERRG 66

Query:    62 AEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR 113
             A E ITRDCLS + +FR DIPAD+YEGCR AA D KLANYVNH+I E DV+R
Sbjct:    67 ARETITRDCLSAL-SFRKDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRR 117


GO:0019991 "septate junction assembly" evidence=IMP
GO:0035151 "regulation of tube size, open tracheal system" evidence=IMP

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
cd0011779 LU Ly-6 antigen / uPA receptor -like domain; occur 97.49
smart0013479 LU Ly-6 antigen / uPA receptor -like domain. Three 97.14
PF0008763 Toxin_1: Snake toxin; InterPro: IPR003571 Snake to 96.42
cd0020664 snake_toxin Snake toxin domain, present in short a 95.98
PF0002177 UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor si 95.5
PF06211107 BAMBI: BMP and activin membrane-bound inhibitor (B 94.86
PF0106483 Activin_recp: Activin types I and II receptor doma 94.73
PF05444152 DUF753: Protein of unknown function (DUF753); Inte 94.46
PF05444152 DUF753: Protein of unknown function (DUF753); Inte 93.47
PF0298883 PLA2_inh: Phospholipase A2 inhibitor; InterPro: IP 91.87
PF06579129 Ly-6_related: Caenorhabditis elegans ly-6-related 89.02
>cd00117 LU Ly-6 antigen / uPA receptor -like domain; occurs singly in GPI-linked cell-surface glycoproteins (Ly-6 family,CD59, thymocyte B cell antigen, Sgp-2) or as three-fold repeated domain in urokinase-type plasminogen activator receptor Back     alignment and domain information
Probab=97.49  E-value=0.00015  Score=50.40  Aligned_cols=47  Identities=30%  Similarity=0.732  Sum_probs=36.9

Q ss_pred             eeeecccCC-CCCCCCCCCCCccccccCCCCCCceEEEEEecC----cceeEeechhhhh
Q psy5004          20 LLCYQCVST-QPGCGTPFKWLWYPSISCPEEDDICVKIIERKG----AEEIITRDCLSTV   74 (173)
Q Consensus        20 L~CY~C~S~-~PgC~dpfn~~~~~~etCp~~~d~CvKVier~g----~~~~itRdClS~~   74 (173)
                      |+||.|.+. ...|..+        ++||+.++.|+++.....    ....++|+|+++.
T Consensus         1 L~C~~C~~~~~~~C~~~--------~~C~~~~~~C~~~~~~~~~~~~~~~~~~rgC~~~C   52 (79)
T cd00117           1 LECYSCTGVSTSSCSTE--------TNCPSPDDQCLTAVATVIEESVRLSLVVRGCASDC   52 (79)
T ss_pred             CccCcCCCCCCCCCCCC--------CccCCCCCEeeEEEEEEEeeccccceEECcccCCC
Confidence            789999883 4468876        599999999999877742    3466889999954



Topology of these domains is similar to that of snake venom neurotoxins.

>smart00134 LU Ly-6 antigen / uPA receptor -like domain Back     alignment and domain information
>PF00087 Toxin_1: Snake toxin; InterPro: IPR003571 Snake toxins belong to a family of proteins [] which groups short and long neurotoxins, cytotoxins and short toxins, as well as a other miscellaneous venom peptides Back     alignment and domain information
>cd00206 snake_toxin Snake toxin domain, present in short and long neurotoxins, cytotoxins and short toxins, and in other miscellaneous venom peptides Back     alignment and domain information
>PF00021 UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor similarity Back     alignment and domain information
>PF06211 BAMBI: BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain; InterPro: IPR009345 This family consists of several eukaryotic BMP and activin membrane-bound inhibitor (BAMBI) proteins Back     alignment and domain information
>PF01064 Activin_recp: Activin types I and II receptor domain; InterPro: IPR000472 Transforming growth factor-beta (TGF-beta) forms a family with other growth factors described in PDOC00223 from PROSITEDOC Back     alignment and domain information
>PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF02988 PLA2_inh: Phospholipase A2 inhibitor; InterPro: IPR004126 Proteins in this entry inhibit basic phospholipase A2 isozymes in snake's venom [, ] Back     alignment and domain information
>PF06579 Ly-6_related: Caenorhabditis elegans ly-6-related protein; InterPro: IPR010558 This family consists of several Caenorhabditis elegans specific ly-6-related HOT and ODR proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
2j8b_A79 CD59 glycoprotein; lipid-binding protein, lipid-bi 97.04
3neq_A66 Muscarinic M1-toxin1, muscarinic toxin 1; chimeric 96.94
2l03_A74 LY-6/neurotoxin-like protein 1; LYNX1, acetylcholi 96.93
1mr6_A68 Neurotoxin; venom; NMR {Bungarus multicinctus} SCO 96.67
2jqp_A65 WEAK toxin 1; protein; NMR {Bungarus candidus} 96.42
1kba_A66 Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} 96.38
3laq_U277 UPAR, U-PAR, urokinase plasminogen activator surfa 96.3
1ff4_A65 Muscarinic toxin/acetylcholine receptor binding P; 96.27
1jgk_A66 Candoxin; beta sheet, snake venom protein, toxin; 96.26
1hc9_A74 Alpha-bungarotoxin; toxin/peptide, complex (toxin/ 96.21
2fd6_U276 Urokinase plasminogen activator surface receptor; 96.15
1vyc_A65 Bucain, neurotoxin; snake neurotoxin; NMR {Bungaru 96.13
2h7z_B77 Irditoxin subunit B; three-finger toxin, neurotoxi 96.1
1ywh_A313 Urokinase plasminogen activator surface receptor; 95.99
2h5f_A77 Denmotoxin; three-finger toxin, neurotoxin, snake 95.82
3hh7_A65 Muscarinic toxin-like protein 3 homolog; haditoxin 95.61
1cvo_A62 Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g. 95.59
3era_A62 Erabutoxin A; snake neurotoxin, venom, postsynapti 95.4
1ntn_A72 Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja 95.34
1f94_A63 Bucandin; three-finger snake presynaptic neurotoxi 95.31
2l5s_A88 TGF-beta receptor type-1; ALK5, transforming growt 95.28
2pjy_C79 TGF-beta receptor type-1; ternary complex, three f 95.21
1vb0_A61 Cobrotoxin B; short-chain neurotoxin, three-finger 95.18
1lsi_A66 LSIII; venom, multigene family, neurotoxin; NMR {L 94.95
3vts_A61 Cytotoxin 1; three finger toxin, venom toxin; 2.43 94.86
2h7z_A75 Irditoxin subunit A; three-finger toxin, neurotoxi 93.14
2h62_C129 Bone morphogenetic protein receptor type IA; TGF-b 92.95
3plc_A63 Beta-cardiotoxin OH-27; beta-sheet, novel cardioto 92.69
1ug4_A60 Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A { 91.65
1ntx_A60 Alpha-neurotoxin; NMR {Dendroaspis polylepis polyl 90.59
3evs_C119 Bone morphogenetic protein receptor type-1B; ligan 90.18
1tfs_A60 Toxin FS2; NMR {Dendroaspis polylepis polylepis} S 88.71
1fas_A61 Fasciculin 1; toxin; 1.80A {Dendroaspis angusticep 88.37
1ywh_A313 Urokinase plasminogen activator surface receptor; 88.36
4aea_A71 Long neurotoxin 1; three-finger toxin, nicotinic a 87.96
3laq_U277 UPAR, U-PAR, urokinase plasminogen activator surfa 87.22
>2j8b_A CD59 glycoprotein; lipid-binding protein, lipid-binding protein MAC, membrane, GPI-anchor, complement, lipoprotein; 1.15A {Homo sapiens} SCOP: g.7.1.3 PDB: 2ux2_A 2uwr_A 1cdq_A 1cdr_A* 1cds_A* 2ofs_A 1erg_A 1erh_A Back     alignment and structure
Probab=97.04  E-value=0.00059  Score=47.95  Aligned_cols=41  Identities=24%  Similarity=0.656  Sum_probs=33.5

Q ss_pred             eeeecccCCCCCCCCCCCCCccccccCCCCCCceEEEEEecCcceeEeechhh
Q psy5004          20 LLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLS   72 (173)
Q Consensus        20 L~CY~C~S~~PgC~dpfn~~~~~~etCp~~~d~CvKVier~g~~~~itRdClS   72 (173)
                      |+||.|......|.++        ++||.++|.|+.+...    ..++|+|++
T Consensus         2 L~Cy~C~~~~~~C~~~--------~~C~~~~d~C~t~~~~----~~~~k~C~~   42 (79)
T 2j8b_A            2 LQCYNCPNPTADCKTA--------VNCSSDFDACLITKAG----LQVYNKCWK   42 (79)
T ss_dssp             CEEECCSSCCTTCCCE--------EECCTTCCEEEEEEET----TEEEEEEEC
T ss_pred             cCCcCCCCCCCCCccc--------eecCCCCCEeEEEEeC----CeeEecccC
Confidence            8999998765579886        7999999999877762    356799997



>3neq_A Muscarinic M1-toxin1, muscarinic toxin 1; chimeric muscarinic toxin, HM1-muscarinic receptor, snake to green mamba; 1.25A {Dendroaspis angusticeps} PDB: 2vlw_A* 3fev_A 4do8_A Back     alignment and structure
>2l03_A LY-6/neurotoxin-like protein 1; LYNX1, acetylcholine receptor, endogenic neuromodulator, Thr toxins, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1mr6_A Neurotoxin; venom; NMR {Bungarus multicinctus} SCOP: g.7.1.1 Back     alignment and structure
>2jqp_A WEAK toxin 1; protein; NMR {Bungarus candidus} Back     alignment and structure
>1kba_A Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2nbt_A Back     alignment and structure
>3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} Back     alignment and structure
>1ff4_A Muscarinic toxin/acetylcholine receptor binding P; three fingers motif; 1.50A {Dendroaspis angusticeps} SCOP: g.7.1.1 Back     alignment and structure
>1jgk_A Candoxin; beta sheet, snake venom protein, toxin; NMR {Bungarus candidus} SCOP: g.7.1.1 Back     alignment and structure
>1hc9_A Alpha-bungarotoxin; toxin/peptide, complex (toxin/peptide), acetylcholine receptor mimitope, alpha-bungarotoxin, 3- finger; 1.8A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2qc1_A* 1abt_A 1bxp_A 1haa_A 1haj_A 1hc9_B 1hoy_A 1idg_A 1idh_A 1idi_A 1idl_A 1ik8_A 1ikc_A 1jbd_A 1kc4_A 1kfh_A 1kl8_A 1l4w_A 1ljz_A 1rgj_A ... Back     alignment and structure
>2fd6_U Urokinase plasminogen activator surface receptor; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 PDB: 3bt2_U* 3bt1_U* 2i9b_E* 3u74_U* 3u73_U* Back     alignment and structure
>1vyc_A Bucain, neurotoxin; snake neurotoxin; NMR {Bungarus candidus} SCOP: g.7.1.1 PDB: 2h8u_A Back     alignment and structure
>2h7z_B Irditoxin subunit B; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 Back     alignment and structure
>1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 Back     alignment and structure
>2h5f_A Denmotoxin; three-finger toxin, neurotoxin, snake venom; 1.90A {Boiga dendrophila} SCOP: g.7.1.1 Back     alignment and structure
>3hh7_A Muscarinic toxin-like protein 3 homolog; haditoxin, three finger toxin, snake venom, neurotoxin, nicotinic acetylcholine receptors; 1.55A {Ophiophagus hannah} SCOP: g.7.1.0 Back     alignment and structure
>1cvo_A Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g.7.1.1 PDB: 1kxi_A Back     alignment and structure
>3era_A Erabutoxin A; snake neurotoxin, venom, postsynaptic neurotoxin; 1.70A {Laticauda semifasciata} SCOP: g.7.1.1 PDB: 2era_A Back     alignment and structure
>1ntn_A Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja oxiana} SCOP: g.7.1.1 PDB: 1w6b_A Back     alignment and structure
>1f94_A Bucandin; three-finger snake presynaptic neurotoxin; 0.97A {Bungarus candidus} SCOP: g.7.1.1 PDB: 1ijc_A Back     alignment and structure
>2l5s_A TGF-beta receptor type-1; ALK5, transforming growth factor beta, type I receptor, SIGN protein; NMR {Homo sapiens} Back     alignment and structure
>2pjy_C TGF-beta receptor type-1; ternary complex, three finger toxin, cytokine-cytokine recep complex; 3.00A {Homo sapiens} PDB: 3kfd_I Back     alignment and structure
>1vb0_A Cobrotoxin B; short-chain neurotoxin, three-finger toxin; HET: SO4; 0.92A {Naja atra} SCOP: g.7.1.1 PDB: 1onj_A* 1je9_A 1nor_A 1iq9_A 1nea_A 3nds_A 1cod_A 1coe_A 1v6p_A 1g6m_A 1qkd_A 1qke_A 5ebx_A 1era_A 1fra_A 3ebx_A 6ebx_A 1nxb_A Back     alignment and structure
>1lsi_A LSIII; venom, multigene family, neurotoxin; NMR {Laticauda semifasciata} SCOP: g.7.1.1 Back     alignment and structure
>3vts_A Cytotoxin 1; three finger toxin, venom toxin; 2.43A {Hemachatus haemachatus} Back     alignment and structure
>2h7z_A Irditoxin subunit A; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 Back     alignment and structure
>2h62_C Bone morphogenetic protein receptor type IA; TGF-beta superfamily, ligand-receptor complex, hormone/growth factor complex; 1.85A {Homo sapiens} SCOP: g.7.1.3 PDB: 2h64_B 3nh7_A 1rew_C 3qb4_B 2goo_B* 2qj9_D 2qja_C 2qjb_C 2k3g_A 1es7_B Back     alignment and structure
>3plc_A Beta-cardiotoxin OH-27; beta-sheet, novel cardiotoxin; 2.41A {Ophiophagus hannah} SCOP: g.7.1.1 Back     alignment and structure
>1ug4_A Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A {Naja atra} PDB: 1h0j_A* 1i02_A 1xt3_A* 2bhi_A* 2crs_A 2crt_A 1cxn_A 1cxo_A 1tgx_A 1cb9_A 1ccq_A 1ffj_A 1chv_S 2ccx_A 1cre_A 1crf_A 1kbs_A 1kbt_A 1rl5_A 1zad_A ... Back     alignment and structure
>1ntx_A Alpha-neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 Back     alignment and structure
>3evs_C Bone morphogenetic protein receptor type-1B; ligand-receptor complex, cystin-knot ligand, three-finger to (receptor); 2.10A {Mus musculus} Back     alignment and structure
>1tfs_A Toxin FS2; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 Back     alignment and structure
>1fas_A Fasciculin 1; toxin; 1.80A {Dendroaspis angusticeps} SCOP: g.7.1.1 PDB: 1fsc_A 1f8u_B* 1b41_B 1fss_B* 1ku6_B* 1mah_F* 2x8b_B* 1qm7_A Back     alignment and structure
>1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 Back     alignment and structure
>4aea_A Long neurotoxin 1; three-finger toxin, nicotinic acetylcholine receptor; 1.94A {Naja kaouthia} SCOP: g.7.1.1 PDB: 1lxg_A 1lxh_A 1yi5_F 1ctx_A 2ctx_A 1txa_A 1txb_A Back     alignment and structure
>3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1ff4a_65 Muscarinic toxin {Green mamba (Dendroaspis angusti 94.7
d1mr6a_68 Bungarotoxin {Many-banded krait (Bungarus multicin 94.46
d2j8ba177 CD59 {Human (Homo sapiens) [TaxId: 9606]} 92.99
d1kxia_62 Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxI 92.94
d1jgka_66 Candoxin {Malayan krait (Bungarus candidus) [TaxId 91.56
d2h62c184 BMP receptor Ia ectodomain {Human (Homo sapiens) [ 90.0
d2h8ua165 Bucain {Malaysian krait (Bungarus candidus) [TaxId 89.73
d1tgxa_60 gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId 89.53
d2fd6u397 Urokinase plasminogen activator surface receptor, 88.82
d1hc9a_74 Bungarotoxin {Many-banded krait (Bungarus multicin 86.47
d1ntna_72 Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 865 86.04
d2fd6u287 Urokinase plasminogen activator surface receptor, 83.42
d1v6pa_62 Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) 83.29
>d1ff4a_ g.7.1.1 (A:) Muscarinic toxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
class: Small proteins
fold: Snake toxin-like
superfamily: Snake toxin-like
family: Snake venom toxins
domain: Muscarinic toxin
species: Green mamba (Dendroaspis angusticeps) [TaxId: 8618]
Probab=94.70  E-value=0.011  Score=39.87  Aligned_cols=45  Identities=24%  Similarity=0.403  Sum_probs=34.1

Q ss_pred             eeeecccCCCCCCCCCCCCCccccccCCCCCCceEEEEEe-cCcceeEeechhhhh
Q psy5004          20 LLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIER-KGAEEIITRDCLSTV   74 (173)
Q Consensus        20 L~CY~C~S~~PgC~dpfn~~~~~~etCp~~~d~CvKVier-~g~~~~itRdClS~~   74 (173)
                      |.|+.|.|.+  |..        ++|||+.+++|.|.... .+.-..|+|+|.-+.
T Consensus         1 ltC~~~~s~~--~~t--------~~tCp~GqnlCykk~~~~~~~g~~i~rGCaaTC   46 (65)
T d1ff4a_           1 LTCVTTKSIG--GVT--------TEDCPAGQNVCFKRWHYVTPKNYDIIKGCAATC   46 (65)
T ss_dssp             CEEEEECTTS--SEE--------EEECCTTCCEEEEEEEESSSSCEEEEEEEESSC
T ss_pred             CeeecCCCcc--CCc--------cccCCCccceeeEEEEecCCCCCEEEeeeeCcC
Confidence            5688888876  333        49999999999998744 445566999998654



>d1mr6a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), gamma-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d2j8ba1 g.7.1.3 (A:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]} Back     information, alignment and structure
>d1jgka_ g.7.1.1 (A:) Candoxin {Malayan krait (Bungarus candidus) [TaxId: 92438]} Back     information, alignment and structure
>d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h8ua1 g.7.1.1 (A:1-65) Bucain {Malaysian krait (Bungarus candidus) [TaxId: 92438]} Back     information, alignment and structure
>d1tgxa_ g.7.1.1 (A:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]} Back     information, alignment and structure
>d2fd6u3 g.7.1.3 (U:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hc9a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1ntna_ g.7.1.1 (A:) Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 8657]} Back     information, alignment and structure
>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6pa_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]} Back     information, alignment and structure