Psyllid ID: psy5022

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
PVYVDSHHVGCTQALPEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPKCCKRRVKKVMVEEAAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
ccccccccccccccccccccccccccccEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccEEEEEEEccEEEEEEcccccHHHccccccEEEEEEccccEEEEEEEccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccHHHHHHHHHHHHcccEEEEEcccccccEEEEEEcccccccccEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHcccccccEEEEcccEEEEEEcccccccccccccccccccEEEEEccccccccccccccEEEEEccEEcccccHHHHHHHHHHHHcc
cccEcccccccccccccccccHHHHHHcEEEEEHHccccEcccccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEEEEcccHHHHHHHcHHHHEEHHHcHcHHHHHHHHHcccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHcccHHHccHHHHHcccccccEEEEEcccccEEEEEEEEccccccccEEEEEEcccccccHHccccccccEEEEEcccEEEcccHHccccccEEEEEEEccccEEEEEEEccccEEEEEEEcccccEHHHHHcccccHccccEEEcEEEEEEcccEEEEccHHHHHHHHHHHccc
pvyvdshhvgctqalpedpvvdtglgpgtlFRLKFLgsvqvdeddpkcckrRVKKVmveeaapegetqpstevdlFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFvsqeadeppkisrtpkmichvfesDEAQFIAQSIGQAFQVAYMEFLKAngiedhsfvkemdyqevlnsqeIFGDELQMFAKKELqkevvvpkakgEILGVVIVEsgwgsmlpTVVIANLapagaaarcgqlnigdqiiAVNGVSLVAYMEFLKAngiedhsfvkemdyqevlnsqeIFGDELQMFAKKELQKEICSLLRGgiaerggvrvgHRIIEinnqsvvavpHEKIVNLLATSVGE
pvyvdshhvgctqalpedpvvdTGLGPGTLFRLKFlgsvqvdeddpkcCKRRVKKVmveeaapegetqpstevdlfiSTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVsqeadeppkisrtPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQkevvvpkakgEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEInnqsvvavpheKIVNLLATSVGE
PVYVDSHHVGCTQALPEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPkcckrrvkkvMVEEAAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
******HHVGCTQALPEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPKCCKRRVK******************VDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV**************KMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLA*****
******************PVVDTGLGPGTLFRLKFLGSV**********************************DLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMAR********************ICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIED*****************IFGD**********QKE*VVPKAKG************GSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQE**********KKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATS***
********VGCTQALPEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPKCCKRRVKKVMVE**********STEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
***************PEDPVVDTGLGPGTLFRLKFLGSVQVDE***********************TQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV**********SRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PVYVDSHHVGCTQALPEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPKCCKRRVKKVMVEEAAPEGETQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGVSLVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
O17583982 Protein lin-10 OS=Caenorh yes N/A 0.896 0.327 0.573 1e-105
Q02410837 Amyloid beta A4 precursor yes N/A 0.891 0.382 0.504 6e-89
O35430839 Amyloid beta A4 precursor yes N/A 0.891 0.381 0.506 7e-89
B2RUJ5842 Amyloid beta A4 precursor yes N/A 0.891 0.380 0.504 1e-88
O35431750 Amyloid beta A4 precursor no N/A 0.899 0.430 0.493 1e-82
P98084750 Amyloid beta A4 precursor no N/A 0.899 0.430 0.493 1e-82
Q99767749 Amyloid beta A4 precursor no N/A 0.899 0.431 0.493 3e-82
Q5RD33749 Amyloid beta A4 precursor yes N/A 0.899 0.431 0.490 9e-82
O70248569 Amyloid beta A4 precursor no N/A 0.885 0.558 0.448 2e-71
O96018575 Amyloid beta A4 precursor no N/A 0.894 0.558 0.456 6e-68
>sp|O17583|LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans GN=lin-10 PE=1 SV=1 Back     alignment and function desciption
 Score =  382 bits (982), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/366 (57%), Positives = 255/366 (69%), Gaps = 44/366 (12%)

Query: 28  GTLFRLKFLGSVQVDEDDPKCCKRRVKKV----MVEEA-----APEGETQPSTEVDLFIS 78
           G LFR ++LGS Q+       C+ R  K       +EA     APEG+ QPSTE+DLFIS
Sbjct: 604 GVLFRARYLGSTQM------LCESRGSKAARMAQAQEAVARVKAPEGDVQPSTEIDLFIS 657

Query: 79  TEKIMVLNTDLK---------EIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPK 129
           TEKIMVLNTDL+         +I+MDHALRTISYIADIGDLVVLMARR   S  +DE   
Sbjct: 658 TEKIMVLNTDLQRISDTDVRQDILMDHALRTISYIADIGDLVVLMARRMSTSH-SDESCS 716

Query: 130 --------ISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDY 181
                   + +TPK+ICHVFESDEA FIAQSIGQAFQVAY+EFL+ANGI+D S+++++DY
Sbjct: 717 DGDSSGGGVRKTPKVICHVFESDEASFIAQSIGQAFQVAYVEFLRANGIDDPSYLRQIDY 776

Query: 182 QEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPA 241
           QEVLNSQE+ GDEL+MFAKKE QKEVVVPK  GE LG+V+VESGWGSMLPTVV+A++ P 
Sbjct: 777 QEVLNSQELLGDELEMFAKKETQKEVVVPKKAGEPLGIVVVESGWGSMLPTVVLAHMNPV 836

Query: 242 GAAARCGQLNIGDQIIAVNGVSLVAY--------MEFLKANGIEDHSFVKEMDYQEVLNS 293
           G AA   +LNIGDQII +NG+SLV          ++ +K       + V      EV   
Sbjct: 837 GPAAHSNKLNIGDQIININGISLVGLPLSAAQTQIKNMKTATAVRMTVVSTPPVVEVRIR 896

Query: 294 QEIFGDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLL 353
           +     +L    +  +   ICSLLRGGIAERGG+RVGHRIIEIN  SVVAV H++IVN+L
Sbjct: 897 RPDTKYQLGFSVQNGV---ICSLLRGGIAERGGIRVGHRIIEINGTSVVAVAHDRIVNML 953

Query: 354 ATSVGE 359
           AT+VGE
Sbjct: 954 ATAVGE 959
Required specifically for the determination of 3 vulval precursor cell fates P5.p, P6.p and P7.p during late second and early third larval stages; required for basolateral localization of receptor tyrosine kinase let-23. Could have a general but redundant role in development, functioning in diverse cell lineages to control cell fates.
Caenorhabditis elegans (taxid: 6239)
>sp|Q02410|APBA1_HUMAN Amyloid beta A4 precursor protein-binding family A member 1 OS=Homo sapiens GN=APBA1 PE=1 SV=3 Back     alignment and function description
>sp|O35430|APBA1_RAT Amyloid beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus GN=Apba1 PE=1 SV=1 Back     alignment and function description
>sp|B2RUJ5|APBA1_MOUSE Amyloid beta A4 precursor protein-binding family A member 1 OS=Mus musculus GN=Apba1 PE=2 SV=2 Back     alignment and function description
>sp|O35431|APBA2_RAT Amyloid beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus GN=Apba2 PE=1 SV=1 Back     alignment and function description
>sp|P98084|APBA2_MOUSE Amyloid beta A4 precursor protein-binding family A member 2 OS=Mus musculus GN=Apba2 PE=1 SV=2 Back     alignment and function description
>sp|Q99767|APBA2_HUMAN Amyloid beta A4 precursor protein-binding family A member 2 OS=Homo sapiens GN=APBA2 PE=1 SV=3 Back     alignment and function description
>sp|Q5RD33|APBA2_PONAB Amyloid beta A4 precursor protein-binding family A member 2 OS=Pongo abelii GN=APBA2 PE=2 SV=1 Back     alignment and function description
>sp|O70248|APBA3_RAT Amyloid beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus GN=Apba3 PE=2 SV=2 Back     alignment and function description
>sp|O96018|APBA3_HUMAN Amyloid beta A4 precursor protein-binding family A member 3 OS=Homo sapiens GN=APBA3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
242024334 1298 conserved hypothetical protein [Pediculu 0.908 0.251 0.739 1e-134
307211613 1527 Protein lin-10 [Harpegnathos saltator] 0.972 0.228 0.739 1e-133
60677973 1603 LP19469p [Drosophila melanogaster] 0.913 0.204 0.731 1e-132
195167022 1156 GL14982 [Drosophila persimilis] gi|19410 0.905 0.281 0.737 1e-132
195481967 2276 GE17852 [Drosophila yakuba] gi|194189377 0.905 0.142 0.737 1e-132
195432643 2155 GK20104 [Drosophila willistoni] gi|19416 0.908 0.151 0.731 1e-132
198468962 2068 GA22393 [Drosophila pseudoobscura pseudo 0.905 0.157 0.734 1e-132
195566087 985 GD16984 [Drosophila simulans] gi|1942040 0.905 0.329 0.737 1e-132
195393522 2082 GJ18807 [Drosophila virilis] gi|19414991 0.908 0.156 0.731 1e-132
442615839 2063 X11Lbeta, isoform B [Drosophila melanoga 0.908 0.158 0.731 1e-132
>gi|242024334|ref|XP_002432583.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518043|gb|EEB19845.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 256/346 (73%), Positives = 279/346 (80%), Gaps = 20/346 (5%)

Query: 28   GTLFRLKFLGSVQ-VDEDDPKCCKRRVKKVMVEEA-----APEGETQPSTEVDLFISTEK 81
            G LFR ++LGS Q V E  P    R ++    EEA     APEGE+QPSTEVDLFISTEK
Sbjct: 936  GVLFRARYLGSTQLVCEGQPTKSTRMMQ---AEEAVSRIKAPEGESQPSTEVDLFISTEK 992

Query: 82   IMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVF 141
            IMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRR+V  + +E  K++RTPKMICHVF
Sbjct: 993  IMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRYVPHDVEESSKMTRTPKMICHVF 1052

Query: 142  ESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKK 201
            ES+EAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKK
Sbjct: 1053 ESEEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKK 1112

Query: 202  ELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNG 261
            E+QKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAP+GAAARCGQLNIGDQIIA+NG
Sbjct: 1113 EMQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPSGAAARCGQLNIGDQIIAING 1172

Query: 262  VSLVA--------YMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEI 313
            +SLV         Y++  K   +   + V      EV   +     +L    +  +   I
Sbjct: 1173 ISLVGLPLSTCQTYIKNTKNQTVVKLTVVPCAPVVEVKIKRPDTKYQLGFSVQNGV---I 1229

Query: 314  CSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE 359
            CSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
Sbjct: 1230 CSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE 1275

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307211613|gb|EFN87662.1| Protein lin-10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|60677973|gb|AAX33493.1| LP19469p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195167022|ref|XP_002024333.1| GL14982 [Drosophila persimilis] gi|194107706|gb|EDW29749.1| GL14982 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195481967|ref|XP_002101853.1| GE17852 [Drosophila yakuba] gi|194189377|gb|EDX02961.1| GE17852 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195432643|ref|XP_002064326.1| GK20104 [Drosophila willistoni] gi|194160411|gb|EDW75312.1| GK20104 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198468962|ref|XP_002134177.1| GA22393 [Drosophila pseudoobscura pseudoobscura] gi|198146653|gb|EDY72804.1| GA22393 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195566087|ref|XP_002106622.1| GD16984 [Drosophila simulans] gi|194204004|gb|EDX17580.1| GD16984 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195393522|ref|XP_002055403.1| GJ18807 [Drosophila virilis] gi|194149913|gb|EDW65604.1| GJ18807 [Drosophila virilis] Back     alignment and taxonomy information
>gi|442615839|ref|NP_001259425.1| X11Lbeta, isoform B [Drosophila melanogaster] gi|440216634|gb|AGB95268.1| X11Lbeta, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
FB|FBgn00526772139 X11Lbeta "X11Lbeta" [Drosophil 0.916 0.153 0.724 4.4e-117
FB|FBgn00263131168 X11L "X11L" [Drosophila melano 0.660 0.202 0.700 3.7e-110
WB|WBGene00002999982 lin-10 [Caenorhabditis elegans 0.824 0.301 0.610 3.1e-90
UNIPROTKB|O17583982 lin-10 "Protein lin-10" [Caeno 0.824 0.301 0.610 3.1e-90
RGD|620844839 Apba1 "amyloid beta (A4) precu 0.827 0.353 0.570 3.6e-82
UNIPROTKB|O35430839 Apba1 "Amyloid beta A4 precurs 0.827 0.353 0.570 3.6e-82
MGI|MGI:1860297842 Apba1 "amyloid beta (A4) precu 0.827 0.352 0.570 5.8e-82
UNIPROTKB|Q02410837 APBA1 "Amyloid beta A4 precurs 0.827 0.354 0.570 9.7e-80
UNIPROTKB|E1C7H3824 APBA1 "Uncharacterized protein 0.827 0.360 0.567 2e-79
UNIPROTKB|F1MYC3835 APBA1 "Uncharacterized protein 0.827 0.355 0.567 2e-79
FB|FBgn0052677 X11Lbeta "X11Lbeta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1165 (415.2 bits), Expect = 4.4e-117, P = 4.4e-117
 Identities = 250/345 (72%), Positives = 272/345 (78%)

Query:    28 GTLFRLKFLGSVQ-VDEDDPXXXX----XXXXXXMVEEAAPEGETQPSTEVDLFISTEKI 82
             G LFR K+LGS Q V E  P               ++  AP+G+ QPSTEVDLFISTEKI
Sbjct:  1775 GVLFRAKYLGSTQLVCEGQPTKSTRMMQAEEAVSRIKALAPDGDVQPSTEVDLFISTEKI 1834

Query:    83 MVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKISRTPKMICHVFE 142
             MVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFV Q+ D+ PK +RTPKMICHVFE
Sbjct:  1835 MVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVPQDIDDAPKPNRTPKMICHVFE 1894

Query:   143 SDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKE 202
             SDEAQFIAQSIGQAFQVAYMEFLKANGIEDH FVKEMDYQEVLNSQEIFGDEL++FAKKE
Sbjct:  1895 SDEAQFIAQSIGQAFQVAYMEFLKANGIEDHRFVKEMDYQEVLNSQEIFGDELEIFAKKE 1954

Query:   203 LQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAGAAARCGQLNIGDQIIAVNGV 262
             LQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANL  +GAAARCGQLNIGDQ+IA+NG+
Sbjct:  1955 LQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLMSSGAAARCGQLNIGDQLIAINGL 2014

Query:   263 SLVA--------YMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEIC 314
             SLV         Y++  K   +   + V      EV   +     +L    +  +   IC
Sbjct:  2015 SLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGV---IC 2071

Query:   315 SLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE 359
             SLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE
Sbjct:  2072 SLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE 2116
GO:0001540 "beta-amyloid binding" evidence=ISS
FB|FBgn0026313 X11L "X11L" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00002999 lin-10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O17583 lin-10 "Protein lin-10" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|620844 Apba1 "amyloid beta (A4) precursor protein-binding, family A, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O35430 Apba1 "Amyloid beta A4 precursor protein-binding family A member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1860297 Apba1 "amyloid beta (A4) precursor protein binding, family A, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q02410 APBA1 "Amyloid beta A4 precursor protein-binding family A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7H3 APBA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYC3 APBA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2RUJ5APBA1_MOUSENo assigned EC number0.50400.89130.3800yesN/A
O17583LIN10_CAEELNo assigned EC number0.57370.89690.3279yesN/A
O35430APBA1_RATNo assigned EC number0.50670.89130.3814yesN/A
Q02410APBA1_HUMANNo assigned EC number0.50400.89130.3823yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
cd01208161 cd01208, PTB_X11, X11-like Phosphotyrosine-binding 1e-82
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 6e-32
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 3e-22
cd01273144 cd01273, PTB_CED-6, Cell death protein 6 homolog ( 3e-13
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 7e-13
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-10
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-09
cd13161120 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM- 2e-09
cd13157129 cd13157, PTB_tensin-related, Tensin-related Phosph 6e-09
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-08
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 9e-08
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-07
cd01274146 cd01274, PTB_Anks, Ankyrin repeat and sterile alph 5e-07
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-06
cd01212149 cd01212, PTB_JIP, JNK-interacting protein-like (JI 1e-05
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-05
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 3e-05
cd13159123 cd13159, PTB_LDLRAP-mammal-like, Low Density Lipop 6e-05
cd01209170 cd01209, PTB_Shc, Shc-like phosphotyrosine-binding 1e-04
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 2e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.004
>gnl|CDD|241244 cd01208, PTB_X11, X11-like Phosphotyrosine-binding (PTB) domain Back     alignment and domain information 
 Score =  247 bits (634), Expect = 1e-82
 Identities = 93/169 (55%), Positives = 110/169 (65%), Gaps = 20/169 (11%)

Query: 16  PEDPVVDTGLGPGTLFRLKFLGSVQVDEDDPKCCKRRVKKVMVEEA-----APEGETQPS 70
           PED      L  G +F   +LGS Q+  +      + V+    +EA     APEGE+QPS
Sbjct: 1   PED------LIDGVIFGANYLGSTQLLSERNPT--KSVRMQQAQEAVSRIKAPEGESQPS 52

Query: 71  TEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEP--- 127
           TEVDLFISTE+I VLN D +E MMDHALRTISYIADIG++VVLMARRR     + E    
Sbjct: 53  TEVDLFISTERIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSSSQECIET 112

Query: 128 ----PKISRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIED 172
                +  R  KMICHVFES++AQ IAQSIGQAF VAY EFL+ANGI  
Sbjct: 113 TPPAQEGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINP 161

The function of the neuronal protein X11 is unknown to date. X11 has a PTB domain followed by two PDZ domains. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 161
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|241303 cd01273, PTB_CED-6, Cell death protein 6 homolog (CED-6/GULP1) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|241315 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM-motif TK (TM/HMTK) Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241311 cd13157, PTB_tensin-related, Tensin-related Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|241304 cd01274, PTB_Anks, Ankyrin repeat and sterile alpha motif (SAM) domain-containing (Anks) protein family Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|241248 cd01212, PTB_JIP, JNK-interacting protein-like (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|241313 cd13159, PTB_LDLRAP-mammal-like, Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1) in mammals and similar proteins Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241245 cd01209, PTB_Shc, Shc-like phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG3605|consensus829 100.0
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 100.0
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 100.0
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 99.98
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 99.98
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 99.97
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 99.97
cd01212148 JIP JNK-interacting protein (JIP) Phosphotyrosine- 99.97
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 99.96
cd01215139 Dab Disabled (Dab) Phosphotyrosine-binding domain. 99.96
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 99.95
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 99.93
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 99.93
cd01271124 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT 99.93
KOG3536|consensus321 99.92
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 99.91
cd01214133 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain 99.9
KOG3209|consensus984 99.86
KOG3209|consensus 984 99.85
KOG3775|consensus482 99.78
cd01269129 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) dom 99.76
PF14719182 PID_2: Phosphotyrosine interaction domain (PTB/PID 99.73
KOG3537|consensus 543 99.72
cd01211125 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma 99.7
cd01213138 tensin Tensin Phosphotyrosine-binding (PTB) domain 99.61
KOG3535|consensus 557 99.54
KOG3697|consensus345 99.54
KOG3580|consensus 1027 99.53
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.5
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.46
PRK10942473 serine endoprotease; Provisional 99.42
PRK10139455 serine endoprotease; Provisional 99.41
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.4
KOG3580|consensus 1027 99.26
cd01272138 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain. 99.21
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.21
KOG3550|consensus207 99.2
PF08416131 PTB: Phosphotyrosine-binding domain; InterPro: IPR 99.17
PF10480200 ICAP-1_inte_bdg: Beta-1 integrin binding protein; 99.16
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.02
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.97
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.84
KOG3553|consensus124 98.79
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.68
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.62
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.59
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.59
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.58
KOG3550|consensus207 98.52
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.46
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.39
KOG1930|consensus483 98.36
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.34
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.3
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.26
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.24
KOG3551|consensus 506 98.2
KOG3549|consensus 505 98.19
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.05
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.02
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.01
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.97
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.97
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.97
KOG3553|consensus124 97.96
KOG1892|consensus 1629 97.96
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.95
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.95
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.93
KOG3651|consensus 429 97.88
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.87
KOG3938|consensus334 97.85
KOG3549|consensus 505 97.83
KOG3606|consensus358 97.8
KOG3551|consensus 506 97.79
KOG3571|consensus 626 97.79
KOG3651|consensus 429 97.78
KOG0507|consensus854 97.69
cd01217158 CG12581 CG12581 Phosphotyrosine-binding (PTB) doma 97.67
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.63
KOG1892|consensus 1629 97.61
KOG3542|consensus 1283 97.59
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.56
KOG3606|consensus 358 97.53
PRK11186 667 carboxy-terminal protease; Provisional 97.51
KOG0609|consensus 542 97.47
PRK10139 455 serine endoprotease; Provisional 97.47
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.42
KOG3571|consensus 626 97.39
cd01210127 EPS8 Epidermal growth factor receptor kinase subst 97.37
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.37
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.37
PRK10898353 serine endoprotease; Provisional 97.37
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.36
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.35
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.34
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.34
KOG3552|consensus 1298 97.33
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.32
PRK10898353 serine endoprotease; Provisional 97.3
KOG3552|consensus 1298 97.29
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.22
PRK10942 473 serine endoprotease; Provisional 97.21
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.21
KOG1421|consensus 955 97.19
KOG3605|consensus 829 97.15
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.1
KOG0609|consensus 542 97.07
KOG3542|consensus 1283 97.04
PRK11186 667 carboxy-terminal protease; Provisional 97.0
KOG4407|consensus 1973 96.92
KOG4458|consensus78 96.92
KOG4448|consensus374 96.92
KOG3834|consensus 462 96.91
KOG1320|consensus473 96.86
KOG1421|consensus955 96.66
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.6
COG3975558 Predicted protease with the C-terminal PDZ domain 96.57
KOG4371|consensus1332 96.53
KOG0606|consensus 1205 96.35
KOG3938|consensus 334 96.35
KOG3129|consensus231 96.15
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.13
KOG3129|consensus231 96.08
PRK09681276 putative type II secretion protein GspC; Provision 95.92
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.81
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.7
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.69
COG3975558 Predicted protease with the C-terminal PDZ domain 95.23
PF1281278 PDZ_1: PDZ-like domain 95.2
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.06
KOG3532|consensus 1051 94.58
COG3480342 SdrC Predicted secreted protein containing a PDZ d 94.25
KOG0507|consensus854 94.05
KOG3532|consensus 1051 93.81
PRK09681276 putative type II secretion protein GspC; Provision 93.52
KOG1738|consensus 638 93.23
KOG0606|consensus 1205 93.18
COG3031275 PulC Type II secretory pathway, component PulC [In 91.94
KOG1320|consensus473 91.32
KOG3557|consensus 721 89.11
KOG1738|consensus 638 89.06
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 86.58
KOG3834|consensus 462 86.42
COG0750 375 Predicted membrane-associated Zn-dependent proteas 86.28
KOG2921|consensus 484 85.37
PF1281278 PDZ_1: PDZ-like domain 82.44
PF02174100 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 80.25
KOG4436|consensus 948 80.03
>KOG3605|consensus Back     alignment and domain information 
Probab=100.00  E-value=6e-70  Score=523.31  Aligned_cols=336  Identities=64%  Similarity=0.930  Sum_probs=302.9

Q ss_pred             CCCcccCcCCCCcEEEEeeeEEEEe-ccCCChhhHHHHH--HHHHHHh-----------CCCCCCCCCcEEEEEEECCee
Q psy5022          17 EDPVVDTGLGPGTLFRLKFLGSVQV-DEDDPKCCKRRVK--KVMVEEA-----------APEGETQPSTEVDLFISTEKI   82 (359)
Q Consensus        17 ~~~~~~~~l~~gv~f~~kylGs~~V-~~~~~~~~~~~~~--~~~~~~~-----------~~~~~~~~~~~v~l~iS~~gi   82 (359)
                      +.|..++.|++||.|.++||||++. ++.++...+++++  ..+.+.+           +++++.|++++|+|+||+++|
T Consensus       438 pg~~epe~LidGvif~A~ylgsTqllse~~psk~~rm~Qaqeavsrvk~~~~~~~s~~~Apegesqp~tevdlfist~ri  517 (829)
T KOG3605|consen  438 PGPCEPEDLIDGVIFGARYLGSTQLLSERNPSKAVRMMQAQEAVSRVKGGQKNAKSGKKAPEGESQPMTEVDLFISTQRI  517 (829)
T ss_pred             CCCCCHHHhhhhheeecccccccccccCCCCcHHHHHHHHHHHHhhhccccccccccccCCCCCCCcceeeeeeeeccee
Confidence            4467778899999999999999999 8888888887643  2222222           788999999999999999999


Q ss_pred             EEEeCCccceeeccccceeeeEEecCCceEEeeecccccccCC-------CCCCCCCCCcceeeEeeccchhhHHhhcch
Q psy5022          83 MVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEAD-------EPPKISRTPKMICHVFESDEAQFIAQSIGQ  155 (359)
Q Consensus        83 ~~~~~~t~~~~~~~~l~~IS~~~~~~~~~~~~~~~~f~~~~~~-------~~~~~~~~~~~~Chvf~s~~a~~i~~~ig~  155 (359)
                      ++++.++++++|+|+|+.|||++|++++++||++|.+..-...       ...+..++++++||||+|++||.|+++|||
T Consensus       518 ~VLnadlqe~mmdhaLrtisyiadIg~lvvlMarrr~~~~s~~~~~~~~~~~~~~~rtpKMICHVFESdeAQfIAQSIGQ  597 (829)
T KOG3605|consen  518 KVLNADLQETMMDHALRTISYIADIGNVVVLMARRRDVRSSSEDCSEDIDPAQKGNRTPKMICHVFESDEAQFIAQSIGQ  597 (829)
T ss_pred             EEEechhHHhhhhhhhhhhHHHhhhhHHHHHHHHhhcccccccccCCCCCcccccCCCcceEEEEeccchHHHHHHHHHH
Confidence            9999999999999999999999999999999999998543221       234556889999999999999999999999


Q ss_pred             hhHHHHHHHHHhcCCCCcccccchhhhhhhcccccccchhhhhhcccccEEEEeeCCCCCccceEEEecCCCCcCCcEEE
Q psy5022         156 AFQVAYMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVI  235 (359)
Q Consensus       156 af~~ay~~~L~~~gi~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~l~r~~~~~lG~~i~~~~~g~~~~~~~V  235 (359)
                      ||++||++||++||++++++.++++|+++++++++++++|..|+..+++++|.+.|..|+.||+.|++++||+..|.++|
T Consensus       598 AFqVAY~EFLrANGI~~e~l~~q~dYqevlNsQei~gDeLe~FakkE~qKEVvv~K~kGEiLGVViVESGWGSmLPTVVi  677 (829)
T KOG3605|consen  598 AFQVAYMEFLRANGIEPEDLVSQMDYQEVLNSQEIFGDELEHFAKKENQKEVVLEKHKGEILGVVIVESGWGSILPTVVI  677 (829)
T ss_pred             HHHHHHHHHHHHcCCCchHhhhhcchhhccchhhhhccHHHHhhhhcccceeeeecccCceeeEEEEecCccccchHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEECCCChhhhcCCCCCCCEEEEECCccHHH--------HHHhhcCCCeEEEEEEeCcceEE--eecc--ccccCcEEec
Q psy5022         236 ANLAPAGAAARCGQLNIGDQIIAVNGVSLVA--------YMEFLKANGIEDHSFVKEMDYQE--VLNS--QEIFGDELQM  303 (359)
Q Consensus       236 ~~v~~~s~A~~~G~L~~GD~Il~Vng~~v~~--------~~~~~~~~~~v~l~v~~~~~~~~--~~~~--~~~~G~~~~~  303 (359)
                      ++..+++||+++|+|..||+|++|||.++.+        .++.+++...|+|+|++-.....  +.++  ..-|||++. 
T Consensus       678 Anmm~~GpAarsgkLnIGDQiiaING~SLVGLPLstcQs~Ik~~KnQT~VkltiV~cpPV~~V~I~RPd~kyQLGFSVQ-  756 (829)
T KOG3605|consen  678 ANMMHGGPAARSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQTAVKLNIVSCPPVTTVLIRRPDLRYQLGFSVQ-  756 (829)
T ss_pred             HhcccCChhhhcCCccccceeEeecCceeccccHHHHHHHHhcccccceEEEEEecCCCceEEEeecccchhhccceee-
Confidence            9999999999999999999999999999888        78888999999999987544332  2233  356799998 


Q ss_pred             ccccccCcEEEEEcCCChhhcCCCCCCCEEEEECCEECCCCCHHHHHHHHHhccCC
Q psy5022         304 FAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGE  359 (359)
Q Consensus       304 ~~~~~~~~~I~~v~~gs~A~~~gL~~GD~Il~INg~~v~~~~~~~~v~~l~~s~g~  359 (359)
                            ..+|+++..||.|+|+|+|+|.||++|||++|...+|+.+|++|.++.||
T Consensus       757 ------NGiICSLlRGGIAERGGVRVGHRIIEINgQSVVA~pHekIV~lLs~aVGE  806 (829)
T KOG3605|consen  757 ------NGIICSLLRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVQLLSNAVGE  806 (829)
T ss_pred             ------CcEeehhhcccchhccCceeeeeEEEECCceEEeccHHHHHHHHHHhhhh
Confidence                  67999999999999999999999999999999999999999999999986

>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain Back     alignment and domain information
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3536|consensus Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>cd01269 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>KOG3537|consensus Back     alignment and domain information
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3535|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd01272 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein Back     alignment and domain information
>PF10480 ICAP-1_inte_bdg: Beta-1 integrin binding protein; InterPro: IPR019517 ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG4458|consensus Back     alignment and domain information
>KOG4448|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF02174 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 Insulin receptor substrate-1 proteins contain both a pleckstrin homology domain IPR001849 from INTERPRO and a phosphotyrosine binding (PTB) domain Back     alignment and domain information
>KOG4436|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
3suz_A287 Crystal Structure Of Rat Mint2 Ppc Length = 287 7e-60
3suz_A287 Crystal Structure Of Rat Mint2 Ppc Length = 287 2e-07
4dbb_A162 The Ptb Domain Of Mint1 Is Autoinhibited By A Helix 1e-40
1u3b_A185 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 3e-37
3sv1_A190 Crystal Structure Of App Peptide Bound Rat Mint2 Pa 5e-37
1aqc_A172 X11 Ptb Domain-10mer Peptide Complex Length = 172 8e-35
1u38_A89 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 1e-17
1x45_A98 Solution Structure Of The First Pdz Domain Of Amylo 3e-17
1y7n_A90 Solution Structure Of The Second Pdz Domain Of The 5e-17
1u39_A80 Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFF 8e-17
2yt8_A94 Solution Structure Of The Pdz Domain Of Amyloid Bet 3e-15
2yt7_A101 Solution Structure Of The Pdz Domain Of Amyloid Bet 9e-15
1n3h_A207 Coupling Of Folding And Binding In The Ptb Domain O 3e-05
2l1c_A211 Shc-Ptb:biphosphorylated Integrin Beta3 Cytoplasmic 4e-05
1shc_A195 Shc Ptb Domain Complexed With A Trka Receptor Phosp 4e-05
3l4f_D132 Crystal Structure Of Betapix Coiled-Coil Domain And 5e-04
3qjm_A115 Structural Flexibility Of Shank Pdz Domain Is Impor 5e-04
1q3o_A109 Crystal Structure Of The Shank Pdz-ligand Complex R 5e-04
>pdb|4DBB|A Chain A, The Ptb Domain Of Mint1 Is Autoinhibited By A Helix In The C-Terminal Linker Region Length = 162 Back     alignment and structure
>pdb|1U3B|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 185 Back     alignment and structure
>pdb|3SV1|A Chain A, Crystal Structure Of App Peptide Bound Rat Mint2 Parm Length = 190 Back     alignment and structure
>pdb|1AQC|A Chain A, X11 Ptb Domain-10mer Peptide Complex Length = 172 Back     alignment and structure
>pdb|1U38|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 89 Back     alignment and structure
>pdb|1X45|A Chain A, Solution Structure Of The First Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A, Member 1 Length = 98 Back     alignment and structure
>pdb|1Y7N|A Chain A, Solution Structure Of The Second Pdz Domain Of The Human Neuronal Adaptor X11alpha Length = 90 Back     alignment and structure
>pdb|1U39|A Chain A, Auto-Inhibition Mechanism Of X11sMINTS FAMILY SCAFFOLD Proteins Revealed By The Closed Conformation Of The Tandem Pdz Domains Length = 80 Back     alignment and structure
>pdb|2YT8|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 (Neuron- Specific X11l2 Protein) (Neuronal Munc18-1-Interacting Protein 3) (Mint-3) (Adapter Protein X11gamma) Length = 94 Back     alignment and structure
>pdb|2YT7|A Chain A, Solution Structure Of The Pdz Domain Of Amyloid Beta A4 Precursor Protein-Binding Family A Member 3 Length = 101 Back     alignment and structure
>pdb|1N3H|A Chain A, Coupling Of Folding And Binding In The Ptb Domain Of The Signaling Protein Shc Length = 207 Back     alignment and structure
>pdb|2L1C|A Chain A, Shc-Ptb:biphosphorylated Integrin Beta3 Cytoplasmic Tail Complex (1:1) Length = 211 Back     alignment and structure
>pdb|1SHC|A Chain A, Shc Ptb Domain Complexed With A Trka Receptor Phosphopeptide, Nmr, Minimized Average Structure Length = 195 Back     alignment and structure
>pdb|3L4F|D Chain D, Crystal Structure Of Betapix Coiled-Coil Domain And Shank Pdz Complex Length = 132 Back     alignment and structure
>pdb|3QJM|A Chain A, Structural Flexibility Of Shank Pdz Domain Is Important For Its Binding To Different Ligands Length = 115 Back     alignment and structure
>pdb|1Q3O|A Chain A, Crystal Structure Of The Shank Pdz-ligand Complex Reveals A Class I Pdz Interaction And A Novel Pdz-pdz Dimerization Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-76
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 2e-40
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 4e-39
2ela_A175 Adapter protein containing PH domain, PTB domain a 9e-34
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 2e-30
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 1e-28
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 1e-27
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 6e-26
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-24
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-10
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-24
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-23
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-23
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 5e-23
1n3h_A207 SHC transforming protein; free protein, beta sandw 8e-23
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 1e-22
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 5e-22
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-21
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-07
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 6e-15
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-05
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 5e-14
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 3e-04
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 7e-14
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-13
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-04
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-13
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-05
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-13
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-07
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-12
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 4e-07
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 3e-12
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 4e-12
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-07
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 5e-12
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 6e-12
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 1e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-11
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 4e-06
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-11
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-06
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 4e-11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-05
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 4e-11
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 5e-06
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-11
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-05
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 5e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 5e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 1e-05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-10
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-06
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-10
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-05
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-10
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-05
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-10
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 8e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-10
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-05
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-10
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 3e-05
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-10
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-05
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-10
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 4e-05
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-10
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-05
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 5e-10
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 9e-06
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-10
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 3e-04
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 7e-10
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-06
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 7e-10
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-05
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-10
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-05
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 8e-10
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 1e-05
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-09
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-04
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-09
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 4e-05
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-09
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-04
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-09
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 5e-07
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-09
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 7e-05
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 4e-09
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 7e-06
2o2t_A117 Multiple PDZ domain protein; structural protein, s 5e-09
2opg_A98 Multiple PDZ domain protein; structural protein, s 5e-09
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-05
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 5e-09
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 6e-04
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 5e-09
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 6e-05
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 6e-09
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 4e-05
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 6e-09
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 3e-05
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 6e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-05
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 7e-09
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 3e-06
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 7e-09
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-04
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 8e-09
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 4e-04
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 9e-09
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-04
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-08
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 8e-05
2djt_A104 Unnamed protein product; PDZ domain, structural ge 1e-08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 7e-06
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-08
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 1e-08
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-05
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-08
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 8e-05
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-08
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-05
2ego_A96 General receptor for phosphoinositides 1- associat 2e-08
2ego_A96 General receptor for phosphoinositides 1- associat 3e-04
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-08
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 3e-05
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-08
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 1e-04
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-08
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 5e-05
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-08
2fne_A117 Multiple PDZ domain protein; structural protein, s 5e-05
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-08
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-04
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-08
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 9e-04
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 2e-08
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 9e-06
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-08
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-05
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 3e-08
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-04
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 3e-08
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 8e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-08
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-04
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-08
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-06
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-08
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-04
2eei_A106 PDZ domain-containing protein 1; regulatory factor 3e-08
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-04
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 3e-08
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-05
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 3e-08
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 7e-04
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 3e-08
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-05
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-08
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-05
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 4e-08
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 6e-06
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-08
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 7e-05
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-08
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-08
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 4e-08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 4e-08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 3e-07
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 8e-05
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-08
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 5e-05
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 5e-08
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 7e-04
2v90_A96 PDZ domain-containing protein 3; membrane, protein 5e-08
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-04
2d90_A102 PDZ domain containing protein 1; structural genomi 5e-08
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 5e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 5e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 7e-05
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 6e-08
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 6e-08
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 6e-08
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-05
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-08
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 8e-04
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 7e-08
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 5e-05
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 7e-08
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 7e-08
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 8e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 7e-08
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-04
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 7e-08
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 4e-06
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 8e-08
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-05
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 8e-08
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 6e-05
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 8e-08
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-05
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 9e-08
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-07
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 8e-05
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-07
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-04
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-07
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 9e-05
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 1e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-04
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-07
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-07
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-06
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-07
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 7e-05
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-07
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-04
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-07
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 9e-05
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-07
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-07
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-05
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-07
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-07
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-05
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-07
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 2e-07
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-07
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 9e-05
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-07
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-07
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 7e-04
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 3e-07
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-06
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-07
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-05
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 4e-07
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-05
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 5e-07
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 1e-05
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 5e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 5e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 3e-04
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 6e-07
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 4e-04
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 7e-07
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 6e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 8e-07
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 4e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 4e-04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-06
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 5e-04
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 5e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 4e-04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-06
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 7e-04
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-06
3k1r_A192 Harmonin; protein-protein complex, alternative spl 2e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-05
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-06
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-06
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 6e-04
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 3e-06
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-06
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-04
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-06
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-05
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 4e-06
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 7e-04
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-06
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-05
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 6e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 5e-04
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 8e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-05
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-05
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 6e-04
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 8e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 8e-04
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 4e-04
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
 Score =  238 bits (608), Expect = 5e-76
 Identities = 171/362 (47%), Positives = 222/362 (61%), Gaps = 28/362 (7%)

Query: 25  LGPGTLFRLKFLGSVQVD---------------EDDPKCCKRRVKKVMVEEAAPEGETQP 69
           L  G +F   +LGS Q+                E   +  + +    + ++A  EG+ Q 
Sbjct: 5   LIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQT 64

Query: 70  STEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPK 129
            TEVDLFIST++I VLN D +E MMDHALRTISYIADIG++VVLMARRR     + +  +
Sbjct: 65  LTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIE 124

Query: 130 IS-------RTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKANGIEDHSFVKEMDYQ 182
            +       +  KMICHVFES++AQ IAQSIGQAF VAY EFL+ANGI       + +Y 
Sbjct: 125 TTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDL-SQKEYS 183

Query: 183 EVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAPAG 242
           +++N+QE++ D+L  F+  E  KE+ + K KGEILGVV+VESGWGS+LPTV++AN+   G
Sbjct: 184 DIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGG 243

Query: 243 AAARCGQLNIGDQIIAVNGVSLVAY-----MEFLKANGIEDHSFVKEMDYQEVLNSQEIF 297
            AAR G+L+IGDQI+++NG SLV          +K    +    +  +    V       
Sbjct: 244 PAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKR 303

Query: 298 GDELQMFAKKELQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSV 357
            D             ICSL+RGGIAERGGVRVGHRIIEIN QSVVA  HEKIV  L+ SV
Sbjct: 304 PDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSV 363

Query: 358 GE 359
           GE
Sbjct: 364 GE 365
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Length = 172 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Length = 207 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 100.0
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 100.0
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 100.0
2ela_A175 Adapter protein containing PH domain, PTB domain a 100.0
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 99.98
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 99.97
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 99.97
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 99.96
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 99.96
1n3h_A207 SHC transforming protein; free protein, beta sandw 99.96
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 99.95
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 99.95
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 99.95
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 99.95
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 99.9
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.87
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.84
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.83
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.82
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.78
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 99.73
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.73
3d8d_A148 Amyloid beta A4 precursor protein-binding family 1 99.7
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 99.65
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.63
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.62
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.55
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.53
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.33
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.32
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.29
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.26
4dx8_A154 Integrin beta-1-binding protein 1; protein-protien 99.25
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.25
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.24
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.22
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.21
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.21
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.21
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.2
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.2
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.2
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 99.19
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.19
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.19
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.18
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.17
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.17
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.17
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.16
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.15
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.15
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.14
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.13
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.13
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.13
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.13
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.13
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.13
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.12
2ego_A96 General receptor for phosphoinositides 1- associat 99.12
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.12
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.11
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.11
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.11
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.11
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.1
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.1
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.1
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.1
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.1
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.09
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.09
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.09
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.09
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.09
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.09
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.09
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.08
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.08
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.08
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.07
2awx_A105 Synapse associated protein 97; membrane protein, s 99.07
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.07
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.07
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.07
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.07
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.07
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.07
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.07
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.07
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.06
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.06
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.06
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.06
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.05
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.05
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.05
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.04
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.04
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.04
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.04
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.04
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.04
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.03
2awx_A105 Synapse associated protein 97; membrane protein, s 99.03
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.03
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.02
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.02
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.02
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.02
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.02
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.02
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.01
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.01
2ego_A96 General receptor for phosphoinositides 1- associat 99.01
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.01
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.01
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.01
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.01
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.0
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.0
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.0
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.0
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.0
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.0
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.0
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.0
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.0
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.0
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.0
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.0
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.0
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.99
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.99
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.99
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.99
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.99
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.99
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.98
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.98
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.98
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.98
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.98
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.98
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.98
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.98
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.98
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.97
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.97
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.97
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.97
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.97
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.97
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.97
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.97
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.96
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.96
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.96
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.96
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.96
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.95
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.95
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.95
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.95
2d90_A102 PDZ domain containing protein 1; structural genomi 98.95
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.95
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.95
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.95
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.95
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.95
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 98.94
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.48
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.94
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.94
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.94
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.94
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.94
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.94
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.94
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.94
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.94
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.94
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.94
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.94
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.93
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.93
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.93
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.93
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.93
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.93
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.93
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.93
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.93
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.92
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.92
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.92
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.92
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.92
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.92
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.92
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.92
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.92
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.92
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.92
1z87_A 263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.92
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.92
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.91
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.91
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.91
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.91
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.91
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.91
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.91
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.91
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.91
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.91
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.91
2d90_A102 PDZ domain containing protein 1; structural genomi 98.91
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.91
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.9
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.9
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.9
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.9
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.9
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.9
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.89
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.89
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.89
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.89
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.88
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.88
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.88
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.88
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.88
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.88
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.88
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.88
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.88
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.87
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.87
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.87
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.87
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.87
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.87
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.87
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.87
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.87
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.86
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.86
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.86
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.86
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.85
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.85
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.85
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.84
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.84
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.84
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.84
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.84
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.84
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.84
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.84
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.84
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.83
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.83
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.83
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.83
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.82
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.82
3gsl_A 196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.82
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.82
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.82
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.82
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.82
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.82
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.82
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 98.81
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.81
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.81
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.8
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.79
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.79
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.79
3r0h_A 206 INAD, inactivation-NO-after-potential D protein; p 98.79
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.78
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.78
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.78
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.78
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.78
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.77
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.77
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.77
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.76
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.75
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.75
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.75
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.75
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.74
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.74
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.74
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.73
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.73
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.73
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.72
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.71
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.71
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.7
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.7
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.7
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.68
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.68
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.68
1p1d_A 196 PDZ45, glutamate receptor interacting protein; PDZ 98.68
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.66
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.66
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.66
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.66
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.66
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.65
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.64
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.64
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.64
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.63
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.62
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.62
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.04
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.61
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.6
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.59
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.59
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.58
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.57
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.56
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.54
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.53
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.52
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.46
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.46
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.44
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.42
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.41
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.4
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.38
3suz_A 388 Amyloid beta A4 precursor protein-binding family 2 98.36
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.36
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.34
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.33
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.31
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.3
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.29
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.29
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.28
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.24
2kl1_A94 YLBL protein; structure genomics, structural genom 98.21
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.21
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.21
2kl1_A94 YLBL protein; structure genomics, structural genom 98.21
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.21
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.15
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.14
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.13
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.13
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.12
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.03
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.02
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.01
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.92
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.88
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.87
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.84
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.82
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.81
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.8
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.8
2cy5_A140 Epidermal growth factor receptor pathway substrate 97.78
3k50_A 403 Putative S41 protease; structural genomics, joint 97.77
3k50_A 403 Putative S41 protease; structural genomics, joint 97.77
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.74
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.72
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.63
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.6
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.53
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.51
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.5
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.39
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.36
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.32
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.23
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 97.08
1k32_A 1045 Tricorn protease; protein degradation, substrate g 96.57
1k32_A 1045 Tricorn protease; protein degradation, substrate g 95.87
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 95.83
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 90.22
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 83.17
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 81.21
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
Probab=100.00  E-value=1.5e-59  Score=455.03  Aligned_cols=328  Identities=54%  Similarity=0.816  Sum_probs=215.3

Q ss_pred             CcCCCCcEEEEeeeEEEEe-ccCCChhhHH------HHHHHHH-------HH-hCCCCCCCCCcEEEEEEECCeeEEEeC
Q psy5022          23 TGLGPGTLFRLKFLGSVQV-DEDDPKCCKR------RVKKVMV-------EE-AAPEGETQPSTEVDLFISTEKIMVLNT   87 (359)
Q Consensus        23 ~~l~~gv~f~~kylGs~~V-~~~~~~~~~~------~~~~~~~-------~~-~~~~~~~~~~~~v~l~iS~~gi~~~~~   87 (359)
                      |.|++||+|.+|||||+|| ++..++..++      +++++.+       .+ +.+++..+++++|.|+||++||++++.
T Consensus         3 e~l~~gv~f~~kylG~~~v~s~~~~~~~~r~~~~~eai~rv~~~~k~~~~~~~~~~~~~~~~~~~v~l~IS~~gi~v~~~   82 (388)
T 3suz_A            3 EDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDAQTLTEVDLFISTQRIKVLNA   82 (388)
T ss_dssp             HHHHHCEEEEEEEEEEEEEEECSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHSCSSCCCCSSEEEEEEECSSEEEEEET
T ss_pred             ccccCCcEEeeeEeeeeeccCCCCCCccchHHHHHHHHHHHHHHHhhccccccCCCcccccccceEEEEEEeceEEEEec
Confidence            5689999999999999999 4444444332      2222222       11 136888899999999999999999999


Q ss_pred             CccceeeccccceeeeEEecCCceEEeeecccccccC---C----CCCCCCCCCcceeeEeeccchhhHHhhcchhhHHH
Q psy5022          88 DLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEA---D----EPPKISRTPKMICHVFESDEAQFIAQSIGQAFQVA  160 (359)
Q Consensus        88 ~t~~~~~~~~l~~IS~~~~~~~~~~~~~~~~f~~~~~---~----~~~~~~~~~~~~Chvf~s~~a~~i~~~ig~af~~a  160 (359)
                      +|++++|+|+|++||||+|+.++|+||+++.......   .    ......+..+++||||+|++|+.|+++++|||+++
T Consensus        83 ~t~~~~~~~~l~~IS~~~d~~~~~~~iak~~~~~~~~~~~~~~~~~~~~~~~~~~~~ChvF~s~~a~~i~~ti~qaf~~~  162 (388)
T 3suz_A           83 DTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVA  162 (388)
T ss_dssp             TTCCEEEEEEGGGEEEEEECSSEEEEEEEECCCCCC-------------CCCCEEEEEEEEECTTHHHHHHHHHHHHHHH
T ss_pred             CCcChhhhccccceeEEeecCceEEEEEecCCCccccccccccCccccccccccceEEEEecccCHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999986532211   0    01122356789999999999999999999999999


Q ss_pred             HHHHHHhcCCCCcccccchhhhhhhcccccccchhhhhhcccccEEEEeeCCCCCccceEEEecCCCCcCCcEEEEEECC
Q psy5022         161 YMEFLKANGIEDHSFVKEMDYQEVLNSQEIFGDELQMFAKKELQKEVVVPKAKGEILGVVIVESGWGSMLPTVVIANLAP  240 (359)
Q Consensus       161 y~~~L~~~gi~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~l~r~~~~~lG~~i~~~~~g~~~~~~~V~~v~~  240 (359)
                      |++||++++++..+. .+.+|+..++.+.++++++..|..++.+++|.+.|..+++|||.|.+..+|...++++|..|.+
T Consensus       163 y~~~l~~~gi~~~~~-~~~~y~~~~~~~~~~~d~~~~~~~~~~~~~V~i~k~~ge~lG~~i~~~~~g~~~~g~~V~~V~~  241 (388)
T 3suz_A          163 YQEFLRANGINPEDL-SQKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMN  241 (388)
T ss_dssp             HHHHHHHHTCCTTTS-CHHHHHHHHHHHHHHHHHHHHTCCSSCCEEEEECCCSSCCCCCCCBCC---CCSCCCBCCCCCC
T ss_pred             hhhhccccCcCcccc-chhhhcccccccccccchhhhhcccccceEEEEECCCCCceeEEEEecCCCCcCCCEEEEeeCC
Confidence            999999999987766 6679999999999999999999999999999999998899999998766776667889999999


Q ss_pred             CChhhhcCCCCCCCEEEEECCccHHH--------HHHhhcCCCeEEEEEEeCcceEE-ee---ccccccCcEEecccccc
Q psy5022         241 AGAAARCGQLNIGDQIIAVNGVSLVA--------YMEFLKANGIEDHSFVKEMDYQE-VL---NSQEIFGDELQMFAKKE  308 (359)
Q Consensus       241 ~s~A~~~G~L~~GD~Il~Vng~~v~~--------~~~~~~~~~~v~l~v~~~~~~~~-~~---~~~~~~G~~~~~~~~~~  308 (359)
                      +|||+++|+|++||+|++|||+++.+        +++..+.+..++|++.+...... ..   .....+||.+.      
T Consensus       242 gspA~~aG~L~~GD~Il~VnG~~v~~~~~~~~~~~l~~~~~~~~v~l~v~r~~~~~~v~l~~~~~~~~lG~~i~------  315 (388)
T 3suz_A          242 GGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQ------  315 (388)
T ss_dssp             SSHHHHTCCCCTTCEEEEETTEECSSCCSTTHHHHTTTCTTCSCEEEEEEECCSCC------------------------
T ss_pred             CCHHHHcCCCCCCCEEEEECCEEccCCCHHHHHHHHHhccCCCccccccccccccceeeEeecCCCCccceEEe------
Confidence            99999999999999999999999865        33344345669999987643221 11   23456888876      


Q ss_pred             cCcEEEEEcCCChhhcCCCCCCCEEEEECCEECCCCCHHHHHHHHHhccC
Q psy5022         309 LQKEICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVG  358 (359)
Q Consensus       309 ~~~~I~~v~~gs~A~~~gL~~GD~Il~INg~~v~~~~~~~~v~~l~~s~g  358 (359)
                       +.+|..|.+||||+++||++||+|++|||+++.+++|++++++|+++.+
T Consensus       316 -~g~I~~V~~gs~A~~aGL~~GD~Il~VNg~~v~~~s~~~~~~~l~~~~~  364 (388)
T 3suz_A          316 -NGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVG  364 (388)
T ss_dssp             --------------------------------------------------
T ss_pred             -cCEEEEeecCCHHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHHhCCC
Confidence             3489999999999999999999999999999999999999999987643
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Back     alignment and structure
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Back     alignment and structure
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A Back     alignment and structure
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} SCOP: b.55.1.2 PDB: 2loz_A 2dkq_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>4dx8_A Integrin beta-1-binding protein 1; protein-protien complex, PTB domain, nudix fold, protein-Pro interaction, membrane, nucleus, protein binding; 2.54A {Homo sapiens} PDB: 4dx9_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2cy5_A Epidermal growth factor receptor pathway substrate 8-like protein 1; structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA; 1.90A {Mus musculus} SCOP: b.55.1.2 PDB: 2cy4_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 4e-40
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 3e-29
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 9e-27
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 3e-24
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 8e-23
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 1e-20
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 1e-16
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 1e-15
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-15
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-04
d2dkqa1147 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T 7e-13
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-10
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-05
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 5e-10
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-05
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 8e-09
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-05
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-08
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-04
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 2e-08
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 9e-05
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 3e-08
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 4e-08
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 0.002
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 9e-08
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 9e-04
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-07
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-04
d1wvha1133 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal 2e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-07
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 3e-07
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-07
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-04
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 4e-07
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 4e-07
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 6e-05
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 5e-07
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 5e-04
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 8e-07
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 9e-07
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-05
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 0.002
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-06
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-06
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-06
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 0.004
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-06
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-06
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-05
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-06
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 0.001
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 4e-06
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-06
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 0.004
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 5e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 6e-06
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 5e-04
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 7e-06
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.002
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 9e-06
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 1e-05
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-05
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 2e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 0.002
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-05
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-05
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 3e-05
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-05
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-04
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 4e-05
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 7e-04
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 4e-05
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-05
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 5e-05
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 6e-05
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 7e-05
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-05
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 9e-05
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 1e-04
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 0.003
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 3e-04
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 4e-04
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 5e-04
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 0.003
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 9e-04
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 0.001
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 0.003
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 0.001
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 0.001
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 0.002
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 0.001
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 0.002
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: X11
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  137 bits (346), Expect = 4e-40
 Identities = 81/163 (49%), Positives = 100/163 (61%), Gaps = 21/163 (12%)

Query: 25  LGPGTLFRLKFLGSVQVDEDDPKC-------CKRRVKKVMVEEAA-------PEGETQPS 70
           L  G +F   +LGS Q+  D            +  V ++ + +         PEGE+QP 
Sbjct: 4   LIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPM 63

Query: 71  TEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDLVVLMARRRFVSQEADEPPKI 130
           TEVDLFI T++I VLN D +E MMDH LRTISYIADIG++VVLMARRR     + E  + 
Sbjct: 64  TEVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRIPRSNSQENVEA 123

Query: 131 S-------RTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLK 166
           S       R  KMICHVFES++AQ IAQSIGQAF VAY EFL+
Sbjct: 124 SHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR 166
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.96
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 99.95
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 99.95
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 99.93
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 99.89
d1wgua_136 Amyloid beta A4 precursor protein-binding family B 99.89
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1wvha1133 Tensin {Chicken (Gallus gallus) [TaxId: 9031]} 99.8
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.51
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.49
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.42
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.41
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.4
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.4
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.39
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.38
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.38
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.37
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.37
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.36
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.35
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.35
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.35
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.33
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.33
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.32
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.32
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.32
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.32
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.31
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.31
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.31
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.31
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.31
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.3
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.3
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.29
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.29
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.29
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.29
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.29
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.28
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.28
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.28
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.27
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.27
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.27
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.27
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.27
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.26
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.25
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.25
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.24
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.24
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.22
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.22
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.22
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.22
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.21
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.21
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.2
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.2
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.2
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.2
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.2
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.19
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.19
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.19
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.19
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.18
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.18
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.17
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.17
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.17
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.17
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.16
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.16
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.15
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.15
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.15
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.15
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.14
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.13
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.12
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.12
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.12
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.11
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.11
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.1
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.09
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.08
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.06
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.06
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.04
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.03
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.02
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.0
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.99
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.98
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.97
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.97
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.93
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.93
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.93
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.93
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.87
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.86
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.86
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.81
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.8
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.71
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.63
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.61
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.58
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.56
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.54
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.47
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.44
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.4
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.39
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.36
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.3
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.29
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.26
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.24
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.24
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.19
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.14
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 96.13
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: X11
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.1e-34  Score=244.59  Aligned_cols=140  Identities=57%  Similarity=0.852  Sum_probs=102.8

Q ss_pred             CcCCCCcEEEEeeeEEEEeccCCChh-h-----H-HHHHHHHHHHh-------CCCCCCCCCcEEEEEEECCeeEEEeCC
Q psy5022          23 TGLGPGTLFRLKFLGSVQVDEDDPKC-C-----K-RRVKKVMVEEA-------APEGETQPSTEVDLFISTEKIMVLNTD   88 (359)
Q Consensus        23 ~~l~~gv~f~~kylGs~~V~~~~~~~-~-----~-~~~~~~~~~~~-------~~~~~~~~~~~v~l~iS~~gi~~~~~~   88 (359)
                      |.|++||+|.||||||++|..+++.. .     + +++++.....+       .+.++.+++++|.|.||.+||+++|++
T Consensus         2 E~l~~Gi~f~vkYLGs~~V~~~~~~~~~~r~~~~~eAi~ri~~~~~~~~~~~~~~~~~~~~~~~V~L~IS~~gIki~d~~   81 (166)
T d1aqca_           2 EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFILTQRIKVLNAD   81 (166)
T ss_dssp             CCTTTCEEEEEEEEEEEEEECCSSCCHHHHHHHHHHHHHHHHHHHHCC--------------CEEEEEECSSEEEEEETT
T ss_pred             ccccCCcEEEeEEeeEEEeccCCCCccchhHHHHHHHHHHHHHhhhcccccccccccccCcccEEEEEEECCeEEEEeCC
Confidence            67899999999999999996655532 1     2 23444432222       334455678899999999999999999


Q ss_pred             ccceeeccccceeeeEEecCCceEEeeeccc-----------ccccCCCCCCCCCCCcceeeEeeccchhhHHhhcchhh
Q psy5022          89 LKEIMMDHALRTISYIADIGDLVVLMARRRF-----------VSQEADEPPKISRTPKMICHVFESDEAQFIAQSIGQAF  157 (359)
Q Consensus        89 t~~~~~~~~l~~IS~~~~~~~~~~~~~~~~f-----------~~~~~~~~~~~~~~~~~~Chvf~s~~a~~i~~~ig~af  157 (359)
                      |++++++|+|++||||||++++|+||+++.-           .++.    ..+....+++||||.|++|++|+.+|||||
T Consensus        82 t~~vi~~~~i~~ISf~ad~~~~fafIar~~~~~~~~~~~~~~~~~~----~~~~~~~~~~CHVF~~~~A~~I~~tIGqAF  157 (166)
T d1aqca_          82 TQETMMDHPLRTISYIADIGNIVVLMARRRIPRSNSQENVEASHPS----QDGKRQYKMICHVFESEDAQLIAQSIGQAF  157 (166)
T ss_dssp             TCCEEEEEEGGGEEEEEEETTEEEEEECCC--------------------------CEEEEEEEECTTHHHHHHHHHHHH
T ss_pred             CCEEEEEecceEEEEEEeCCCEEEEEEecCCCCccccccccccccc----ccccCCCceEeEEEeCccHHHHHHHHHHHH
Confidence            9999999999999999999999999887531           1221    223455679999999988999999999999


Q ss_pred             HHHHHHHHH
Q psy5022         158 QVAYMEFLK  166 (359)
Q Consensus       158 ~~ay~~~L~  166 (359)
                      ++|||+||+
T Consensus       158 ~lay~~~l~  166 (166)
T d1aqca_         158 SVAYQEFLR  166 (166)
T ss_dssp             HHHHHHHHC
T ss_pred             HHHHHHHhC
Confidence            999999985
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure