Psyllid ID: psy5020


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MTSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNIDYL
cccccHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccc
cccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccc
MTSDELRLSQigmkarspeghaakgmqikghediWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFwirkptnqhqFLENVTCALNAINEDGIKLVNIDYL
mtsdelrlsqigmkarspeghaAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALnainedgiklvnidyl
MTSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNIDYL
***************************IKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNID**
*************************************IQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKR**********NQHQFLENVTCALNAINEDGIKLVNIDYL
MTSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNIDYL
************************GMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNIDYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNIDYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q9VEN1 2210 Filamin-A OS=Drosophila m no N/A 0.7 0.038 0.440 3e-17
Q8VHX6 2726 Filamin-C OS=Mus musculus yes N/A 0.7 0.030 0.470 9e-15
Q14315 2725 Filamin-C OS=Homo sapiens yes N/A 0.7 0.030 0.470 9e-15
O75369 2602 Filamin-B OS=Homo sapiens no N/A 0.7 0.032 0.458 1e-14
Q80X90 2602 Filamin-B OS=Mus musculus no N/A 0.7 0.032 0.458 4e-14
Q8BTM8 2647 Filamin-A OS=Mus musculus no N/A 0.7 0.031 0.435 7e-14
P21333 2647 Filamin-A OS=Homo sapiens no N/A 0.7 0.031 0.435 7e-14
P13466 857 Gelation factor OS=Dictyo yes N/A 0.691 0.096 0.409 3e-12
Q9QXZ0 7354 Microtubule-actin cross-l no N/A 0.65 0.010 0.4 8e-08
D3ZHV2 5430 Microtubule-actin cross-l no N/A 0.65 0.014 0.4 8e-08
>sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 59/84 (70%)

Query: 35  WVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQH 94
           W  IQ +TF  W NEHLK++   + +L  DL+DG +L AL+E+L ++++  + ++PT + 
Sbjct: 13  WKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRS 72

Query: 95  QFLENVTCALNAINEDGIKLVNID 118
           Q LENV+ AL  + ++GIK+VNID
Sbjct: 73  QKLENVSVALKFLQDEGIKIVNID 96




Involved in the germline ring canal formation. May tether actin microfilament within the ovarian ring canal to the cell membrane. Contributes to actin microfilaments organization.
Drosophila melanogaster (taxid: 7227)
>sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 Back     alignment and function description
>sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 Back     alignment and function description
>sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 Back     alignment and function description
>sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 Back     alignment and function description
>sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 Back     alignment and function description
>sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 Back     alignment and function description
>sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 Back     alignment and function description
>sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 Back     alignment and function description
>sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
242005614 2862 conserved hypothetical protein [Pediculu 0.966 0.040 0.689 5e-43
170041221 1159 conserved hypothetical protein [Culex qu 0.925 0.095 0.633 1e-36
157108900 740 hypothetical protein AaeL_AAEL015057 [Ae 0.925 0.15 0.633 2e-36
321458954 838 hypothetical protein DAPPUDRAFT_328542 [ 0.966 0.138 0.615 1e-35
270003480 2894 hypothetical protein TcasGA2_TC002723 [T 0.941 0.039 0.617 1e-35
91079384 2797 PREDICTED: similar to jitterbug CG30092- 0.958 0.041 0.615 2e-35
312377814 456 hypothetical protein AND_10762 [Anophele 0.925 0.243 0.642 6e-35
194757060 2968 GF11329 [Drosophila ananassae] gi|190622 0.966 0.039 0.589 7e-35
195430546 1617 GK21843 [Drosophila willistoni] gi|19415 0.966 0.071 0.589 7e-35
442624476 2990 jitterbug, isoform N [Drosophila melanog 0.966 0.038 0.589 9e-35
>gi|242005614|ref|XP_002423659.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506819|gb|EEB10921.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 80/116 (68%), Positives = 93/116 (80%)

Query: 2   TSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDL 61
           + D LRLS +G+ ARSPEGHAAKGM IKG+ED+WV+IQ +TFKNWVNEHLK V + V D 
Sbjct: 3   SKDSLRLSHVGLVARSPEGHAAKGMAIKGNEDLWVEIQANTFKNWVNEHLKRVNMEVIDF 62

Query: 62  AKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDGIKLVNI 117
             D  DGT+LCALVE+LQKRK+  W +KPTNQH F ENVT ALNAI ED +KLVNI
Sbjct: 63  TSDFIDGTRLCALVELLQKRKIGPWNKKPTNQHHFFENVTMALNAIAEDEVKLVNI 118




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170041221|ref|XP_001848370.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167864816|gb|EDS28199.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157108900|ref|XP_001650436.1| hypothetical protein AaeL_AAEL015057 [Aedes aegypti] gi|108868494|gb|EAT32719.1| AAEL015057-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321458954|gb|EFX70013.1| hypothetical protein DAPPUDRAFT_328542 [Daphnia pulex] Back     alignment and taxonomy information
>gi|270003480|gb|EEZ99927.1| hypothetical protein TcasGA2_TC002723 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91079384|ref|XP_971392.1| PREDICTED: similar to jitterbug CG30092-PD [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312377814|gb|EFR24553.1| hypothetical protein AND_10762 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194757060|ref|XP_001960783.1| GF11329 [Drosophila ananassae] gi|190622081|gb|EDV37605.1| GF11329 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195430546|ref|XP_002063315.1| GK21843 [Drosophila willistoni] gi|194159400|gb|EDW74301.1| GK21843 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|442624476|ref|NP_001261140.1| jitterbug, isoform N [Drosophila melanogaster] gi|440214586|gb|AGB93671.1| jitterbug, isoform N [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
FB|FBgn0028371 2955 jbug "jitterbug" [Drosophila m 0.966 0.039 0.589 2.4e-31
FB|FBgn0014141 2399 cher "cheerio" [Drosophila mel 0.725 0.036 0.443 4.3e-15
ZFIN|ZDB-GENE-090313-85 248 si:ch211-222g5.6 "si:ch211-222 0.7 0.338 0.423 6.2e-14
WB|WBGene00016006 3720 fln-2 [Caenorhabditis elegans 0.666 0.021 0.517 6.2e-14
UNIPROTKB|F8WE98 604 FLNA "Filamin-A" [Homo sapiens 0.725 0.144 0.438 3.2e-13
RGD|1308807 2693 Flnc "filamin C, gamma" [Rattu 0.725 0.032 0.471 4e-13
UNIPROTKB|E2RP26 2720 FLNC "Uncharacterized protein" 0.725 0.031 0.471 4e-13
UNIPROTKB|F1SMN5 2720 FLNC "Uncharacterized protein" 0.725 0.031 0.471 4e-13
UNIPROTKB|E1BE25 2723 E1BE25 "Uncharacterized protei 0.725 0.031 0.471 4e-13
UNIPROTKB|Q14315 2725 FLNC "Filamin-C" [Homo sapiens 0.725 0.031 0.471 4e-13
FB|FBgn0028371 jbug "jitterbug" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 2.4e-31, P = 2.4e-31
 Identities = 69/117 (58%), Positives = 86/117 (73%)

Query:     2 TSDELRLSQIGMKARSPEGHAAKGMQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDL 61
             T++  +++  G+ ARSPEG AAKGM I+G+ED+WV+IQ +TF+NWVNEHL+  G+ V D 
Sbjct:    24 TTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEIQANTFRNWVNEHLRETGMQVHDW 83

Query:    62 AKDLADGTKLCALVEILQKRKLK-FWIRKPTNQHQFLENVTCALNAINEDGIKLVNI 117
             A D  DGT LCALVE LQ R LK  W R+P NQH +LEN T AL +I  D IKLVNI
Sbjct:    84 ATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYLENATTALKSIEADHIKLVNI 140




GO:0003779 "actin binding" evidence=ISS
GO:0009612 "response to mechanical stimulus" evidence=IGI
GO:0048104 "establishment of body hair or bristle planar orientation" evidence=IMP
FB|FBgn0014141 cher "cheerio" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090313-85 si:ch211-222g5.6 "si:ch211-222g5.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016006 fln-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F8WE98 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308807 Flnc "filamin C, gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RP26 FLNC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMN5 FLNC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE25 E1BE25 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q14315 FLNC "Filamin-C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 2e-15
smart00033101 smart00033, CH, Calponin homology domain 2e-13
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 5e-11
COG5069 612 COG5069, SAC6, Ca2+-binding actin-bundling protein 1e-08
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
 Score = 66.2 bits (162), Expect = 2e-15
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 38  IQTHTFKNWVNEHL-KSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQF 96
            Q      W+N+ L +   + + + + DL DG  LC L+  L    +      P ++ + 
Sbjct: 1   SQKEELLRWINKVLGEYGPVTINNFSTDLKDGIALCKLLNSLSPDLIDKKKINPLSRFKR 60

Query: 97  LENVTCALNAINEDGIKLVNID 118
           LEN+  ALN   + G+ +VN D
Sbjct: 61  LENINLALNFAEKLGVPVVNFD 82


The CH domain is found in cytoskeletal and signal transduction proteins, including actin-binding proteins like spectrin, alpha-actinin, dystrophin, utrophin, and fimbrin, proteins essential for regulation of cell shape (cortexillins), and signaling proteins (Vav). Length = 107

>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG0517|consensus 2473 99.92
cd00014107 CH Calponin homology domain; actin-binding domain 99.67
smart00033103 CH Calponin homology domain. Actin binding domains 99.67
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 99.5
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.5
KOG0035|consensus 890 99.36
KOG0046|consensus 627 99.31
KOG0046|consensus 627 99.02
KOG2046|consensus193 99.0
KOG3631|consensus365 98.97
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 98.34
COG5199178 SCP1 Calponin [Cytoskeleton] 98.33
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 97.95
KOG0532|consensus722 96.92
KOG0516|consensus 1047 96.92
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 96.8
KOG2996|consensus 865 96.72
KOG0518|consensus 1113 96.45
KOG3631|consensus 365 96.3
COG5261 1054 IQG1 Protein involved in regulation of cellular mo 94.82
KOG2128|consensus 1401 94.08
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 93.11
>KOG0517|consensus Back     alignment and domain information
Probab=99.92  E-value=5.5e-26  Score=207.68  Aligned_cols=93  Identities=35%  Similarity=0.469  Sum_probs=90.5

Q ss_pred             cccccchhhHHHHHHHHHHHHHHHhhcccCCcccchhhhhhhHHHHHHHHHHHcCcccccccCCCCcHHHHHhhHHHHHH
Q psy5020          26 MQIKGHEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALN  105 (120)
Q Consensus        26 ~~~~~~~~~w~~~Q~ktft~WiN~~L~~~~~~V~dL~~DL~DGv~Li~LLe~Lsg~~i~~~~~~p~~r~qkieNv~~aL~  105 (120)
                      .+||.++++.+.+|+||||+|||+||..+++.|.|||+||+||+.|+.|||+|||+.+|++. +++||+||+|||++||+
T Consensus        36 sRIKaLadERe~vQKKTFTKWvNShL~rv~c~I~DLy~DlrDG~~LlkLLEvlSGE~LpkPt-rGRMRIH~LENvdKaLq  114 (2473)
T KOG0517|consen   36 SRIKALADEREAVQKKTFTKWVNSHLARVSCRIGDLYTDLRDGIMLLKLLEVLSGERLPKPT-RGRMRIHCLENVDKALQ  114 (2473)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHHHHHHhcchhHHHHHHHhhhHHHHHHHHHHccccCCCCC-CCceeehhHhhhHHHHH
Confidence            49999999999999999999999999999999999999999999999999999999999985 79999999999999999


Q ss_pred             HHHhCCCeEeccCC
Q psy5020         106 AINEDGIKLVNIDY  119 (120)
Q Consensus       106 flk~~gi~lvnI~~  119 (120)
                      ||++..|+|.|||+
T Consensus       115 FLkeqkVhLEniGs  128 (2473)
T KOG0517|consen  115 FLKEQKVHLENIGS  128 (2473)
T ss_pred             HHHhcccccccCCc
Confidence            99999999999997



>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG2046|consensus Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>COG5199 SCP1 Calponin [Cytoskeleton] Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0516|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0518|consensus Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>COG5261 IQG1 Protein involved in regulation of cellular morphogenesis/cytokinesis [Cell division and chromosome partitioning / Signal transduction mechanisms] Back     alignment and domain information
>KOG2128|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
4b7l_A 347 Crystal Structure Of Human Filamin B Actin Binding 3e-15
2wa6_A 245 Structure Of The W148r Mutant Of Human Filamin B Ac 1e-14
3fer_A 262 Crystal Structure Of N-Terminal Actin-Binding Domai 2e-14
2wa7_A 245 Structure Of The M202v Mutant Of Human Filamin B Ac 2e-14
2wa5_A 245 Crystal Structure Of Human Filamin B Actin Binding 2e-14
2wfn_A 278 Filamin A Actin Binding Domain Length = 278 7e-14
3hop_A 272 Structure Of The Actin-Binding Domain Of Human Fila 8e-14
3hoc_A 272 Structure Of The Actin-Binding Domain Of Human Fila 9e-14
1sjj_A 863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 1e-08
2r0o_A 237 Crystal Structure Of The Actin-Binding Domain Of Hu 2e-08
2eyi_A 234 Crystal Structure Of The Actin-Binding Domain Of Hu 2e-08
3f7p_A 296 Crystal Structure Of A Complex Between Integrin Bet 4e-08
3lue_K109 Model Of Alpha-Actinin Ch1 Bound To F-Actin Length 9e-08
1tjt_A 250 X-Ray Structure Of The Human Alpha-Actinin Isoform 1e-07
1wku_A 254 High Resolution Structure Of The Human Alpha-Actini 1e-07
1dxx_A 246 N-Terminal Actin-Binding Domain Of Human Dystrophin 1e-06
1sh5_A 245 Crystal Structure Of Actin-Binding Domain Of Mouse 2e-06
1mb8_A 243 Crystal Structure Of The Actin Binding Domain Of Pl 2e-06
2yrn_A129 Solution Structure Of The Ch Domain From Human Neur 6e-05
1qag_A 226 Actin Binding Region Of The Dystrophin Homologue Ut 6e-04
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain With 1st Filamin Repeat Length = 347 Back     alignment and structure

Iteration: 1

Score = 77.0 bits (188), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 1/85 (1%) Query: 35 WVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEIL-QKRKLKFWIRKPTNQ 93 W IQ +TF W NEHLKSV + +L DL+DG +L AL+E+L QKR + + ++PT + Sbjct: 14 WKKIQQNTFTRWCNEHLKSVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFR 73 Query: 94 HQFLENVTCALNAINEDGIKLVNID 118 LENV+ AL ++ + IKLV+ID Sbjct: 74 QMQLENVSVALEFLDRESIKLVSID 98
>pdb|2WA6|A Chain A, Structure Of The W148r Mutant Of Human Filamin B Actin Binding Domain At 1.95 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|3FER|A Chain A, Crystal Structure Of N-Terminal Actin-Binding Domain From Human Filamin B (Tandem Ch-Domains). Northeast Structural Genomics Consortium Target Hr5571a. Length = 262 Back     alignment and structure
>pdb|2WA7|A Chain A, Structure Of The M202v Mutant Of Human Filamin B Actin Binding Domain At 1.85 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2WA5|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain At 1.9 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2WFN|A Chain A, Filamin A Actin Binding Domain Length = 278 Back     alignment and structure
>pdb|3HOP|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Length = 272 Back     alignment and structure
>pdb|3HOC|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Mutant E254k Length = 272 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 Back     alignment and structure
>pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 Back     alignment and structure
>pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 Back     alignment and structure
>pdb|3LUE|K Chain K, Model Of Alpha-Actinin Ch1 Bound To F-Actin Length = 109 Back     alignment and structure
>pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 Back     alignment and structure
>pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 Back     alignment and structure
>pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 Back     alignment and structure
>pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 Back     alignment and structure
>pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 Back     alignment and structure
>pdb|2YRN|A Chain A, Solution Structure Of The Ch Domain From Human Neuron Navigator 2 Length = 129 Back     alignment and structure
>pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 1e-26
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 3e-26
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 5e-26
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 2e-25
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 6e-24
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 9e-24
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 4e-23
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 8e-23
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 9e-22
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 4e-12
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 3e-20
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 3e-20
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 2e-16
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 6e-12
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 2e-06
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 4e-06
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 7e-05
1ujo_A144 Transgelin; CH domain, actin binding, structural g 1e-04
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 4e-04
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
 Score = 94.9 bits (236), Expect = 1e-26
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 35  WVDIQTHTFKNWVNEHLKSVGL--HVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTN 92
            ++ Q   + +W N +L   G    + DL +D+ DG  L  +++++   K++     P N
Sbjct: 15  GLEDQKRIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQIIQVVANEKIEDINGCPKN 74

Query: 93  QHQFLENVTCALNAINEDGIKLVNID 118
           + Q +EN+   LN +   GI +  + 
Sbjct: 75  RSQMIENIDACLNFLAAKGINIQGLS 100


>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Length = 131 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 203 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 159 Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Length = 108 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Length = 144 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 99.96
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 99.94
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 99.94
3hoc_A 272 Filamin-A; calponin homology domain, actin binding 99.93
2wa7_A 245 Filamin-B; disease mutation, skeletal dysplasia, s 99.92
3f7p_A 296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 99.91
1wku_A 254 Alpha-actinin 3; calponin homology domain, actin b 99.91
1sh5_A 245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 99.89
1dxx_A 246 Dystrophin; structural protein, muscular dystrophy 99.88
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 99.86
1aoa_A 275 T-fimbrin; actin-binding protein, calcium-binding, 99.85
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.81
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.77
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.75
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.73
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 99.43
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 99.38
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 99.34
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 99.34
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 99.33
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 99.31
1ujo_A144 Transgelin; CH domain, actin binding, structural g 99.29
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 99.28
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 99.24
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 99.23
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 99.09
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 99.06
2qjz_A123 Microtubule-associated protein RP/EB family member 98.83
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 98.75
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 98.48
1wyl_A116 NEDD9 interacting protein with calponin homology a 98.47
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 98.46
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 98.41
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 98.39
2d88_A121 Protein mical-3; all alpha, calponin homology doma 98.38
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 98.38
1bhd_A118 Utrophin; calponin homology, actin binding, struct 98.28
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 98.28
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 98.25
3hoc_A272 Filamin-A; calponin homology domain, actin binding 98.17
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.12
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 98.07
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.07
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.01
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 97.97
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 97.48
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 97.2
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 97.1
2r8u_A 268 Microtubule-associated protein RP/EB family member 96.87
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 96.86
1wix_A164 HOOK homolog 1, RSGI RUH-026; structural genomics, 95.2
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
Probab=99.96  E-value=5.7e-29  Score=176.67  Aligned_cols=89  Identities=24%  Similarity=0.362  Sum_probs=84.0

Q ss_pred             chhhHHHHHHHHHHHHHHHhhcccCCcccchhhhhhhHHHHHHHHHHHcCcccc--cccCCCCcHHHHHhhHHHHHHHHH
Q psy5020          31 HEDIWVDIQTHTFKNWVNEHLKSVGLHVEDLAKDLADGTKLCALVEILQKRKLK--FWIRKPTNQHQFLENVTCALNAIN  108 (120)
Q Consensus        31 ~~~~w~~~Q~ktft~WiN~~L~~~~~~V~dL~~DL~DGv~Li~LLe~Lsg~~i~--~~~~~p~~r~qkieNv~~aL~flk  108 (120)
                      .+++|+.+|++|||+|||+||.+.+.+|+||++||+||+.||.|+|.|+|+++|  +++++|++++|++|||+.||+|++
T Consensus        15 ~~~e~~~~q~ktft~WiN~~L~~~~~~v~dL~~Dl~DGv~L~~Lle~ls~~~~~~~~~~~~p~~r~~kieNv~~aL~~lk   94 (131)
T 2vzc_A           15 HAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQ   94 (131)
T ss_dssp             HCHHHHHHHHHHHHHHHHHHHGGGTCCCCCTTTTTTTSHHHHHHHHHHTTCCCCTTSSCSSCCSHHHHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHcCCcccCHHHHcccHHHHHHHHHHhcCCCCCHHHhcCCCCcHHHHHHHHHHHHHHHH
Confidence            467888899999999999999999999999999999999999999999999886  577889999999999999999999


Q ss_pred             hCCCeEeccCC
Q psy5020         109 EDGIKLVNIDY  119 (120)
Q Consensus       109 ~~gi~lvnI~~  119 (120)
                      +.||+++||+|
T Consensus        95 ~~gi~l~~I~~  105 (131)
T 2vzc_A           95 DGGLEKPKPRP  105 (131)
T ss_dssp             HTTCCCCSSCH
T ss_pred             HcCCCcCCCCH
Confidence            99999999986



>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1wix_A HOOK homolog 1, RSGI RUH-026; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.40.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 9e-19
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 6e-11
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 0.003
d1sh5a1120 a.40.1.1 (A:8-127) Actin binding domain of plectin 1e-17
d1dxxa1111 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens 2e-15
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-15
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-12
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 2e-04
d1p2xa_159 a.40.1.1 (A:) Ras GTPase-activating-like protein r 2e-12
d1aoaa1131 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-cros 2e-12
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 1e-08
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-08
d1h67a_108 a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [T 0.001
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 0.003
d1ujoa_144 a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [Ta 0.004
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Fimbrin (Plastin), actin-crosslinking domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 78.1 bits (192), Expect = 9e-19
 Identities = 20/92 (21%), Positives = 34/92 (36%), Gaps = 12/92 (13%)

Query: 39  QTHTFKNWVNEHLKS---------VGLHVEDLAKDLADGTKLCALVEILQKRKL---KFW 86
           +   F   +N +L           +  H   L + + DG  LC L+ +     +      
Sbjct: 2   EKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDERAIN 61

Query: 87  IRKPTNQHQFLENVTCALNAINEDGIKLVNID 118
            ++  N  +  EN T  LN+    G  +VNI 
Sbjct: 62  TKRVLNPWERNENHTLCLNSAKAVGCSVVNIG 93


>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 159 Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 108 Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.93
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.9
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.84
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.77
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.77
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.76
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.68
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 99.66
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.65
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 99.2
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 99.15
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 98.44
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 97.75
d1wixa_164 Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId 95.54
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Dystrophin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=6.2e-27  Score=159.39  Aligned_cols=85  Identities=36%  Similarity=0.547  Sum_probs=79.0

Q ss_pred             hhHHHHHHHHHHHHHHHhhcccC-CcccchhhhhhhHHHHHHHHHHHcCcccccccCCCCcHHHHHhhHHHHHHHHHhCC
Q psy5020          33 DIWVDIQTHTFKNWVNEHLKSVG-LHVEDLAKDLADGTKLCALVEILQKRKLKFWIRKPTNQHQFLENVTCALNAINEDG  111 (120)
Q Consensus        33 ~~w~~~Q~ktft~WiN~~L~~~~-~~V~dL~~DL~DGv~Li~LLe~Lsg~~i~~~~~~p~~r~qkieNv~~aL~flk~~g  111 (120)
                      -+|+++|+++||+|||+||.+.+ ..|+|+++||+||+.||.|+|.++|++++.  ..|++++++++|++.||+|+++.|
T Consensus         3 ~e~e~~Q~~~ft~WiN~~L~~~~~~~i~nl~~Dl~DG~~L~~Lle~l~~~~~~~--~~~~~r~~~l~N~~~aL~~~k~~~   80 (111)
T d1dxxa1           3 YEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPK--EKGSTRVHALNNVNKALRVLQNNN   80 (111)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHTTCCCCSCTTTTTTTSHHHHHHHHHHHSCCCCC--CCCSSHHHHHHHHHHHHHHHHHTT
T ss_pred             HhHHHHHHHHHHHHHHHHccccCCcchhhHHHHhcchHHHHHHHHHHcCCcCCC--CCCCcHhhHHHHHHHHHHHHHHhC
Confidence            37899999999999999998776 479999999999999999999999999986  469999999999999999999999


Q ss_pred             CeEeccCC
Q psy5020         112 IKLVNIDY  119 (120)
Q Consensus       112 i~lvnI~~  119 (120)
                      +++++|++
T Consensus        81 ~~~~~i~~   88 (111)
T d1dxxa1          81 VDLVNIGS   88 (111)
T ss_dssp             CCCTTCCH
T ss_pred             CcccCCCH
Confidence            99999875



>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wixa_ a.40.3.1 (A:) Hook homolog 1, Hook1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure