Psyllid ID: psy5025

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530---
MVKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQGSSCQLTCETLNTGQVTCF
ccccccccccccccEEEEEEccccEEEEEcccccEEEcccccccccccccccccccEEEEcccccEEEcccccccccccccccccccccccccEEEEEccccccccEEEEEEEEEEccccEEEEEEcccccccccEEEEEEEccEEEEEEEccccEEEEEEcccccccccEEEEEEEEccEEEEEEcccccEEEEccccEEEEEccccEEEEccccccccccccccccccEEEEEEEEEccEEccccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccEEEEccccEEcccccEEEEEcccccccccccEEEEEEEEEEccccEEEEEEEEcccccEEEEEEEccEEEEEEEcccccEEEEEccEEEcccccEEEEEEEEEEEEEccccccccccccccccEEEEEEEEEccccEEEEEEcccccEEEEccccEEEEcccccEEEccccccccccccccccccEEEEEEEEEccEEccccccccccccccccccccccccccccc
cccccccEEEccccEEEccccccccHEcccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEEEccccccccccEEEEEEEEEccccEEEEEccccccccccEEEEEEEccEEEEEEEccccEEEEEcccEcccccEEEEEEEEcccEEEEEEccccccccccccccEEEEccccEEEcccccccccccccccccccEEEEEEEEEccEEccccHHHHccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEcccccccEEEEEEEccEEEEEEEccccEEEEEEcccccccccEEEEEEEEccccEEEEEccccccccccccccccccccccEccccEEEEEccccccccccccccEEEEccccEEEccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccc
mvksdnqvilddwntVRVFRHRWDAWiqlndgnkikgrskecledkcnktpcehggkcittpgssyclcplgftgdlcqtrldlqvpqfngssylryqgLGEQYLSLLDLTIVFkaiepngillynghradgvGDFIALYLNDRyvdftfdlgtgaatlrssnpislgewhklrltrtgrhaylqvdrfpssqilspgpftqLSLSLSLylggvpdynivspkvkiksSFIGCIQKVLINNhelnilgeaiqgvnvvncahpcitqpcgsgscvplydgykcvctqsckeshltEVMCasfdhgasflhyldpeiihssgllhyKFQLHVDFRITgyefnidmriktssssglilwtgssqskdFLALGIHNGYAHVMYNLGNGEVLLEnnqtkinngvWHRLTVHRNFMVVMhgsshtrsnksskieFKCLSIQRLHRTGKQCLIRidtdysmqsisggkfeqlntdsglyvggvedieELTRSKYHHSFKGWIsnlilsndyqvklplsrsqgsscqltcetlntgqvtcf
mvksdnqvilddwntvrVFRHRWDawiqlndgnkikgrSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAAtlrssnpislgewHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGsshtrsnksskieFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSqgsscqltcetlntgqvtcf
MVKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQlslslslylGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYnlgngevllennQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQGSSCQLTCETLNTGQVTCF
*******VILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHG**********KIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPL*******CQLTCETL********
*VKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRF*************LSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNIL****************ITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVK******************NTGQ*TCF
MVKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMH**********SKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQGSSCQLTCETLNTGQVTCF
*****NQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSS**EFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQGSSCQLTCETLNTGQV*CF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSKECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSGSCVPLYDGYKCVCTQSCKESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQGSSCQLTCETLNTGQVTCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query533 2.2.26 [Sep-21-2011]
Q63HQ21017 Pikachurin OS=Homo sapien no N/A 0.784 0.411 0.327 8e-67
A3KN331018 Pikachurin OS=Bos taurus yes N/A 0.784 0.410 0.330 3e-66
B4F7851005 Pikachurin OS=Rattus norv yes N/A 0.782 0.414 0.325 1e-64
Q4VBE41017 Pikachurin OS=Mus musculu yes N/A 0.782 0.410 0.324 1e-64
P253041959 Agrin OS=Rattus norvegicu no N/A 0.733 0.199 0.307 5e-53
A2ASQ11950 Agrin OS=Mus musculus GN= no N/A 0.733 0.200 0.303 7e-52
O004682067 Agrin OS=Homo sapiens GN= no N/A 0.656 0.169 0.343 1e-50
P316962081 Agrin OS=Gallus gallus GN no N/A 0.784 0.200 0.282 2e-49
Q904041328 Agrin (Fragment) OS=Diplo N/A N/A 0.778 0.312 0.277 4e-49
P981604391 Basement membrane-specifi no N/A 0.786 0.095 0.269 2e-42
>sp|Q63HQ2|EGFLA_HUMAN Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 Back     alignment and function desciption
 Score =  255 bits (651), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 160/489 (32%), Positives = 240/489 (49%), Gaps = 71/489 (14%)

Query: 41   ECLEDKCNKTPCEHGGKCITTPGSSY-CLCPLGFTGDLCQTRLDLQVPQFNGS----SYL 95
            EC    C++  C HGG C      SY CLCPLGF G  C+    L +PQF  S    +  
Sbjct: 563  ECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDAFTLTIPQFRESLRSYAAT 622

Query: 96   RYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTG 155
             +    + YLS ++  I F+    +G+LLY+     G  DF+++ L   +V+F FD G+G
Sbjct: 623  PWPLEPQHYLSFMEFEITFRPDSGDGVLLYS--YDTGSKDFLSINLAGGHVEFRFDCGSG 680

Query: 156  AATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVP 215
               LRS +P++LG WH+LR++RT ++  LQVD+    + ++ G FTQ+  +  +++GGVP
Sbjct: 681  TGVLRSEDPLTLGNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVP 740

Query: 216  DYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCG-SGSCV 274
            +Y+ V     +   F G IQK+++N+  +++  +   GVNV N AHPC+  PC   GSC 
Sbjct: 741  NYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVNVENAAHPCVRAPCAHGGSCR 800

Query: 275  PLYDGYKCVCTQSCKESH------------LTEVMCASFDHGASFLHYLDPEIIHSSGLL 322
            P  +GY C C    +  H            + E +      G S+L Y +P+I+      
Sbjct: 801  PRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEIPQFIGRSYLTYDNPDILK----- 855

Query: 323  HYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSK---DFLALGIHNGYAHVMY 379
                      R++G   N+ MR KT++  GL+LW G S  +   DF++LG+ +G     Y
Sbjct: 856  ----------RVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSY 905

Query: 380  NLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHR 439
            NLG+G   +  N +  N+G WHR+                R  +S KI           R
Sbjct: 906  NLGSGVASIMVNGS-FNDGRWHRVKA-------------VRDGQSGKITVDDYGA----R 947

Query: 440  TGKQCLIRIDTDYSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLI 499
            TGK               S G   QLN +  LYVGG+++I   T  +Y     G IS+  
Sbjct: 948  TGK---------------SPGMMRQLNINGALYVGGMKEIALHTNRQYMRGLVGCISHFT 992

Query: 500  LSNDYQVKL 508
            LS DY + L
Sbjct: 993  LSTDYHISL 1001
Involved in both the retinal photoreceptor ribbon synapse formation and physiological functions of visual perception. Necessary for proper bipolar dendritic tip apposition to the photoreceptor ribbon synapse. Promotes matrix assembly and cell adhesiveness.
Homo sapiens (taxid: 9606)
>sp|A3KN33|EGFLA_BOVIN Pikachurin OS=Bos taurus GN=EGFLAM PE=2 SV=1 Back     alignment and function description
>sp|B4F785|EGFLA_RAT Pikachurin OS=Rattus norvegicus GN=Egflam PE=2 SV=1 Back     alignment and function description
>sp|Q4VBE4|EGFLA_MOUSE Pikachurin OS=Mus musculus GN=Egflam PE=1 SV=1 Back     alignment and function description
>sp|P25304|AGRIN_RAT Agrin OS=Rattus norvegicus GN=Agrn PE=1 SV=2 Back     alignment and function description
>sp|A2ASQ1|AGRIN_MOUSE Agrin OS=Mus musculus GN=Agrn PE=1 SV=1 Back     alignment and function description
>sp|O00468|AGRIN_HUMAN Agrin OS=Homo sapiens GN=AGRN PE=1 SV=5 Back     alignment and function description
>sp|P31696|AGRIN_CHICK Agrin OS=Gallus gallus GN=AGRN PE=1 SV=3 Back     alignment and function description
>sp|Q90404|AGRIN_DIPOM Agrin (Fragment) OS=Diplobatis ommata GN=AGRN PE=2 SV=1 Back     alignment and function description
>sp|P98160|PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens GN=HSPG2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query533
189239107 774 PREDICTED: similar to AGAP005165-PA [Tri 0.851 0.586 0.410 1e-117
345492856 805 PREDICTED: pikachurin-like [Nasonia vitr 0.806 0.534 0.428 1e-112
242004510 744 laminin gamma-3 chain, putative [Pedicul 0.808 0.579 0.435 1e-109
307180989 651 EGF-like, fibronectin type-III and lamin 0.825 0.675 0.410 1e-107
383852766 894 PREDICTED: pikachurin-like [Megachile ro 0.806 0.480 0.414 1e-107
350400577 896 PREDICTED: pikachurin-like [Bombus impat 0.851 0.506 0.436 1e-106
340713542 893 PREDICTED: pikachurin-like [Bombus terre 0.851 0.508 0.432 1e-106
380025122 903 PREDICTED: pikachurin-like [Apis florea] 0.851 0.502 0.432 1e-106
328780429 908 PREDICTED: pikachurin-like [Apis mellife 0.851 0.5 0.430 1e-106
270011220566 hypothetical protein TcasGA2_TC030664 [T 0.859 0.809 0.397 1e-102
>gi|189239107|ref|XP_001813157.1| PREDICTED: similar to AGAP005165-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  429 bits (1103), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/531 (41%), Positives = 324/531 (61%), Gaps = 77/531 (14%)

Query: 1   MVKSDNQVILDDWNTVRVFRHRWDAWIQLNDGNKIKGRSK--------------ECLEDK 46
           +V+S+  V+L+ WN + ++RHRWDAW+QLN G  ++GRSK              EC  D+
Sbjct: 283 VVRSEETVLLNQWNHITLYRHRWDAWLQLNSGKHVQGRSKGLFSRITFREPLFKECTADR 342

Query: 47  CNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLS 106
           C++ PC+HGGKC+T+  S+ CLCPLGF+GDLC+ R+DLQVP FNGSS+LRY+GLGE+ L+
Sbjct: 343 CSRVPCQHGGKCLTSEESAVCLCPLGFSGDLCEIRVDLQVPSFNGSSHLRYRGLGEEALT 402

Query: 107 LLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPIS 166
            LD  I  K   PNG++LYNGHR DG GDF+ALYL D Y++F +DLGTGA  + S + IS
Sbjct: 403 WLDFEITLKPTAPNGLVLYNGHRGDGFGDFMALYLRDGYMEFAYDLGTGAGFVTSQHRIS 462

Query: 167 LGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKI 226
           LGEWH++R++RTGR A L VD    S++LSPG FTQLSL L+LYLGGVP++ +VSP+V++
Sbjct: 463 LGEWHRVRVSRTGRLAILSVDNQLPSEVLSPGAFTQLSLPLNLYLGGVPNFGLVSPQVRV 522

Query: 227 KSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGS-GSCVPLYDGYKCVCT 285
           +++FIGC+Q V IN   + IL EA+ G NV NC HPCI +PCG  G CVP  D + C C 
Sbjct: 523 RAAFIGCVQMVRINGRTVPILAEALGGANVDNCPHPCIARPCGEDGECVPELDYFTCRCK 582

Query: 286 QSCKESHLTEVMCA----SFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNI 341
              ++      +CA    +F    S+LHY            +  F L     ++    ++
Sbjct: 583 PGYRDQ-----LCARGPPAFRGTDSYLHY------------NEAFTLEA---LSSDPLDV 622

Query: 342 DMRIKTSSSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWH 401
           ++R K +S SGL+LW  S     F++LG+  G   + + +   EV++ +N T +++ +WH
Sbjct: 623 NVRFKVASESGLLLWMNSGDGG-FMSLGLEAGALVLRFTVRGEEVVVVHNSTTVHDNLWH 681

Query: 402 RLTVHRN----FMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSI 457
           R+   R+     ++V +G + TR +    +E   +S+                       
Sbjct: 682 RVKAVRDRSSAVLIVDNGPALTRQS----VEIPPMSVS---------------------- 715

Query: 458 SGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKL 508
                  L  + GLYVGG+ +   L+ ++Y H  KG +++L+L+ DY++++
Sbjct: 716 -------LGENEGLYVGGMPNASLLSFTRYKHGIKGCVADLVLNTDYRLQV 759

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345492856|ref|XP_001600956.2| PREDICTED: pikachurin-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242004510|ref|XP_002423126.1| laminin gamma-3 chain, putative [Pediculus humanus corporis] gi|212506072|gb|EEB10388.1| laminin gamma-3 chain, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307180989|gb|EFN68763.1| EGF-like, fibronectin type-III and laminin G-like domain-containing protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383852766|ref|XP_003701896.1| PREDICTED: pikachurin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350400577|ref|XP_003485887.1| PREDICTED: pikachurin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713542|ref|XP_003395301.1| PREDICTED: pikachurin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380025122|ref|XP_003696328.1| PREDICTED: pikachurin-like [Apis florea] Back     alignment and taxonomy information
>gi|328780429|ref|XP_393275.4| PREDICTED: pikachurin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|270011220|gb|EFA07668.1| hypothetical protein TcasGA2_TC030664 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query533
FB|FBgn0034070 1361 SP2353 "SP2353" [Drosophila me 0.469 0.183 0.449 2.2e-94
UNIPROTKB|E1BQW41022 EGFLAM "Uncharacterized protei 0.677 0.353 0.339 2.5e-70
UNIPROTKB|Q63HQ21017 EGFLAM "Pikachurin" [Homo sapi 0.694 0.363 0.340 5.5e-69
UNIPROTKB|A3KN331018 EGFLAM "Pikachurin" [Bos tauru 0.673 0.352 0.329 2e-67
MGI|MGI:21461491017 Egflam "EGF-like, fibronectin 0.694 0.363 0.337 1.1e-65
UNIPROTKB|F1N606904 EGFLAM "Pikachurin" [Bos tauru 0.609 0.359 0.345 4.6e-57
RGD|13065921005 Egflam "EGF-like, fibronectin 0.793 0.420 0.320 1.8e-55
UNIPROTKB|F1LQ53963 Agrn "Agrin" [Rattus norvegicu 0.654 0.362 0.334 2.5e-54
RGD|20671959 Agrn "agrin" [Rattus norvegicu 0.455 0.124 0.380 1.7e-51
UNIPROTKB|I3LEG71020 EGFLAM "Uncharacterized protei 0.690 0.360 0.283 3.2e-51
FB|FBgn0034070 SP2353 "SP2353" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 619 (223.0 bits), Expect = 2.2e-94, Sum P(4) = 2.2e-94
 Identities = 116/258 (44%), Positives = 164/258 (63%)

Query:    32 GNKIKGRS-KECLEDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFN 90
             G+ I G   ++C  DKC + PC+HGGKC+ +   + CLCP+GF GDLC+ R+DLQVP FN
Sbjct:   567 GDVINGFDIQDCSTDKCVRYPCQHGGKCLPSDQGAICLCPIGFVGDLCEIRMDLQVPAFN 626

Query:    91 GSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNG--HRADGVGDFIALYLNDRYVDF 148
             GSS+LRY  LG+  L  L+L +  K  + +G++LY+G  HR    GDFIALYLND +V+F
Sbjct:   627 GSSFLRYAPLGDSALIWLELKVTLKPEQADGLILYSGPEHR----GDFIALYLNDGFVEF 682

Query:   149 TFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQXXXXXX 208
              FDLG+G A +RS + +SLG+WH ++++RT R A L+VD+      +S   F        
Sbjct:   683 AFDLGSGPALVRSEHSLSLGQWHTIKISRTARLAVLKVDKHQEVLTISSNGFWHLSLDQN 742

Query:   209 XXXGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPC 268
                GGV   + +   +K K  F+GCIQ++ IN H L I+ EA+ G N+ NC H C+ +PC
Sbjct:   743 LFVGGVNHVDRLPLDLKYKPFFVGCIQRIDINGHSLGIVAEALGGSNIGNCPHACVARPC 802

Query:   269 GS-GSCVPLYDGYKCVCT 285
             G    CVP  + Y+C C+
Sbjct:   803 GPLAECVPQMESYECRCS 820
GO:0003674 "molecular_function" evidence=ND
GO:0005615 "extracellular space" evidence=ISS
GO:0046716 "muscle cell homeostasis" evidence=IGI;IMP
GO:0042052 "rhabdomere development" evidence=IMP
UNIPROTKB|E1BQW4 EGFLAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q63HQ2 EGFLAM "Pikachurin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN33 EGFLAM "Pikachurin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2146149 Egflam "EGF-like, fibronectin type III and laminin G domains" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N606 EGFLAM "Pikachurin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306592 Egflam "EGF-like, fibronectin type III and laminin G domains" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ53 Agrn "Agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2067 Agrn "agrin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEG7 EGFLAM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query533
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 9e-35
smart00282132 smart00282, LamG, Laminin G domain 2e-31
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 9e-29
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 3e-28
smart00282132 smart00282, LamG, Laminin G domain 2e-27
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 6e-27
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 2e-23
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 2e-18
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-07
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 1e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-05
pfam0000832 pfam00008, EGF, EGF-like domain 1e-05
smart0018135 smart00181, EGF, Epidermal growth factor-like doma 0.002
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information 
 Score =  127 bits (321), Expect = 9e-35
 Identities = 57/152 (37%), Positives = 85/152 (55%), Gaps = 4/152 (2%)

Query: 89  FNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDF 148
           F+GSSY+R   L      L  ++  F+   PNG+LLY G      GDF+AL L D  +  
Sbjct: 4   FSGSSYVRLPTLPAPRTRL-SISFSFRTTSPNGLLLYAGS--QNGGDFLALELEDGRLVL 60

Query: 149 TFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLS 208
            +DLG+G+  L S  P++ G+WH + + R GR   L VD     +  SPG    L+L   
Sbjct: 61  RYDLGSGSLVLSSKTPLNDGQWHSVSVERNGRSVTLSVDGERVVESGSPGGSALLNLDGP 120

Query: 209 LYLGGVPDYNIVSPKVKIKSSFIGCIQKVLIN 240
           LYLGG+P+ ++ SP + +   F+GCI+ + +N
Sbjct: 121 LYLGGLPE-DLKSPGLPVSPGFVGCIRDLKVN 151

Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules. Length = 151
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information
>gnl|CDD|214544 smart00181, EGF, Epidermal growth factor-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 533
KOG4289|consensus 2531 100.0
KOG3516|consensus 1306 100.0
KOG3514|consensus 1591 100.0
KOG3514|consensus 1591 100.0
KOG3516|consensus 1306 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 99.95
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.9
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.89
smart00282135 LamG Laminin G domain. 99.88
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.87
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.85
smart00282135 LamG Laminin G domain. 99.84
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.82
KOG1219|consensus 4289 99.81
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.77
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 99.06
KOG3509|consensus 964 98.73
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 98.7
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.69
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 98.67
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 98.46
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.38
cd00152201 PTX Pentraxins are plasma proteins characterized b 98.24
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.21
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 98.21
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 98.2
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 98.18
cd00152201 PTX Pentraxins are plasma proteins characterized b 98.09
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 98.02
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 97.95
cd0005336 EGF Epidermal growth factor domain, found in epide 97.74
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 97.73
smart0018135 EGF Epidermal growth factor-like domain. 97.63
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.49
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 97.47
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.42
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.26
KOG3509|consensus964 97.24
smart00560133 LamGL LamG-like jellyroll fold domain. 97.14
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.1
cd0005336 EGF Epidermal growth factor domain, found in epide 97.07
smart0018135 EGF Epidermal growth factor-like domain. 96.79
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.47
smart00560133 LamGL LamG-like jellyroll fold domain. 96.3
KOG1834|consensus 952 96.1
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 95.87
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.69
KOG1836|consensus1705 95.24
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 94.99
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 94.45
PHA03099139 epidermal growth factor-like protein (EGF-like pro 94.43
PHA02887126 EGF-like protein; Provisional 94.01
KOG1834|consensus 952 93.26
PHA03099139 epidermal growth factor-like protein (EGF-like pro 93.11
PHA02887126 EGF-like protein; Provisional 92.95
PF1266224 cEGF: Complement Clr-like EGF-like 92.3
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 91.2
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 90.92
KOG1214|consensus1289 90.23
smart0005163 DSL delta serrate ligand. 90.12
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 90.06
KOG3546|consensus 1167 88.76
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 87.0
PF14099224 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 86.49
KOG3546|consensus 1167 85.99
KOG1225|consensus525 84.7
KOG1217|consensus487 84.24
KOG1217|consensus487 83.56
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 82.4
KOG1225|consensus525 81.04
>KOG4289|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-50  Score=429.83  Aligned_cols=397  Identities=25%  Similarity=0.533  Sum_probs=314.2

Q ss_pred             ceee-cCCCC--CCCCCCCCCCCCCeeeeCCCCceecCCCCCCCCCccccccc-------c-------------------
Q psy5025          35 IKGR-SKECL--EDKCNKTPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDL-------Q-------------------   85 (533)
Q Consensus        35 ~~G~-~~~C~--~d~C~~~pC~NggtC~~~~~~y~C~C~~g~~G~~Ce~~~~~-------~-------------------   85 (533)
                      ++|| +.-|+  +|.|-+.||.|+|+|....++|+|.|.++|+|.+||.+...       |                   
T Consensus      1227 PpGFTgd~CeTeiDlCYs~pC~nng~C~srEggYtCeCrpg~tGehCEvs~~agrCvpGvC~nggtC~~~~nggf~c~Cp 1306 (2531)
T KOG4289|consen 1227 PPGFTGDYCETEIDLCYSGPCGNNGRCRSREGGYTCECRPGFTGEHCEVSARAGRCVPGVCKNGGTCVNLLNGGFCCHCP 1306 (2531)
T ss_pred             CCCCCcccccchhHhhhcCCCCCCCceEEecCceeEEecCCccccceeeecccCccccceecCCCEEeecCCCceeccCC
Confidence            7888 88888  79999999999999999999999999999999999987421       1                   


Q ss_pred             ------------ccccCCceeEEEcCCcccccceeEEEEEEEecCCCeeEEEccccCCCCCCeEEEEEECCEEEEEEEcC
Q psy5025          86 ------------VPQFNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLG  153 (533)
Q Consensus        86 ------------~~~F~g~syl~~~~~~~~~~~~~~ls~~FrT~~~dGlLl~~~~~~~~~~~fl~l~L~~G~l~~~~~~g  153 (533)
                                  +.+|.+.||+.++.....+  +++++|+|.|...+|+|+|.|+.   +.||++|++.++++++.|+.|
T Consensus      1307 ~ge~e~prC~v~trSFp~~sfv~frglrqRf--h~TlslsfaT~~~nGlL~ynGne---khDFvalevVd~qvqltfS~G 1381 (2531)
T KOG4289|consen 1307 YGEFEDPRCEVTTRSFPPESFVTFRGLRQRF--HFTLSLSFATIERNGLLLYNGNE---KHDFVALEVVDEQVQLTFSAG 1381 (2531)
T ss_pred             CcccCCCceEEEeeccCchheEEEeccccce--EEEEEEEEEEeeecceEEecCCc---ccceEeeeeeeeeEEEEEecc
Confidence                        5579999999999876655  78999999999999999999954   499999999999999999999


Q ss_pred             CCceEEE--eeccccCCCcEEEEEEEECCEEEEEEcCccCcee-------------eCCCCceeeecCCCEEEcCcCCCC
Q psy5025         154 TGAATLR--SSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQI-------------LSPGPFTQLSLSLSLYLGGVPDYN  218 (533)
Q Consensus       154 ~~~~~v~--s~~~lnDg~Wh~V~v~~~~~~~~L~VD~~~~~~~-------------~~~~~~~~l~~~~~l~vGG~p~~~  218 (533)
                      ....++.  .+..++||+||+|.++..++.+.++||++.....             ...+....+++.+++++||+|...
T Consensus      1382 es~t~v~p~Vp~gvsDGqWHtV~l~YyNK~av~svDdCdt~~al~fg~~gNCAa~g~q~~sKKsLDltgpLlLGGvPe~f 1461 (2531)
T KOG4289|consen 1382 ESTTTVSPDVPGGVSDGQWHTVQLEYYNKVAVVSVDDCDTNVALRFGTIGNCAAQGTQTGSKKSLDLTGPLLLGGVPETF 1461 (2531)
T ss_pred             cccceecCCCCCCcccCceeEEEEEEeceEEEEEeccccccceeeecCccchHhhhhccCcceeeeccCceeecCCCCcc
Confidence            6665554  3578999999999999999999999999875432             223456678888999999999654


Q ss_pred             ccCCCcccccCceeeeeeEEECcEEcccccccccC-CCccCCC---CCCCCCCC-CCCeeeecCCceEEecCCCCCcCcc
Q psy5025         219 IVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQG-VNVVNCA---HPCITQPC-GSGSCVPLYDGYKCVCTQSCKESHL  293 (533)
Q Consensus       219 ~~~~~~~~~~~F~GCI~~l~in~~~l~~~~~~~~~-~~~~~C~---~~C~~~pC-ngg~C~~~~~~~~C~C~~g~~G~~c  293 (533)
                      .     .....|.|||+++.++++.+| ++..... ....+|+   +.|.+.+| |+|+|++.|++|.|+||.++.|..|
T Consensus      1462 p-----v~~k~FvGCmrdLsvD~~~VD-ma~fianngt~eGC~ark~fCdsg~C~n~g~CvnrWg~~~C~CP~~fggk~c 1535 (2531)
T KOG4289|consen 1462 P-----VIEKQFVGCMRDLSVDGRDVD-MATFIANNGTHEGCKARKNFCDSGQCSNGGTCVNRWGGFSCECPLGFGGKGC 1535 (2531)
T ss_pred             h-----hhHhHhhhhhhhccccccccc-HHHHHhhcCcccCchhhhcccCCCccCCCCeeecccCcEeecCccccCCcch
Confidence            2     233789999999999999999 4443332 2357894   78999999 9999999999999999999999888


Q ss_pred             cce--eeeeecCCCeeEEecCccccccccccceeeeeeeeeeecceeeEEEEEEEeCCCCeEEEEeccCCCCCeEEEEEE
Q psy5025         294 TEV--MCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTSSSSGLILWTGSSQSKDFLALGIH  371 (533)
Q Consensus       294 ~~~--~~~~f~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~rt~~~~g~ll~~~~~~~~~~l~l~l~  371 (533)
                      ...  .+-.| .|.|.+.+...+.                  ..+..+.++|.|||++.+|+|+.+...+. .-+.+.|.
T Consensus      1536 ~~~m~~pq~f-rG~sl~sw~~~~~------------------~vSvPwylsl~FRTr~ad~vl~~~~~~~r-st~~lqld 1595 (2531)
T KOG4289|consen 1536 CQGMAHPQHF-RGHSLVSWEGLPS------------------QVSVPWYLSLMFRTRRADGVLMQAEFGGR-STYNLQLD 1595 (2531)
T ss_pred             hhccCCchhc-cccceeeecCCCc------------------ceecceEEEEEEEeeccccEEEEEEeCCC-ceEEEEEc
Confidence            653  33455 7788777764433                  23567899999999999999999875554 44889999


Q ss_pred             CCEEEEEEEcCCceEEEeeCceeecCCCeEEEEEEEeeeeeecCCcccccCCcchhhhhhhhhccccccCcEEEEEECCc
Q psy5025         372 NGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTD  451 (533)
Q Consensus       372 ~g~l~~~~~~g~~~~~~~~~~~~~~dg~wH~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~vD~~  451 (533)
                      +|+|.+.+  +...  +.+...+++||+||++.+..                                ... ..++.|..
T Consensus      1596 ~g~l~~~v--~~s~--v~L~~~~vtdg~Wh~~~i~l--------------------------------~~d-~~~t~d~g 1638 (2531)
T KOG4289|consen 1596 DGTLKYNV--GDSS--VELPAPRVTDGHWHHLVIEL--------------------------------EAD-SVATLDYG 1638 (2531)
T ss_pred             CCEEEEEe--cCce--EEccCccccCCchhheeeee--------------------------------ccC-eEEEEech
Confidence            99987765  3333  34478899999999999998                                433 45555543


Q ss_pred             -eeeeEecCCcceeeccCCceEEcCCCCcccccccccccCceeeEEEEEEcCceEEeec
Q psy5025         452 -YSMQSISGGKFEQLNTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLP  509 (533)
Q Consensus       452 -~~~~~~~~~~~~~l~~~~~l~lGg~~~~~~~~~~~~~~~f~GCi~~l~i~~~~~l~~~  509 (533)
                       ....... + ...++..+ ||+||+|...      ...+|.|||+++++ ++...-.+
T Consensus      1639 ~~~aea~~-g-l~gl~l~s-l~vGgap~~g------~p~gf~GCiqgV~v-~g~~~l~~ 1687 (2531)
T KOG4289|consen 1639 IYQAEAKA-G-LSGLNLES-LYVGGAPATG------VPRGFRGCIQGVRV-GGVSILVP 1687 (2531)
T ss_pred             hhhhhhhc-C-CCCceeeE-EEEccccCCC------ccccchhhhhceEE-CCEeeccc
Confidence             2222111 1 33455554 9999999542      46799999999999 66655443

>KOG3516|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PF14099 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 3IKW_A 3INA_A 3IMN_A 3IN9_A 2ZZJ_A Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query533
3pve_A189 Crystal Structure Of The G2 Domain Of Agrin From Mu 3e-28
1q56_A195 Nmr Structure Of The B0 Isoform Of The Agrin G3 Dom 2e-13
1pz8_A201 Modulation Of Agrin Function By Alternative Splicin 1e-12
3sh4_A195 Laminin G Like Domain 3 From Human Perlecan Length 2e-12
3sh4_A195 Laminin G Like Domain 3 From Human Perlecan Length 3e-11
1pz7_A204 Modulation Of Agrin Function By Alternative Splicin 3e-12
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 4e-12
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 3e-08
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 6e-12
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 2e-07
3poy_A1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 8e-12
3asi_A410 Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns 1e-11
3v64_A191 Crystal Structure Of Agrin And Lrp4 Length = 191 7e-09
2h0b_A184 Crystal Structure Of The Second LnsLG DOMAIN FROM N 3e-07
2jd4_A383 Mouse Laminin Alpha1 Chain, Domains Lg4-5 Length = 3e-07
3bop_A175 Structure Of Mouse Beta-neurexin 2d4 Length = 175 2e-06
2wjs_A608 Crystal Structure Of The Lg1-3 Region Of The Lamini 2e-06
3mw4_A178 Crystal Structure Of Beta-Neurexin 3 Without The Sp 3e-06
3mw3_A208 Crystal Structure Of Beta-Neurexin 2 With The Splic 5e-06
2r1d_A226 Crystal Structure Of Rat Neurexin 1beta In The Ca2+ 5e-06
3biw_E243 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 5e-06
3vkf_C181 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 7e-06
1c4r_A182 The Structure Of The Ligand-Binding Domain Of Neure 7e-06
2wqz_C179 Crystal Structure Of Synaptic Protein Neuroligin-4 8e-06
3b3q_E197 Crystal Structure Of A Synaptic Adhesion Complex Le 9e-06
3bod_A178 Structure Of Mouse Beta-Neurexin 1 Length = 178 9e-06
2r1b_A220 Crystal Structure Of Rat Neurexin 1beta With A Spli 1e-05
3mw2_A207 Crystal Structure Of Beta-Neurexin 1 With The Splic 1e-05
4bdw_A85 The Stucture Of The Fni-egf Tandem Domain Of Coagul 9e-05
1dyk_A394 Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 39 9e-05
1dyk_A 394 Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 39 1e-04
2r16_A182 Crystal Structure Of Bovine Neurexin 1 Alpha LnsLG 1e-04
1okq_A394 Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site M 4e-04
>pdb|3PVE|A Chain A, Crystal Structure Of The G2 Domain Of Agrin From Mus Musculus Length = 189 Back     alignment and structure 
Iteration: 1

 Score =  123 bits (308), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 99/179 (55%), Gaps = 11/179 (6%)
Query: 89  FNGSSYLRYQGL-------GEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYL 141
           FNG SYL  +GL       GE+    + L +VF A  P+G+LLYNG + DG GDF++L L
Sbjct: 14  FNGFSYLELKGLHTFERDLGEK----MALEMVFLARGPSGLLLYNGQKTDGKGDFVSLAL 69
Query: 142 NDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFT 201
           ++R+++F +DLG GAA +RS  PI+LG W ++ L R GR   LQV   P     SP P T
Sbjct: 70  HNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPVPHT 129
Query: 202 QXXXXXXXXXGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILGEAIQGVNVVNCA 260
                     GG PD++ ++    + S F G IQ V +  H+L      ++ V+V   A
Sbjct: 130 MLNLKEPLYVGGAPDFSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVDVAPFA 188
>pdb|1Q56|A Chain A, Nmr Structure Of The B0 Isoform Of The Agrin G3 Domain In Its Ca2+ Bound State Length = 195 Back     alignment and structure
>pdb|1PZ8|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 201 Back     alignment and structure
>pdb|3SH4|A Chain A, Laminin G Like Domain 3 From Human Perlecan Length = 195 Back     alignment and structure
>pdb|3SH4|A Chain A, Laminin G Like Domain 3 From Human Perlecan Length = 195 Back     alignment and structure
>pdb|1PZ7|A Chain A, Modulation Of Agrin Function By Alternative Splicing And Ca2+ Binding Length = 204 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3ASI|A Chain A, Alpha-Neurexin-1 Ectodomain Fragment; Lns5-Egf3-Lns6 Length = 410 Back     alignment and structure
>pdb|3V64|A Chain A, Crystal Structure Of Agrin And Lrp4 Length = 191 Back     alignment and structure
>pdb|2H0B|A Chain A, Crystal Structure Of The Second LnsLG DOMAIN FROM NEUREXIN 1 ALPHA Length = 184 Back     alignment and structure
>pdb|2JD4|A Chain A, Mouse Laminin Alpha1 Chain, Domains Lg4-5 Length = 383 Back     alignment and structure
>pdb|3BOP|A Chain A, Structure Of Mouse Beta-neurexin 2d4 Length = 175 Back     alignment and structure
>pdb|2WJS|A Chain A, Crystal Structure Of The Lg1-3 Region Of The Laminin Alpha2 Chain Length = 608 Back     alignment and structure
>pdb|3MW4|A Chain A, Crystal Structure Of Beta-Neurexin 3 Without The Splice Insert 4 Length = 178 Back     alignment and structure
>pdb|3MW3|A Chain A, Crystal Structure Of Beta-Neurexin 2 With The Splice Insert 4 Length = 208 Back     alignment and structure
>pdb|2R1D|A Chain A, Crystal Structure Of Rat Neurexin 1beta In The Ca2+ Containing Form Length = 226 Back     alignment and structure
>pdb|3BIW|E Chain E, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 243 Back     alignment and structure
>pdb|3VKF|C Chain C, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 181 Back     alignment and structure
>pdb|1C4R|A Chain A, The Structure Of The Ligand-Binding Domain Of Neurexin 1beta: Regulation Of Lns Domain Function By Alternative Splicing Length = 182 Back     alignment and structure
>pdb|2WQZ|C Chain C, Crystal Structure Of Synaptic Protein Neuroligin-4 In Complex With Neurexin-beta 1: Alternative Refinement Length = 179 Back     alignment and structure
>pdb|3B3Q|E Chain E, Crystal Structure Of A Synaptic Adhesion Complex Length = 197 Back     alignment and structure
>pdb|3BOD|A Chain A, Structure Of Mouse Beta-Neurexin 1 Length = 178 Back     alignment and structure
>pdb|2R1B|A Chain A, Crystal Structure Of Rat Neurexin 1beta With A Splice Insert At Ss#4 Length = 220 Back     alignment and structure
>pdb|3MW2|A Chain A, Crystal Structure Of Beta-Neurexin 1 With The Splice Insert 4 Length = 207 Back     alignment and structure
>pdb|4BDW|A Chain A, The Stucture Of The Fni-egf Tandem Domain Of Coagulation Factor Xii In Complex With Holmium Length = 85 Back     alignment and structure
>pdb|1DYK|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 394 Back     alignment and structure
>pdb|1DYK|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair Length = 394 Back     alignment and structure
>pdb|2R16|A Chain A, Crystal Structure Of Bovine Neurexin 1 Alpha LnsLG DOMAIN 4 (With No Splice Insert) Length = 182 Back     alignment and structure
>pdb|1OKQ|A Chain A, Laminin Alpha 2 Chain Lg4-5 Domain Pair, Ca1 Site Mutant Length = 394 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query533
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-69
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 7e-31
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-23
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 8e-69
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 2e-35
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 7e-24
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 4e-68
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-39
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 8e-19
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-62
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-62
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-60
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-52
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-48
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-35
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 2e-57
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 2e-54
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 2e-28
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 1e-56
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 1e-27
3v64_A191 Low-density lipoprotein receptor-related protein; 5e-50
3v64_A191 Low-density lipoprotein receptor-related protein; 3e-30
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 8e-49
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 7e-22
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 2e-18
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 1e-48
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 3e-27
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 4e-44
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 6e-31
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 6e-41
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 4e-24
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 1e-40
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 1e-30
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 2e-33
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 3e-24
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 3e-32
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 2e-23
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 4e-32
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 5e-22
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 4e-32
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 1e-21
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-27
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 3e-18
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-08
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 6e-08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-08
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 6e-06
2vh0_B134 Activated factor XA light chain; serine protease, 1e-07
2vh0_B134 Activated factor XA light chain; serine protease, 2e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 7e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 8e-07
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 9e-07
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-06
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 5e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 5e-04
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 8e-06
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 1e-05
1nql_B53 Epidermal growth factor; cell surface receptor, ty 5e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-04
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 7e-05
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 7e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 6e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-04
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
 Score =  227 bits (581), Expect = 1e-69
 Identities = 69/469 (14%), Positives = 144/469 (30%), Gaps = 108/469 (23%)

Query: 50  TPCEHGGKCITTPGSSYCLCPLGFTGDLCQTRLDLQVPQFNGSSYLRYQGLGEQYLSLLD 109
            P    G C+     +       F                + +S++       +  + L 
Sbjct: 15  VPTMVHGPCVAESEPALLTGSKQFG--------------LSRNSHIAIAFDDTKVKNRLT 60

Query: 110 LTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGE 169
           + +  +    +G+L Y         DF  + L + +  F++DLG+G  +      I+ G+
Sbjct: 61  IELEVRTEAESGLLFYMARI--NHADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDGQ 118

Query: 170 WHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSS 229
           WHK+++ R  +   L VD   S  I SP     L +   LY+GG+P          +  S
Sbjct: 119 WHKIKIVRVKQEGILYVDDASSQTI-SPKKADILDVVGILYVGGLPINYTTRRIGPVTYS 177

Query: 230 FIGCIQKVLINNHELNILGEAIQGVNVVNCAHPCITQPCGSG-SCVPLYDGYKCVCTQSC 288
             GC++ + +    ++ L +     +V  C     +     G        G+K       
Sbjct: 178 LDGCVRNLHMEQAPVD-LDQPTSSFHVGTCFANAESGTYFDGTGFAKAVGGFK------- 229

Query: 289 KESHLTEVMCASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFRITGYEFNIDMRIKTS 348
                                                          G +  ++   +T+
Sbjct: 230 ----------------------------------------------VGLDLLVEFEFRTT 243

Query: 349 SSSGLILWTGSSQSKDFLALGIHNGYAHVMYNLGNGE---VLLENNQTKINNGVWHRLTV 405
             +G++L   S +  D + + + +       + G G    +        + NG WH++T 
Sbjct: 244 RPTGVLLGVSSQKM-DGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTA 302

Query: 406 HRNFMVVMHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGGKFEQL 465
            +                                   +  + +D +              
Sbjct: 303 KKI--------------------------------KNRLELVVDGNQVDAQSPNSASTSA 330

Query: 466 NTDSGLYVGGVEDIEELTRSKYHHSFKGWISNLILSNDYQVKLPLSRSQ 514
           +T+  ++VGG            +  F+G I +L L+      L ++ ++
Sbjct: 331 DTNDPVFVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAK 379
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Length = 58 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Length = 52 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query533
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 100.0
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 100.0
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 100.0
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 100.0
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 100.0
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.95
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.95
3v64_A191 Low-density lipoprotein receptor-related protein; 99.94
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.94
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.94
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.94
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.93
3v64_A191 Low-density lipoprotein receptor-related protein; 99.93
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.93
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.93
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.92
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.91
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.91
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.91
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.9
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.9
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.9
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.9
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.9
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.88
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.88
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.88
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.87
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.87
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.87
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 99.28
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.98
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.85
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.83
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.81
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.79
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.79
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.77
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.63
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.6
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 98.57
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.52
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.48
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 98.47
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 98.47
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 98.45
3pvn_A206 C-reactive protein; pentraxin family, immune syste 98.44
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 98.41
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.33
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 98.31
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 98.3
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.26
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.25
3pvn_A206 C-reactive protein; pentraxin family, immune syste 98.24
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.24
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.24
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.2
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 98.18
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 98.18
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.16
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 98.16
2vh0_B134 Activated factor XA light chain; serine protease, 98.12
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 98.12
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.11
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.1
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 98.09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.08
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.07
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.07
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.05
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 98.01
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.01
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 98.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.93
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.91
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 97.88
4dqa_A355 Uncharacterized protein; two domains structure, DU 97.84
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.83
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.82
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.8
4dqa_A355 Uncharacterized protein; two domains structure, DU 97.73
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.69
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.64
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.62
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.56
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 97.56
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.53
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.5
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 97.48
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.47
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.47
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 97.46
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.45
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 97.44
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 97.42
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 97.31
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.31
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 97.31
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 97.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.23
2i9a_A145 Urokinase-type plasminogen activator; growth facto 97.2
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.18
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 97.12
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.08
2bou_A143 EGF-like module containing mucin-like hormone rece 97.06
2bou_A143 EGF-like module containing mucin-like hormone rece 97.03
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.0
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.99
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.96
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 96.95
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.94
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 96.92
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.91
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 96.91
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.85
2vh0_B134 Activated factor XA light chain; serine protease, 96.84
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 96.84
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 96.8
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.77
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.77
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 96.61
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.6
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 96.59
1a8d_A 452 Tetanus neurotoxin; clostridial, ganglioside bindi 96.58
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.44
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.44
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 96.41
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 96.4
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 96.38
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.33
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 96.19
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 96.1
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 96.06
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.99
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 95.91
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 95.85
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 95.69
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 95.54
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 95.5
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.5
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 95.33
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 95.3
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 95.27
3v65_B386 Low-density lipoprotein receptor-related protein; 95.03
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 94.84
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 94.74
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 94.73
3v65_B386 Low-density lipoprotein receptor-related protein; 94.71
1szb_A170 Mannose binding lectin-associated serine protease- 94.7
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 94.54
1a8d_A452 Tetanus neurotoxin; clostridial, ganglioside bindi 94.47
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 94.39
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 94.14
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 94.04
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 93.62
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.56
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 93.4
1nzi_A159 Complement C1S component; calcium, innate immunity 93.2
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 93.15
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 92.94
3v0a_B 1196 NTNH; botulinum neurotoxin, toxin, neurotoxin asso 92.51
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 91.6
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 91.49
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 91.43
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 91.42
1epw_A 1290 Bontoxilysin B, botulinum neurotoxin type B; zinc, 90.56
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 90.16
2nyy_A 1295 Botulinum neurotoxin type A; neurotoxin, FAB, prot 90.02
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 89.82
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 89.79
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 88.3
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 87.83
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 87.63
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 87.61
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 87.52
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 87.24
4azz_A172 Levanase; hydrolase; 1.70A {Bacillus subtilis} 86.65
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 85.71
3rsj_A 413 BONT/F; clostridium botulinum type F, ganglioside 85.38
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 84.32
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 81.29
2nyy_A1295 Botulinum neurotoxin type A; neurotoxin, FAB, prot 80.77
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 80.7
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 80.18
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-55  Score=515.77  Aligned_cols=343  Identities=25%  Similarity=0.487  Sum_probs=267.2

Q ss_pred             eeEEEEEEEecCCCeeEEEccccCCCCCCeEEEEEECCEEEEEEEcCCCceEEE--eeccccCCCcEEEEEEEECC-EEE
Q psy5025         107 LLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLR--SSNPISLGEWHKLRLTRTGR-HAY  183 (533)
Q Consensus       107 ~~~ls~~FrT~~~dGlLl~~~~~~~~~~~fl~l~L~~G~l~~~~~~g~~~~~v~--s~~~lnDg~Wh~V~v~~~~~-~~~  183 (533)
                      .++|+|+|||.+++|+|||....   ..||++|+|.+|+|++.++.|+++..++  +...++||+||+|.+.+..+ ...
T Consensus       859 ~~~is~~frT~~~~GlLly~~~~---~~dfi~l~L~~G~l~~~~~~G~g~~~~~~~s~~~vnDg~WH~V~~~~~~~~~~~  935 (1245)
T 3qcw_A          859 SMHLFFQFKTTSLDGLILYNSGD---GNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHT  935 (1245)
T ss_dssp             CEEEEEEEECSCSCEEEEEEEES---TTCEEEEEEETTEEEEEEESSSCCEEEECCCSSCSCSSSCEEEEEEECTTCEEE
T ss_pred             eEEEEEEEEeCCCCEEEEEeCCC---CCCEEEEEEeCCEEEEEEECCCCcEEEEecCcccccCCCeEEEEEEEeCCeeEE
Confidence            57899999999999999998643   2799999999999999999998877665  67899999999999999886 467


Q ss_pred             EEEcCccCceeeCCCCceeeecCCCEEEcCcCCCCc--cCCCcccccCceeeeeeEEECcEEcccccccccC--CCccCC
Q psy5025         184 LQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNI--VSPKVKIKSSFIGCIQKVLINNHELNILGEAIQG--VNVVNC  259 (533)
Q Consensus       184 L~VD~~~~~~~~~~~~~~~l~~~~~l~vGG~p~~~~--~~~~~~~~~~F~GCI~~l~in~~~l~~~~~~~~~--~~~~~C  259 (533)
                      |.||+.......  .....++...++||||+|....  .+.......+|.|||++|+||++.+++...+...  ....+|
T Consensus       936 L~VD~~~~~~~~--~~~~~l~~~~~lylGG~p~~~~~~~~~~~~~~~~F~GCi~~l~ing~~~~l~~~~~~~~~~v~~gC 1013 (1245)
T 3qcw_A          936 VKIDTKITTQIT--AGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGC 1013 (1245)
T ss_dssp             EEETTEEEEEEC--CCCCCCCEEEEEEESCCCGGGGGGCCTTCCCSSBCCEEEEEEEETTBCCCTTTTCSEEESCEEESS
T ss_pred             EEECCEeeeecc--CCcceeccCCCeEECcccccchhhhcccccccCCcEEEeeeEEECCEEcccccchhccccceeeee
Confidence            999996433222  2234566677899999986421  2222334578999999999999987754433222  223578


Q ss_pred             C---CCCCCCCC-CCCeeeecCCceEEecC-CCCCcCcccceee-eeecCCCeeEEecCccccccccccceeeeeeeeee
Q psy5025         260 A---HPCITQPC-GSGSCVPLYDGYKCVCT-QSCKESHLTEVMC-ASFDHGASFLHYLDPEIIHSSGLLHYKFQLHVDFR  333 (533)
Q Consensus       260 ~---~~C~~~pC-ngg~C~~~~~~~~C~C~-~g~~G~~c~~~~~-~~f~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~  333 (533)
                      +   +.|.++|| |+|+|++.|++|.|+|+ ++|.|..|+.... ..|..+.+++.|......                +
T Consensus      1014 ~~~~~~C~~~pC~ngG~C~~~~~~~~C~C~~~g~~G~~C~~~~~~~~f~~~~~~v~y~~~~~~----------------~ 1077 (1245)
T 3qcw_A         1014 EGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPND----------------R 1077 (1245)
T ss_dssp             SCCCCCCCTTSSSSSCEEEEETTEEEEECTTSSCBSTTSCBCCCEEEEEEEEEEEEEECCTTC----------------C
T ss_pred             ecccCceECCcCCCCCEeCCCCCCCEEECCCCCCCCCCccCCCceEEEcCCCcEEEEecCCCC----------------c
Confidence            5   68999999 99999999999999999 5999999987543 345345678877644321                1


Q ss_pred             ecceeeEEEEEEEeCCCCeEEEEeccCC-CCCeEEEEEECCEEEEEEEcCCceEEEeeCceeecCCCeEEEEEEEeeeee
Q psy5025         334 ITGYEFNIDMRIKTSSSSGLILWTGSSQ-SKDFLALGIHNGYAHVMYNLGNGEVLLENNQTKINNGVWHRLTVHRNFMVV  412 (533)
Q Consensus       334 ~~~~~~~i~~~~rt~~~~g~ll~~~~~~-~~~~l~l~l~~g~l~~~~~~g~~~~~~~~~~~~~~dg~wH~v~~~~~~~~~  412 (533)
                      ......+|+|.|||++++|+||++.+.. ..+||+|+|.+|+|.+.+++|.+...+..+...++||+||+|++.|     
T Consensus      1078 ~~~~~~~i~l~FrT~~~~g~Ll~~~s~~~~~~~l~l~l~~G~l~~~~~~g~~~~~~~~~~~~v~DG~wH~V~i~r----- 1152 (1245)
T 3qcw_A         1078 PSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTR----- 1152 (1245)
T ss_dssp             CCBSEEEEEEEEEBCCSSEEEEEEEECTTCCCEEEEEEETTEEEEEEESSSCCEEEECCSCCCBSSSCEEEEEEE-----
T ss_pred             cccccceEEEEEEEcCCCeEEEEEeccCCCCceEEEEEECCEEEEEEECCCCceEEecCCcEecCCCeEEEEEEE-----
Confidence            1223468999999999999999986543 3699999999999999999998777666677889999999999999     


Q ss_pred             ecCCcccccCCcchhhhhhhhhccccccCcEEEEEECCceeeeEecCC-cceeeccCCceEEcCCCCcccccccccccCc
Q psy5025         413 MHGSSHTRSNKSSKIEFKCLSIQRLHRTGKQCLIRIDTDYSMQSISGG-KFEQLNTDSGLYVGGVEDIEELTRSKYHHSF  491 (533)
Q Consensus       413 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~vD~~~~~~~~~~~-~~~~l~~~~~l~lGg~~~~~~~~~~~~~~~f  491 (533)
                                                 .++.+.|+||+.........+ ....++....|||||.+.         ..+|
T Consensus      1153 ---------------------------~~~~~~l~VD~~~~~~~~~~g~~~~~~~~~~~l~lGg~~~---------~~~F 1196 (1245)
T 3qcw_A         1153 ---------------------------SGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQ---------GQPF 1196 (1245)
T ss_dssp             ---------------------------ETTEEEEEETTSCCEEECCCSCCCCCBCSEEEEEESSTTT---------TCCC
T ss_pred             ---------------------------CCCEEEEEECCeeeeeccCCcceeEEeccCceEEECCccC---------CCCC
Confidence                                       889999999998655433222 223455666799999764         2689


Q ss_pred             eeeEEEEEEcCceEEeeccc
Q psy5025         492 KGWISNLILSNDYQVKLPLS  511 (533)
Q Consensus       492 ~GCi~~l~i~~~~~l~~~~~  511 (533)
                      .|||++|++|+-.+|+++..
T Consensus      1197 ~Gcls~v~~n~~~pl~~a~~ 1216 (1245)
T 3qcw_A         1197 QGQLSGLYYNGLKVLNMAAE 1216 (1245)
T ss_dssp             CEEEEEEEETTBCHHHHHHT
T ss_pred             EEEEceEEECChHHHHHhhc
Confidence            99999999977777776554
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v0a_B NTNH; botulinum neurotoxin, toxin, neurotoxin associated protein, progenitor toxin complex, VHH bound interlocked complex; HET: MES; 2.70A {Clostridium botulinum} PDB: 3v0b_B Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1epw_A Bontoxilysin B, botulinum neurotoxin type B; zinc, metalloprotease, transmembrane, hydrolase; 1.90A {Clostridium botulinum} SCOP: b.29.1.6 b.42.4.2 d.92.1.7 h.4.2.1 PDB: 1f31_A* 1g9a_A* 1g9b_A* 1g9c_A* 1g9d_A* 1i1e_A* 1s0b_A 1s0c_A 1s0d_A 1s0e_A 1s0f_A 1s0g_A 2np0_A 3zuq_A 2etf_A 2xhl_A 1z0h_A 2nm1_A 3g94_A 1f82_A ... Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2nyy_A Botulinum neurotoxin type A; neurotoxin, FAB, protein antibody complex, toxin- system complex; 2.61A {Clostridium botulinum} PDB: 2nz9_A 3bta_A 3v0a_A* 3v0b_A 3v0c_A 3zus_A 3zur_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3rsj_A BONT/F; clostridium botulinum type F, ganglioside binding site, GD1A; HET: NGA GAL SIA; 2.00A {Clostridium botulinum} PDB: 3fuq_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2nyy_A Botulinum neurotoxin type A; neurotoxin, FAB, protein antibody complex, toxin- system complex; 2.61A {Clostridium botulinum} PDB: 2nz9_A 3bta_A 3v0a_A* 3v0b_A 3v0c_A 3zus_A 3zur_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 533
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 3e-33
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 9e-19
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 4e-29
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 7e-16
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 1e-28
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 1e-19
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 3e-24
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 4e-16
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 7e-24
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 1e-17
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 5e-19
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 3e-12
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 2e-18
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 2e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 9e-09
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 2e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-08
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-08
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 5e-08
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 5e-08
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 6e-08
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 6e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 8e-08
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 1e-07
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 2e-07
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 4e-07
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 0.001
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 2e-06
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 4e-05
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 5e-05
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 9e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 1e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 6e-04
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 0.001
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 0.002
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 0.002
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.004
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Agrin
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score =  123 bits (308), Expect = 3e-33
 Identities = 50/192 (26%), Positives = 88/192 (45%), Gaps = 16/192 (8%)

Query: 83  DLQVPQFNGSSYLRYQGLGEQYLSLLD--------------LTIVFKAIEPNGILLYNGH 128
           D +   F+G +Y+ Y     +    LD                +  K     G++L++G 
Sbjct: 5   DAEAIAFDGRTYMEYHNAVTKSPDALDYPAEPSEKALQSNHFELSIKTEATQGLILWSG- 63

Query: 129 RADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLGEWHKLRLTRTGRHAYLQVDR 188
           +     D+IAL + D +V   +DLG+    LRS+ PI+   W  ++  R  R   LQV  
Sbjct: 64  KGLERSDYIALAIVDGFVQMMYDLGSKPVVLRSTVPINTNHWTHIKAYRVQREGSLQVGN 123

Query: 189 FPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSP-KVKIKSSFIGCIQKVLINNHELNIL 247
                  SP   TQL    +L+LGG+   ++         + FIGCI+ V+++  EL+++
Sbjct: 124 EAPITGSSPLGATQLDTDGALWLGGMERLSVAHKLPKAYSTGFIGCIRDVIVDRQELHLV 183

Query: 248 GEAIQGVNVVNC 259
            +A+    +++C
Sbjct: 184 EDALNNPTILHC 195
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query533
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.93
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.93
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.92
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.92
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.92
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.9
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.89
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.89
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.88
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.87
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.86
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.86
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.81
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.77
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 99.34
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 99.3
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 99.3
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 99.27
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.26
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.23
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.17
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 99.14
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.13
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 99.11
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 99.09
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 99.03
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.99
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.94
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.92
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.91
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.9
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.89
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.81
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 98.76
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.68
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.65
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.65
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.62
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.62
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.57
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.56
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 98.36
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 98.36
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 98.24
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.22
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.17
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 98.14
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.13
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 98.12
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 98.1
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 98.07
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.83
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 97.76
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.69
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.65
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 97.52
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 97.49
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 97.27
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.23
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.22
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.17
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 97.09
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.06
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 96.97
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 96.95
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 96.93
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.9
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.8
d1nt0a345 Mannose-binding protein associated serine protease 96.71
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 96.68
d1szba245 Mannose-binding protein associated serine protease 96.63
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 96.62
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.53
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.25
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 96.06
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.73
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.72
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 95.68
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.62
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.27
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 94.35
d1i0ua241 Low density lipoprotein (LDL) receptor, different 94.06
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 92.51
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 92.47
d1szba245 Mannose-binding protein associated serine protease 90.86
d1nt0a345 Mannose-binding protein associated serine protease 90.75
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 90.65
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 88.29
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 88.13
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 87.76
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 87.16
d1ijqa250 Low density lipoprotein (LDL) receptor, different 87.05
d3bpse140 Low density lipoprotein (LDL) receptor, different 86.89
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 84.02
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 83.32
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 83.31
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.93  E-value=4.9e-25  Score=201.88  Aligned_cols=167  Identities=22%  Similarity=0.412  Sum_probs=135.7

Q ss_pred             cCCceeEEEcCCcccccceeEEEEEEEecCCCeeEEEccccCCCCCCeEEEEEECCEEEEEEEcCCCceEEEeeccccCC
Q psy5025          89 FNGSSYLRYQGLGEQYLSLLDLTIVFKAIEPNGILLYNGHRADGVGDFIALYLNDRYVDFTFDLGTGAATLRSSNPISLG  168 (533)
Q Consensus        89 F~g~syl~~~~~~~~~~~~~~ls~~FrT~~~dGlLl~~~~~~~~~~~fl~l~L~~G~l~~~~~~g~~~~~v~s~~~lnDg  168 (533)
                      +.++||+.++.........++|+|+|||.+++|+|||.+...  ..+|++|+|.+|+|++.++.|++...+.++..++||
T Consensus        21 ~s~~s~~~~~~~~~~~~~~~~i~~~frT~~~~GlL~~~~~~~--~~dfi~l~l~~G~l~~~~~~g~~~~~~~~~~~v~Dg   98 (189)
T d1dyka1          21 LSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARIN--HADFATVQLRNGFPYFSYDLGSGDTSTMIPTKINDG   98 (189)
T ss_dssp             SSTTCEEEEECCGGGGSSEEEEEEEEEECCSCEEEEEEECTT--SSSEEEEEEETTEEEEEEESSSCEEEEECCSCCCSS
T ss_pred             CCCCceEEEecCcccccccEEEEEEEEECCCCEEEEEEcCCC--CCcEEEEEEECCEEEEEEECCCccEEecCCcEeeCC
Confidence            367899999876555556789999999999999999987643  378999999999999999999888888888899999


Q ss_pred             CcEEEEEEEECCEEEEEEcCccCceeeCCCCceeeecCCCEEEcCcCCCCccCCCcccccCceeeeeeEEECcEEccccc
Q psy5025         169 EWHKLRLTRTGRHAYLQVDRFPSSQILSPGPFTQLSLSLSLYLGGVPDYNIVSPKVKIKSSFIGCIQKVLINNHELNILG  248 (533)
Q Consensus       169 ~Wh~V~v~~~~~~~~L~VD~~~~~~~~~~~~~~~l~~~~~l~vGG~p~~~~~~~~~~~~~~F~GCI~~l~in~~~l~~~~  248 (533)
                      +||+|.+.+.+..+.|.||+.... ...+.....++....+||||+|.............+|.|||++++||+++++ +.
T Consensus        99 ~WH~V~v~~~~~~~~l~VD~~~~~-~~~~~~~~~l~~~~~lyiGG~p~~~~~~~~~~~~~~F~GCi~~v~in~~~~~-L~  176 (189)
T d1dyka1          99 QWHKIKIVRVKQEGILYVDDASSQ-TISPKKADILDVVGILYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVD-LD  176 (189)
T ss_dssp             SCEEEEEEEETTEEEEEETTEEEE-EECSTTCCCCCCCSEEEESSCCTTCCCCSSCSCCSBCSEEEEEEEESSSCCC-TT
T ss_pred             CEEEEEEEEcccEEEEEECCccee-eEccCcccccccccceEEecccccccccccCcCCCCcEEEEeEEEECCEEec-CC
Confidence            999999999999999999996533 3344455566677889999999765544434456789999999999999998 55


Q ss_pred             ccccCCCccCC
Q psy5025         249 EAIQGVNVVNC  259 (533)
Q Consensus       249 ~~~~~~~~~~C  259 (533)
                      ++....++..|
T Consensus       177 ~~~~~~~V~~C  187 (189)
T d1dyka1         177 QPTSSFHVGTC  187 (189)
T ss_dssp             SCSEEESCBCC
T ss_pred             CcccCCCccCc
Confidence            55555555444
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure