Psyllid ID: psy5004
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 240848789 | 161 | uncharacterized protein LOC100168749 pre | 0.641 | 0.689 | 0.684 | 6e-40 | |
| 383852296 | 154 | PREDICTED: uncharacterized protein LOC10 | 0.687 | 0.772 | 0.576 | 5e-36 | |
| 345487346 | 155 | PREDICTED: hypothetical protein LOC10012 | 0.624 | 0.696 | 0.657 | 1e-35 | |
| 340709946 | 160 | PREDICTED: hypothetical protein LOC10065 | 0.647 | 0.7 | 0.598 | 2e-35 | |
| 350421346 | 160 | PREDICTED: hypothetical protein LOC10074 | 0.647 | 0.7 | 0.589 | 3e-35 | |
| 307185897 | 154 | hypothetical protein EAG_05804 [Camponot | 0.653 | 0.733 | 0.601 | 6e-35 | |
| 91077808 | 155 | PREDICTED: similar to conserved hypothet | 0.687 | 0.767 | 0.586 | 2e-34 | |
| 380022214 | 155 | PREDICTED: uncharacterized protein LOC10 | 0.549 | 0.612 | 0.694 | 9e-34 | |
| 242008769 | 145 | conserved hypothetical protein [Pediculu | 0.549 | 0.655 | 0.697 | 5e-33 | |
| 332373252 | 158 | unknown [Dendroctonus ponderosae] | 0.774 | 0.848 | 0.525 | 6e-33 |
| >gi|240848789|ref|NP_001155799.1| uncharacterized protein LOC100168749 precursor [Acyrthosiphon pisum] gi|239788070|dbj|BAH70730.1| ACYPI009426 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 168 bits (426), Expect = 6e-40, Method: Compositional matrix adjust.
Identities = 76/111 (68%), Positives = 91/111 (81%)
Query: 3 LLVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGA 62
L L + FV S LLCYQCVST PGCGTPFKWLW+ +ISCPEEDD+CVK+IE+ GA
Sbjct: 7 FLSLVIFSTIFVHAQSLLLCYQCVSTHPGCGTPFKWLWHKTISCPEEDDLCVKVIEKVGA 66
Query: 63 EEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR 113
EE ITRDCLS++K FRTDIPAD+YEGCR ++ D KL +YVN+SIPELD++R
Sbjct: 67 EERITRDCLSSLKGFRTDIPADKYEGCRKSSVDVKLGHYVNNSIPELDIKR 117
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383852296|ref|XP_003701664.1| PREDICTED: uncharacterized protein LOC100876421 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345487346|ref|XP_001606729.2| PREDICTED: hypothetical protein LOC100120756 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340709946|ref|XP_003393560.1| PREDICTED: hypothetical protein LOC100651313 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350421346|ref|XP_003492813.1| PREDICTED: hypothetical protein LOC100741951 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307185897|gb|EFN71724.1| hypothetical protein EAG_05804 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|91077808|ref|XP_970231.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270001488|gb|EEZ97935.1| hypothetical protein TcasGA2_TC000323 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380022214|ref|XP_003694947.1| PREDICTED: uncharacterized protein LOC100864197 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|242008769|ref|XP_002425172.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508874|gb|EEB12434.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332373252|gb|AEE61767.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| FB|FBgn0036198 | 158 | crim "crimpled" [Drosophila me | 0.630 | 0.689 | 0.562 | 7.9e-30 |
| FB|FBgn0036198 crim "crimpled" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 330 (121.2 bits), Expect = 7.9e-30, P = 7.9e-30
Identities = 63/112 (56%), Positives = 77/112 (68%)
Query: 4 LVLTLSLISFVSRCSALLCYQCVSTQPGCGTPFKW--LWYPSISCPEEDDICVKIIERKG 61
L+ L L + + SA+ CY+C S PGC F W + + CPE DDICVK+ ER+G
Sbjct: 7 LIAALLLAALIHEGSAIWCYRCTSATPGCAEKFNWRGIGFLGEHCPEPDDICVKVTERRG 66
Query: 62 AEEIITRDCLSTVKAFRTDIPADRYEGCRAAAKDPKLANYVNHSIPELDVQR 113
A E ITRDCLS + +FR DIPAD+YEGCR AA D KLANYVNH+I E DV+R
Sbjct: 67 ARETITRDCLSAL-SFRKDIPADKYEGCRPAAHDEKLANYVNHTIKEHDVRR 117
|
|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| cd00117 | 79 | LU Ly-6 antigen / uPA receptor -like domain; occur | 97.49 | |
| smart00134 | 79 | LU Ly-6 antigen / uPA receptor -like domain. Three | 97.14 | |
| PF00087 | 63 | Toxin_1: Snake toxin; InterPro: IPR003571 Snake to | 96.42 | |
| cd00206 | 64 | snake_toxin Snake toxin domain, present in short a | 95.98 | |
| PF00021 | 77 | UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor si | 95.5 | |
| PF06211 | 107 | BAMBI: BMP and activin membrane-bound inhibitor (B | 94.86 | |
| PF01064 | 83 | Activin_recp: Activin types I and II receptor doma | 94.73 | |
| PF05444 | 152 | DUF753: Protein of unknown function (DUF753); Inte | 94.46 | |
| PF05444 | 152 | DUF753: Protein of unknown function (DUF753); Inte | 93.47 | |
| PF02988 | 83 | PLA2_inh: Phospholipase A2 inhibitor; InterPro: IP | 91.87 | |
| PF06579 | 129 | Ly-6_related: Caenorhabditis elegans ly-6-related | 89.02 |
| >cd00117 LU Ly-6 antigen / uPA receptor -like domain; occurs singly in GPI-linked cell-surface glycoproteins (Ly-6 family,CD59, thymocyte B cell antigen, Sgp-2) or as three-fold repeated domain in urokinase-type plasminogen activator receptor | Back alignment and domain information |
|---|
Probab=97.49 E-value=0.00015 Score=50.40 Aligned_cols=47 Identities=30% Similarity=0.732 Sum_probs=36.9
Q ss_pred eeeecccCC-CCCCCCCCCCCccccccCCCCCCceEEEEEecC----cceeEeechhhhh
Q psy5004 20 LLCYQCVST-QPGCGTPFKWLWYPSISCPEEDDICVKIIERKG----AEEIITRDCLSTV 74 (173)
Q Consensus 20 L~CY~C~S~-~PgC~dpfn~~~~~~etCp~~~d~CvKVier~g----~~~~itRdClS~~ 74 (173)
|+||.|.+. ...|..+ ++||+.++.|+++..... ....++|+|+++.
T Consensus 1 L~C~~C~~~~~~~C~~~--------~~C~~~~~~C~~~~~~~~~~~~~~~~~~rgC~~~C 52 (79)
T cd00117 1 LECYSCTGVSTSSCSTE--------TNCPSPDDQCLTAVATVIEESVRLSLVVRGCASDC 52 (79)
T ss_pred CccCcCCCCCCCCCCCC--------CccCCCCCEeeEEEEEEEeeccccceEECcccCCC
Confidence 789999883 4468876 599999999999877742 3466889999954
|
Topology of these domains is similar to that of snake venom neurotoxins. |
| >smart00134 LU Ly-6 antigen / uPA receptor -like domain | Back alignment and domain information |
|---|
| >PF00087 Toxin_1: Snake toxin; InterPro: IPR003571 Snake toxins belong to a family of proteins [] which groups short and long neurotoxins, cytotoxins and short toxins, as well as a other miscellaneous venom peptides | Back alignment and domain information |
|---|
| >cd00206 snake_toxin Snake toxin domain, present in short and long neurotoxins, cytotoxins and short toxins, and in other miscellaneous venom peptides | Back alignment and domain information |
|---|
| >PF00021 UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor similarity | Back alignment and domain information |
|---|
| >PF06211 BAMBI: BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain; InterPro: IPR009345 This family consists of several eukaryotic BMP and activin membrane-bound inhibitor (BAMBI) proteins | Back alignment and domain information |
|---|
| >PF01064 Activin_recp: Activin types I and II receptor domain; InterPro: IPR000472 Transforming growth factor-beta (TGF-beta) forms a family with other growth factors described in PDOC00223 from PROSITEDOC | Back alignment and domain information |
|---|
| >PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster | Back alignment and domain information |
|---|
| >PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster | Back alignment and domain information |
|---|
| >PF02988 PLA2_inh: Phospholipase A2 inhibitor; InterPro: IPR004126 Proteins in this entry inhibit basic phospholipase A2 isozymes in snake's venom [, ] | Back alignment and domain information |
|---|
| >PF06579 Ly-6_related: Caenorhabditis elegans ly-6-related protein; InterPro: IPR010558 This family consists of several Caenorhabditis elegans specific ly-6-related HOT and ODR proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 2j8b_A | 79 | CD59 glycoprotein; lipid-binding protein, lipid-bi | 97.04 | |
| 3neq_A | 66 | Muscarinic M1-toxin1, muscarinic toxin 1; chimeric | 96.94 | |
| 2l03_A | 74 | LY-6/neurotoxin-like protein 1; LYNX1, acetylcholi | 96.93 | |
| 1mr6_A | 68 | Neurotoxin; venom; NMR {Bungarus multicinctus} SCO | 96.67 | |
| 2jqp_A | 65 | WEAK toxin 1; protein; NMR {Bungarus candidus} | 96.42 | |
| 1kba_A | 66 | Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} | 96.38 | |
| 3laq_U | 277 | UPAR, U-PAR, urokinase plasminogen activator surfa | 96.3 | |
| 1ff4_A | 65 | Muscarinic toxin/acetylcholine receptor binding P; | 96.27 | |
| 1jgk_A | 66 | Candoxin; beta sheet, snake venom protein, toxin; | 96.26 | |
| 1hc9_A | 74 | Alpha-bungarotoxin; toxin/peptide, complex (toxin/ | 96.21 | |
| 2fd6_U | 276 | Urokinase plasminogen activator surface receptor; | 96.15 | |
| 1vyc_A | 65 | Bucain, neurotoxin; snake neurotoxin; NMR {Bungaru | 96.13 | |
| 2h7z_B | 77 | Irditoxin subunit B; three-finger toxin, neurotoxi | 96.1 | |
| 1ywh_A | 313 | Urokinase plasminogen activator surface receptor; | 95.99 | |
| 2h5f_A | 77 | Denmotoxin; three-finger toxin, neurotoxin, snake | 95.82 | |
| 3hh7_A | 65 | Muscarinic toxin-like protein 3 homolog; haditoxin | 95.61 | |
| 1cvo_A | 62 | Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g. | 95.59 | |
| 3era_A | 62 | Erabutoxin A; snake neurotoxin, venom, postsynapti | 95.4 | |
| 1ntn_A | 72 | Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja | 95.34 | |
| 1f94_A | 63 | Bucandin; three-finger snake presynaptic neurotoxi | 95.31 | |
| 2l5s_A | 88 | TGF-beta receptor type-1; ALK5, transforming growt | 95.28 | |
| 2pjy_C | 79 | TGF-beta receptor type-1; ternary complex, three f | 95.21 | |
| 1vb0_A | 61 | Cobrotoxin B; short-chain neurotoxin, three-finger | 95.18 | |
| 1lsi_A | 66 | LSIII; venom, multigene family, neurotoxin; NMR {L | 94.95 | |
| 3vts_A | 61 | Cytotoxin 1; three finger toxin, venom toxin; 2.43 | 94.86 | |
| 2h7z_A | 75 | Irditoxin subunit A; three-finger toxin, neurotoxi | 93.14 | |
| 2h62_C | 129 | Bone morphogenetic protein receptor type IA; TGF-b | 92.95 | |
| 3plc_A | 63 | Beta-cardiotoxin OH-27; beta-sheet, novel cardioto | 92.69 | |
| 1ug4_A | 60 | Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A { | 91.65 | |
| 1ntx_A | 60 | Alpha-neurotoxin; NMR {Dendroaspis polylepis polyl | 90.59 | |
| 3evs_C | 119 | Bone morphogenetic protein receptor type-1B; ligan | 90.18 | |
| 1tfs_A | 60 | Toxin FS2; NMR {Dendroaspis polylepis polylepis} S | 88.71 | |
| 1fas_A | 61 | Fasciculin 1; toxin; 1.80A {Dendroaspis angusticep | 88.37 | |
| 1ywh_A | 313 | Urokinase plasminogen activator surface receptor; | 88.36 | |
| 4aea_A | 71 | Long neurotoxin 1; three-finger toxin, nicotinic a | 87.96 | |
| 3laq_U | 277 | UPAR, U-PAR, urokinase plasminogen activator surfa | 87.22 |
| >2j8b_A CD59 glycoprotein; lipid-binding protein, lipid-binding protein MAC, membrane, GPI-anchor, complement, lipoprotein; 1.15A {Homo sapiens} SCOP: g.7.1.3 PDB: 2ux2_A 2uwr_A 1cdq_A 1cdr_A* 1cds_A* 2ofs_A 1erg_A 1erh_A | Back alignment and structure |
|---|
Probab=97.04 E-value=0.00059 Score=47.95 Aligned_cols=41 Identities=24% Similarity=0.656 Sum_probs=33.5
Q ss_pred eeeecccCCCCCCCCCCCCCccccccCCCCCCceEEEEEecCcceeEeechhh
Q psy5004 20 LLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIERKGAEEIITRDCLS 72 (173)
Q Consensus 20 L~CY~C~S~~PgC~dpfn~~~~~~etCp~~~d~CvKVier~g~~~~itRdClS 72 (173)
|+||.|......|.++ ++||.++|.|+.+... ..++|+|++
T Consensus 2 L~Cy~C~~~~~~C~~~--------~~C~~~~d~C~t~~~~----~~~~k~C~~ 42 (79)
T 2j8b_A 2 LQCYNCPNPTADCKTA--------VNCSSDFDACLITKAG----LQVYNKCWK 42 (79)
T ss_dssp CEEECCSSCCTTCCCE--------EECCTTCCEEEEEEET----TEEEEEEEC
T ss_pred cCCcCCCCCCCCCccc--------eecCCCCCEeEEEEeC----CeeEecccC
Confidence 8999998765579886 7999999999877762 356799997
|
| >3neq_A Muscarinic M1-toxin1, muscarinic toxin 1; chimeric muscarinic toxin, HM1-muscarinic receptor, snake to green mamba; 1.25A {Dendroaspis angusticeps} PDB: 2vlw_A* 3fev_A 4do8_A | Back alignment and structure |
|---|
| >2l03_A LY-6/neurotoxin-like protein 1; LYNX1, acetylcholine receptor, endogenic neuromodulator, Thr toxins, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mr6_A Neurotoxin; venom; NMR {Bungarus multicinctus} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >2jqp_A WEAK toxin 1; protein; NMR {Bungarus candidus} | Back alignment and structure |
|---|
| >1kba_A Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2nbt_A | Back alignment and structure |
|---|
| >3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1ff4_A Muscarinic toxin/acetylcholine receptor binding P; three fingers motif; 1.50A {Dendroaspis angusticeps} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >1jgk_A Candoxin; beta sheet, snake venom protein, toxin; NMR {Bungarus candidus} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >1hc9_A Alpha-bungarotoxin; toxin/peptide, complex (toxin/peptide), acetylcholine receptor mimitope, alpha-bungarotoxin, 3- finger; 1.8A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2qc1_A* 1abt_A 1bxp_A 1haa_A 1haj_A 1hc9_B 1hoy_A 1idg_A 1idh_A 1idi_A 1idl_A 1ik8_A 1ikc_A 1jbd_A 1kc4_A 1kfh_A 1kl8_A 1l4w_A 1ljz_A 1rgj_A ... | Back alignment and structure |
|---|
| >2fd6_U Urokinase plasminogen activator surface receptor; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 PDB: 3bt2_U* 3bt1_U* 2i9b_E* 3u74_U* 3u73_U* | Back alignment and structure |
|---|
| >1vyc_A Bucain, neurotoxin; snake neurotoxin; NMR {Bungarus candidus} SCOP: g.7.1.1 PDB: 2h8u_A | Back alignment and structure |
|---|
| >2h7z_B Irditoxin subunit B; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 | Back alignment and structure |
|---|
| >2h5f_A Denmotoxin; three-finger toxin, neurotoxin, snake venom; 1.90A {Boiga dendrophila} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >3hh7_A Muscarinic toxin-like protein 3 homolog; haditoxin, three finger toxin, snake venom, neurotoxin, nicotinic acetylcholine receptors; 1.55A {Ophiophagus hannah} SCOP: g.7.1.0 | Back alignment and structure |
|---|
| >1cvo_A Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g.7.1.1 PDB: 1kxi_A | Back alignment and structure |
|---|
| >3era_A Erabutoxin A; snake neurotoxin, venom, postsynaptic neurotoxin; 1.70A {Laticauda semifasciata} SCOP: g.7.1.1 PDB: 2era_A | Back alignment and structure |
|---|
| >1ntn_A Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja oxiana} SCOP: g.7.1.1 PDB: 1w6b_A | Back alignment and structure |
|---|
| >1f94_A Bucandin; three-finger snake presynaptic neurotoxin; 0.97A {Bungarus candidus} SCOP: g.7.1.1 PDB: 1ijc_A | Back alignment and structure |
|---|
| >2l5s_A TGF-beta receptor type-1; ALK5, transforming growth factor beta, type I receptor, SIGN protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pjy_C TGF-beta receptor type-1; ternary complex, three finger toxin, cytokine-cytokine recep complex; 3.00A {Homo sapiens} PDB: 3kfd_I | Back alignment and structure |
|---|
| >1vb0_A Cobrotoxin B; short-chain neurotoxin, three-finger toxin; HET: SO4; 0.92A {Naja atra} SCOP: g.7.1.1 PDB: 1onj_A* 1je9_A 1nor_A 1iq9_A 1nea_A 3nds_A 1cod_A 1coe_A 1v6p_A 1g6m_A 1qkd_A 1qke_A 5ebx_A 1era_A 1fra_A 3ebx_A 6ebx_A 1nxb_A | Back alignment and structure |
|---|
| >1lsi_A LSIII; venom, multigene family, neurotoxin; NMR {Laticauda semifasciata} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >3vts_A Cytotoxin 1; three finger toxin, venom toxin; 2.43A {Hemachatus haemachatus} | Back alignment and structure |
|---|
| >2h7z_A Irditoxin subunit A; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >2h62_C Bone morphogenetic protein receptor type IA; TGF-beta superfamily, ligand-receptor complex, hormone/growth factor complex; 1.85A {Homo sapiens} SCOP: g.7.1.3 PDB: 2h64_B 3nh7_A 1rew_C 3qb4_B 2goo_B* 2qj9_D 2qja_C 2qjb_C 2k3g_A 1es7_B | Back alignment and structure |
|---|
| >3plc_A Beta-cardiotoxin OH-27; beta-sheet, novel cardiotoxin; 2.41A {Ophiophagus hannah} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >1ug4_A Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A {Naja atra} PDB: 1h0j_A* 1i02_A 1xt3_A* 2bhi_A* 2crs_A 2crt_A 1cxn_A 1cxo_A 1tgx_A 1cb9_A 1ccq_A 1ffj_A 1chv_S 2ccx_A 1cre_A 1crf_A 1kbs_A 1kbt_A 1rl5_A 1zad_A ... | Back alignment and structure |
|---|
| >1ntx_A Alpha-neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >3evs_C Bone morphogenetic protein receptor type-1B; ligand-receptor complex, cystin-knot ligand, three-finger to (receptor); 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >1tfs_A Toxin FS2; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 | Back alignment and structure |
|---|
| >1fas_A Fasciculin 1; toxin; 1.80A {Dendroaspis angusticeps} SCOP: g.7.1.1 PDB: 1fsc_A 1f8u_B* 1b41_B 1fss_B* 1ku6_B* 1mah_F* 2x8b_B* 1qm7_A | Back alignment and structure |
|---|
| >1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 | Back alignment and structure |
|---|
| >4aea_A Long neurotoxin 1; three-finger toxin, nicotinic acetylcholine receptor; 1.94A {Naja kaouthia} SCOP: g.7.1.1 PDB: 1lxg_A 1lxh_A 1yi5_F 1ctx_A 2ctx_A 1txa_A 1txb_A | Back alignment and structure |
|---|
| >3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d1ff4a_ | 65 | Muscarinic toxin {Green mamba (Dendroaspis angusti | 94.7 | |
| d1mr6a_ | 68 | Bungarotoxin {Many-banded krait (Bungarus multicin | 94.46 | |
| d2j8ba1 | 77 | CD59 {Human (Homo sapiens) [TaxId: 9606]} | 92.99 | |
| d1kxia_ | 62 | Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxI | 92.94 | |
| d1jgka_ | 66 | Candoxin {Malayan krait (Bungarus candidus) [TaxId | 91.56 | |
| d2h62c1 | 84 | BMP receptor Ia ectodomain {Human (Homo sapiens) [ | 90.0 | |
| d2h8ua1 | 65 | Bucain {Malaysian krait (Bungarus candidus) [TaxId | 89.73 | |
| d1tgxa_ | 60 | gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId | 89.53 | |
| d2fd6u3 | 97 | Urokinase plasminogen activator surface receptor, | 88.82 | |
| d1hc9a_ | 74 | Bungarotoxin {Many-banded krait (Bungarus multicin | 86.47 | |
| d1ntna_ | 72 | Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 865 | 86.04 | |
| d2fd6u2 | 87 | Urokinase plasminogen activator surface receptor, | 83.42 | |
| d1v6pa_ | 62 | Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) | 83.29 |
| >d1ff4a_ g.7.1.1 (A:) Muscarinic toxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Snake toxin-like superfamily: Snake toxin-like family: Snake venom toxins domain: Muscarinic toxin species: Green mamba (Dendroaspis angusticeps) [TaxId: 8618]
Probab=94.70 E-value=0.011 Score=39.87 Aligned_cols=45 Identities=24% Similarity=0.403 Sum_probs=34.1
Q ss_pred eeeecccCCCCCCCCCCCCCccccccCCCCCCceEEEEEe-cCcceeEeechhhhh
Q psy5004 20 LLCYQCVSTQPGCGTPFKWLWYPSISCPEEDDICVKIIER-KGAEEIITRDCLSTV 74 (173)
Q Consensus 20 L~CY~C~S~~PgC~dpfn~~~~~~etCp~~~d~CvKVier-~g~~~~itRdClS~~ 74 (173)
|.|+.|.|.+ |.. ++|||+.+++|.|.... .+.-..|+|+|.-+.
T Consensus 1 ltC~~~~s~~--~~t--------~~tCp~GqnlCykk~~~~~~~g~~i~rGCaaTC 46 (65)
T d1ff4a_ 1 LTCVTTKSIG--GVT--------TEDCPAGQNVCFKRWHYVTPKNYDIIKGCAATC 46 (65)
T ss_dssp CEEEEECTTS--SEE--------EEECCTTCCEEEEEEEESSSSCEEEEEEEESSC
T ss_pred CeeecCCCcc--CCc--------cccCCCccceeeEEEEecCCCCCEEEeeeeCcC
Confidence 5688888876 333 49999999999998744 445566999998654
|
| >d1mr6a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), gamma-bungarotoxin [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d2j8ba1 g.7.1.3 (A:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]} | Back information, alignment and structure |
|---|
| >d1jgka_ g.7.1.1 (A:) Candoxin {Malayan krait (Bungarus candidus) [TaxId: 92438]} | Back information, alignment and structure |
|---|
| >d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h8ua1 g.7.1.1 (A:1-65) Bucain {Malaysian krait (Bungarus candidus) [TaxId: 92438]} | Back information, alignment and structure |
|---|
| >d1tgxa_ g.7.1.1 (A:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]} | Back information, alignment and structure |
|---|
| >d2fd6u3 g.7.1.3 (U:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hc9a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1ntna_ g.7.1.1 (A:) Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 8657]} | Back information, alignment and structure |
|---|
| >d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6pa_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]} | Back information, alignment and structure |
|---|