Psyllid ID: psy5031


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MKKEVDLKMGGDFEEDSLPQYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
cccccccccccccccccccccccEEEEEEcccccEEEcHHHHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHHccccEEcccccEEEEccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccccccccEEEEEEccEEEEcccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc
cccEEEEccccccccccccccccEEEEEEcccccEEccHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccHHHcccEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccEEEccccccccEEEEEEccEEEEEcccccEEEEEEEEccccccccccHHHHHEEEHHHHHHcHEEEEEccHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEcc
mkkevdlkmggdfeedslpqygaiQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFtyieeapsgdwmgpddvplegfswrggserdttgILMWSHVYIAtlptgekvsaFRKGKSFLLDFLLRYMNFtyieeapsgdwmgpddvplegfswrggserdttgILMWSHVYIATLPTGEKAAVILLDtqgtfdsestvRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLaladtgtkpfqrlqfl
mkkevdlkmggdfeedslpqyGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEeapsgdwmgpdDVPLEGFSWRGGSERDTTGILMWSHVYIATLptgekvsaFRKGKSFLLDFLLRYMNFTYIEeapsgdwmgpdDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTqgtfdsestvRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
MKKEVDLKMGGDFEEDSLPQYGAIQIVKSEEKHKFILDYEALERILLQdhvkdkhvvvvSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
*******************QYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADT***********
************************QIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIE**********DDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTY*******************FSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
MKKEVDLKMGGDFEEDSLPQYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
**************EDSLPQYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIE*APSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYI****SGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKEVDLKMGGDFEEDSLPQYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
Q9VC57 541 Atlastin OS=Drosophila me yes N/A 0.516 0.268 0.787 5e-63
Q58D72 558 Atlastin-1 OS=Bos taurus yes N/A 0.501 0.252 0.698 7e-54
Q60HD2 558 Atlastin-1 OS=Macaca fasc N/A N/A 0.501 0.252 0.705 1e-53
Q5R4P1 558 Atlastin-1 OS=Pongo abeli no N/A 0.501 0.252 0.698 2e-53
Q8WXF7 558 Atlastin-1 OS=Homo sapien yes N/A 0.501 0.252 0.698 2e-53
Q6PA06 583 Atlastin-2 OS=Mus musculu yes N/A 0.569 0.274 0.606 2e-53
Q95LN3 565 Atlastin-2 OS=Macaca fasc N/A N/A 0.569 0.283 0.606 2e-53
Q6GN29 569 Atlastin-2 OS=Xenopus lae N/A N/A 0.565 0.279 0.612 2e-53
Q8NHH9 583 Atlastin-2 OS=Homo sapien no N/A 0.569 0.274 0.606 3e-53
Q91YH5 541 Atlastin-3 OS=Mus musculu no N/A 0.601 0.312 0.584 2e-52
>sp|Q9VC57|ATLAS_DROME Atlastin OS=Drosophila melanogaster GN=atl PE=1 SV=1 Back     alignment and function desciption
 Score =  241 bits (614), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/146 (78%), Positives = 126/146 (86%), Gaps = 1/146 (0%)

Query: 136 AFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHV 195
           AFRKGKSFLLDF LRYM   Y+    + DW+G +  PLEGFSWRGGSERDTTGILMWS +
Sbjct: 46  AFRKGKSFLLDFFLRYMYSKYVHHDAT-DWLGGESDPLEGFSWRGGSERDTTGILMWSDI 104

Query: 196 YIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQH 255
           ++   P G+K A+ILLDTQG FDS+STVRDCATVFALSTMLSS+QIYNLSQNIQEDDLQH
Sbjct: 105 FLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQH 164

Query: 256 LQLFTEYGRLALADTGTKPFQRLQFL 281
           LQLFTEYGRLALADTG KPFQRLQFL
Sbjct: 165 LQLFTEYGRLALADTGKKPFQRLQFL 190




GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis. May also regulate microtubule polymerization and Golgi biogenesis. Required for dopaminergic neurons survival and the growth of muscles and synapses at neuromuscular junctions.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 5EC: .EC: -
>sp|Q58D72|ATLA1_BOVIN Atlastin-1 OS=Bos taurus GN=ATL1 PE=2 SV=2 Back     alignment and function description
>sp|Q60HD2|ATLA1_MACFA Atlastin-1 OS=Macaca fascicularis GN=ATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R4P1|ATLA1_PONAB Atlastin-1 OS=Pongo abelii GN=ATL1 PE=2 SV=2 Back     alignment and function description
>sp|Q8WXF7|ATLA1_HUMAN Atlastin-1 OS=Homo sapiens GN=ATL1 PE=1 SV=1 Back     alignment and function description
>sp|Q6PA06|ATLA2_MOUSE Atlastin-2 OS=Mus musculus GN=Atl2 PE=1 SV=1 Back     alignment and function description
>sp|Q95LN3|ATLA2_MACFA Atlastin-2 OS=Macaca fascicularis GN=ATL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6GN29|ATLA2_XENLA Atlastin-2 OS=Xenopus laevis GN=atl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8NHH9|ATLA2_HUMAN Atlastin-2 OS=Homo sapiens GN=ATL2 PE=1 SV=2 Back     alignment and function description
>sp|Q91YH5|ATLA3_MOUSE Atlastin-3 OS=Mus musculus GN=Atl3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
351702031 606 Atlastin-3 [Heterocephalus glaber] 0.911 0.422 0.565 5e-80
157134123 548 atlastin [Aedes aegypti] gi|108881409|gb 0.612 0.313 0.686 4e-63
289740431 538 guanylate-binding protein [Glossina mors 0.612 0.319 0.686 2e-62
345498404 588 PREDICTED: atlastin-like isoform 1 [Naso 0.519 0.248 0.787 4e-62
170045221 527 atlastin [Culex quinquefasciatus] gi|167 0.612 0.326 0.680 5e-62
340714459 603 PREDICTED: atlastin-like isoform 1 [Bomb 0.519 0.242 0.773 7e-62
307213647 659 Atlastin-2 [Harpegnathos saltator] 0.516 0.220 0.787 8e-62
332016235 656 Atlastin [Acromyrmex echinatior] 0.519 0.222 0.787 8e-62
189239475 560 PREDICTED: similar to AGAP002047-PA [Tri 0.519 0.260 0.767 9e-62
350399193 603 PREDICTED: atlastin-like isoform 2 [Bomb 0.519 0.242 0.773 1e-61
>gi|351702031|gb|EHB04950.1| Atlastin-3 [Heterocephalus glaber] Back     alignment and taxonomy information
 Score =  303 bits (776), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 155/274 (56%), Positives = 196/274 (71%), Gaps = 18/274 (6%)

Query: 22  GAIQIV-KSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYM 80
           G +Q+V   +++H F L+ +AL  ILLQDH++D  VVVVSVAGAFRKGKSF+LDF+LRY+
Sbjct: 7   GPVQVVLVHKDQHSFELEEKALASILLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYL 66

Query: 81  NFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEK------- 133
                +E    +W+G  + PL GFSWRGGS+ +TTGI +WS V+    P G+K       
Sbjct: 67  YSQ--KEGGHSNWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVEKPGGKKDHIRDLD 124

Query: 134 ------VSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTT 187
                   AFRKGKSF+LDF+LRY+     +E    +W+G  + PL GFSWRGGS+ +TT
Sbjct: 125 VVVVSVAGAFRKGKSFILDFMLRYLYSQ--KEGGHSNWLGDPEEPLTGFSWRGGSDPETT 182

Query: 188 GILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQN 247
           GI +WS V+    P G+K AV+L+DTQG FDS+STV+DCAT+FALSTM SS+QIYNLSQN
Sbjct: 183 GIQIWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQN 242

Query: 248 IQEDDLQHLQLFTEYGRLALADTGTKPFQRLQFL 281
           IQEDDLQ LQLFTEYGRLA+ +   KPFQ L FL
Sbjct: 243 IQEDDLQQLQLFTEYGRLAMDEIFQKPFQTLMFL 276




Source: Heterocephalus glaber

Species: Heterocephalus glaber

Genus: Heterocephalus

Family: Bathyergidae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|157134123|ref|XP_001663157.1| atlastin [Aedes aegypti] gi|108881409|gb|EAT45634.1| AAEL003109-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|289740431|gb|ADD18963.1| guanylate-binding protein [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|345498404|ref|XP_001607339.2| PREDICTED: atlastin-like isoform 1 [Nasonia vitripennis] gi|345498406|ref|XP_003428223.1| PREDICTED: atlastin-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170045221|ref|XP_001850215.1| atlastin [Culex quinquefasciatus] gi|167868202|gb|EDS31585.1| atlastin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340714459|ref|XP_003395746.1| PREDICTED: atlastin-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307213647|gb|EFN89021.1| Atlastin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332016235|gb|EGI57148.1| Atlastin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189239475|ref|XP_975363.2| PREDICTED: similar to AGAP002047-PA [Tribolium castaneum] gi|270010557|gb|EFA07005.1| hypothetical protein TcasGA2_TC009975 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350399193|ref|XP_003485450.1| PREDICTED: atlastin-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
FB|FBgn0039213 541 atl "atlastin" [Drosophila mel 0.516 0.268 0.787 1.2e-58
UNIPROTKB|Q58D72 558 ATL1 "Atlastin-1" [Bos taurus 0.501 0.252 0.698 8.3e-51
UNIPROTKB|F1SHX5 558 ATL1 "Uncharacterized protein" 0.501 0.252 0.705 1.1e-50
UNIPROTKB|F1NAM6 546 ATL1 "Uncharacterized protein" 0.501 0.258 0.705 1.1e-50
UNIPROTKB|Q60HD2 558 ATL1 "Atlastin-1" [Macaca fasc 0.501 0.252 0.705 1.1e-50
UNIPROTKB|F8WD04 558 ATL1 "Atlastin-1" [Homo sapien 0.501 0.252 0.698 1.3e-50
UNIPROTKB|Q8WXF7 558 ATL1 "Atlastin-1" [Homo sapien 0.501 0.252 0.698 1.3e-50
UNIPROTKB|Q5R4P1 558 ATL1 "Atlastin-1" [Pongo abeli 0.501 0.252 0.698 1.3e-50
ZFIN|ZDB-GENE-030131-6505 624 atl2 "atlastin GTPase 2" [Dani 0.569 0.256 0.630 3.6e-50
UNIPROTKB|E2R653 561 E2R653 "Uncharacterized protei 0.501 0.251 0.698 4.6e-50
FB|FBgn0039213 atl "atlastin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 602 (217.0 bits), Expect = 1.2e-58, P = 1.2e-58
 Identities = 115/146 (78%), Positives = 126/146 (86%)

Query:   136 AFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHV 195
             AFRKGKSFLLDF LRYM   Y+    + DW+G +  PLEGFSWRGGSERDTTGILMWS +
Sbjct:    46 AFRKGKSFLLDFFLRYMYSKYVHHDAT-DWLGGESDPLEGFSWRGGSERDTTGILMWSDI 104

Query:   196 YIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQH 255
             ++   P G+K A+ILLDTQG FDS+STVRDCATVFALSTMLSS+QIYNLSQNIQEDDLQH
Sbjct:   105 FLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQH 164

Query:   256 LQLFTEYGRLALADTGTKPFQRLQFL 281
             LQLFTEYGRLALADTG KPFQRLQFL
Sbjct:   165 LQLFTEYGRLALADTGKKPFQRLQFL 190


GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0008582 "regulation of synaptic growth at neuromuscular junction" evidence=IMP
GO:0031114 "regulation of microtubule depolymerization" evidence=IMP
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0003924 "GTPase activity" evidence=IMP;IDA
GO:0016320 "endoplasmic reticulum membrane fusion" evidence=IDA;IMP
GO:0031227 "intrinsic to endoplasmic reticulum membrane" evidence=IDA
GO:0061025 "membrane fusion" evidence=IDA
GO:0032561 "guanyl ribonucleotide binding" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IMP
UNIPROTKB|Q58D72 ATL1 "Atlastin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHX5 ATL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAM6 ATL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q60HD2 ATL1 "Atlastin-1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|F8WD04 ATL1 "Atlastin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXF7 ATL1 "Atlastin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4P1 ATL1 "Atlastin-1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6505 atl2 "atlastin GTPase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R653 E2R653 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58D72ATLA1_BOVIN3, ., 6, ., 5, ., -0.69860.50170.2526yesN/A
Q8WXF7ATLA1_HUMAN3, ., 6, ., 5, ., -0.69860.50170.2526yesN/A
Q6PA06ATLA2_MOUSE3, ., 6, ., 5, ., -0.60600.56930.2744yesN/A
Q9VC57ATLAS_DROME3, ., 6, ., 5, ., -0.78760.51600.2680yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
pfam02263 264 pfam02263, GBP, Guanylate-binding protein, N-termi 3e-55
cd01851224 cd01851, GBP, Guanylate-binding protein (GBP) fami 1e-36
pfam02263264 pfam02263, GBP, Guanylate-binding protein, N-termi 1e-23
cd01851224 cd01851, GBP, Guanylate-binding protein (GBP) fami 7e-14
>gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain Back     alignment and domain information
 Score =  179 bits (455), Expect = 3e-55
 Identities = 51/161 (31%), Positives = 71/161 (44%), Gaps = 38/161 (23%)

Query: 134 VSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWS 193
           V  +R GKS+L++FL                        L GFS     E +T GI MW 
Sbjct: 27  VGLYRTGKSYLMNFLAG---------------------KLTGFSLGSTVESETKGIWMWC 65

Query: 194 HVYIATLPTGEKAAVILLDTQGTFD-SESTVRDCATVFALSTMLSSIQIYNLSQNIQEDD 252
             +    P   K  ++LLDT+G  D  +S  ++ A +FAL+T+LSS  +YN SQ I +  
Sbjct: 66  VPH----PNKPKHTLVLLDTEGLGDVEKSDPKNDAWIFALATLLSSTFVYNSSQTINQQA 121

Query: 253 LQHLQLFTE------------YGRLALADTGTKPFQRLQFL 281
           LQ L L TE            YGR+A +      F    + 
Sbjct: 122 LQQLHLVTELTELIRAKSSPRYGRVADSAEFVSFFPDFVWT 162


Transcription of the anti-viral guanylate-binding protein (GBP) is induced by interferon-gamma during macrophage induction. This family contains GBP1 and GPB2, both GTPases capable of binding GTP, GDP and GMP. Length = 264

>gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) Back     alignment and domain information
>gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
PF02263 260 GBP: Guanylate-binding protein, N-terminal domain; 100.0
KOG2037|consensus 552 100.0
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 99.97
KOG2203|consensus 772 99.31
KOG2037|consensus 552 99.28
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 98.86
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 97.7
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 97.65
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.39
COG1159298 Era GTPase [General function prediction only] 97.14
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 97.02
PRK00089292 era GTPase Era; Reviewed 96.98
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 96.73
KOG4181|consensus491 96.5
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.43
TIGR00436270 era GTP-binding protein Era. Era is an essential G 96.42
PF05879 742 RHD3: Root hair defective 3 GTP-binding protein (R 96.21
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 96.18
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 96.04
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 96.01
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 96.01
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 96.01
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 95.98
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 95.94
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 95.92
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.74
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.72
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 95.63
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 95.56
PRK12289352 GTPase RsgA; Reviewed 95.54
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 95.45
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 95.38
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 95.35
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.22
PRK12288347 GTPase RsgA; Reviewed 95.21
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.21
PRK12298390 obgE GTPase CgtA; Reviewed 95.05
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 94.93
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 94.84
KOG1423|consensus379 94.81
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 94.79
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 94.74
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 94.73
PRK09563287 rbgA GTPase YlqF; Reviewed 94.68
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 94.67
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 94.64
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 94.6
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 94.54
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 94.45
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.41
PRK15494339 era GTPase Era; Provisional 94.37
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.36
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 94.3
PRK00098298 GTPase RsgA; Reviewed 94.2
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 94.2
PRK05480209 uridine/cytidine kinase; Provisional 94.1
cd04171164 SelB SelB subfamily. SelB is an elongation factor 94.09
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 94.04
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.0
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.95
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 93.94
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 93.89
PRK08233182 hypothetical protein; Provisional 93.86
PTZ00301210 uridine kinase; Provisional 93.85
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 93.84
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 93.83
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 93.77
PRK06696223 uridine kinase; Validated 93.75
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 93.73
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 93.73
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 93.73
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 93.7
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 93.69
PRK09270229 nucleoside triphosphate hydrolase domain-containin 93.68
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 93.68
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.66
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 93.65
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 93.61
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.56
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 93.56
COG1084346 Predicted GTPase [General function prediction only 93.43
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 93.39
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 93.37
PRK07667193 uridine kinase; Provisional 93.34
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 93.3
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 93.3
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.29
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 93.27
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 93.25
PRK00093 435 GTP-binding protein Der; Reviewed 93.21
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 93.16
PF13173128 AAA_14: AAA domain 93.07
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 93.04
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.03
cd01878204 HflX HflX subfamily. A distinct conserved domain w 93.02
PLN03118211 Rab family protein; Provisional 93.01
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.01
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 93.0
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 92.99
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 92.89
cd00154159 Rab Rab family. Rab GTPases form the largest famil 92.79
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.77
PLN02318 656 phosphoribulokinase/uridine kinase 92.77
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 92.66
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 92.64
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 92.64
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.63
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.59
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 92.57
COG1161322 Predicted GTPases [General function prediction onl 92.56
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 92.49
cd00876160 Ras Ras family. The Ras family of the Ras superfam 92.48
smart00382148 AAA ATPases associated with a variety of cellular 92.45
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 92.44
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 92.41
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 92.34
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 92.33
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 92.3
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 92.29
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.28
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.26
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 92.26
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 92.23
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 92.21
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 92.2
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 92.2
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 92.18
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 92.17
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 92.17
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 92.16
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 92.15
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 92.14
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 92.1
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 92.09
PRK00300205 gmk guanylate kinase; Provisional 92.09
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 92.09
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 92.07
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 92.07
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.01
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 92.01
cd03269210 ABC_putative_ATPase This subfamily is involved in 92.01
CHL00071 409 tufA elongation factor Tu 92.0
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 91.99
PRK05439311 pantothenate kinase; Provisional 91.98
cd00881189 GTP_translation_factor GTP translation factor fami 91.97
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 91.96
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 91.94
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 91.92
PRK14241258 phosphate transporter ATP-binding protein; Provisi 91.91
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 91.9
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 91.88
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 91.85
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 91.85
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 91.8
cd04123162 Rab21 Rab21 subfamily. The localization and functi 91.79
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 91.79
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 91.79
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 91.78
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 91.77
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 91.77
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 91.76
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 91.76
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 91.75
PF1355562 AAA_29: P-loop containing region of AAA domain 91.74
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 91.74
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 91.73
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 91.72
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 91.71
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 91.7
PRK09087226 hypothetical protein; Validated 91.67
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 91.61
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 91.6
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 91.6
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 91.6
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.58
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 91.58
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.55
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 91.54
PRK14242253 phosphate transporter ATP-binding protein; Provisi 91.52
COG4240300 Predicted kinase [General function prediction only 91.51
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 91.5
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 91.48
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 91.46
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 91.45
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 91.42
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 91.42
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 91.4
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 91.38
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 91.38
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 91.36
PRK00454196 engB GTP-binding protein YsxC; Reviewed 91.36
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 91.36
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 91.36
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 91.34
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.3
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 91.29
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 91.28
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 91.28
PRK14239252 phosphate transporter ATP-binding protein; Provisi 91.27
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 91.24
PRK03003 472 GTP-binding protein Der; Reviewed 91.23
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 91.22
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.22
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.2
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 91.15
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 91.14
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 91.12
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 91.11
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.09
cd03246173 ABCC_Protease_Secretion This family represents the 91.08
PRK12736 394 elongation factor Tu; Reviewed 91.07
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 91.07
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 91.04
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 91.02
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 90.99
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 90.99
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 90.96
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 90.95
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 90.93
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 90.93
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 90.9
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 90.89
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 90.88
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 90.87
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 90.86
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.86
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 90.84
PLN03110216 Rab GTPase; Provisional 90.79
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 90.78
PLN02796347 D-glycerate 3-kinase 90.77
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 90.77
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 90.73
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 90.73
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 90.72
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 90.7
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 90.68
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 90.66
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 90.66
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 90.65
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 90.65
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 90.64
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 90.64
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 90.61
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 90.61
cd03116159 MobB Molybdenum is an essential trace element in t 90.61
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 90.58
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 90.56
PRK10908222 cell division protein FtsE; Provisional 90.55
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 90.54
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 90.54
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 90.54
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 90.53
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 90.52
PRK06547172 hypothetical protein; Provisional 90.51
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 90.5
cd03234226 ABCG_White The White subfamily represents ABC tran 90.48
COG3596296 Predicted GTPase [General function prediction only 90.46
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 90.45
PRK14240250 phosphate transporter ATP-binding protein; Provisi 90.43
PRK14235267 phosphate transporter ATP-binding protein; Provisi 90.41
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 90.4
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 90.39
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 90.38
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 90.37
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 90.35
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 90.34
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 90.32
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 90.31
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 90.29
cd03215182 ABC_Carb_Monos_II This family represents domain II 90.26
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 90.24
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 90.23
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 90.22
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 90.22
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 90.22
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 90.21
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 90.21
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 90.16
PF00004132 AAA: ATPase family associated with various cellula 90.16
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 90.15
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 90.07
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 90.07
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 90.06
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 90.06
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 90.05
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 90.03
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 90.02
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 90.01
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 90.01
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 90.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 89.98
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 89.96
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 89.96
PRK07261171 topology modulation protein; Provisional 89.96
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 89.91
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 89.91
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 89.88
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 89.88
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 89.86
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 89.86
PRK09825176 idnK D-gluconate kinase; Provisional 89.86
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 89.86
PRK12735 396 elongation factor Tu; Reviewed 89.85
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 89.84
TIGR00101199 ureG urease accessory protein UreG. This model rep 89.84
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 89.83
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 89.83
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 89.82
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 89.79
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 89.78
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 89.77
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 89.76
KOG1547|consensus 336 89.75
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 89.73
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 89.73
PRK09984262 phosphonate/organophosphate ester transporter subu 89.72
PRK00698205 tmk thymidylate kinase; Validated 89.71
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 89.7
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 89.7
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 89.7
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 89.69
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 89.69
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 89.68
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 89.68
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 89.67
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 89.64
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 89.63
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 89.62
PRK09580248 sufC cysteine desulfurase ATPase component; Review 89.61
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 89.6
COG4559259 ABC-type hemin transport system, ATPase component 89.59
PRK14237267 phosphate transporter ATP-binding protein; Provisi 89.58
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 89.57
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 89.53
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 89.52
PRK06762166 hypothetical protein; Provisional 89.52
cd01896233 DRG The developmentally regulated GTP-binding prot 89.5
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 89.46
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 89.46
PLN02348 395 phosphoribulokinase 89.46
COG4136213 ABC-type uncharacterized transport system, ATPase 89.44
PRK14238271 phosphate transporter ATP-binding protein; Provisi 89.44
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 89.42
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 89.41
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 89.4
PRK14243264 phosphate transporter ATP-binding protein; Provisi 89.4
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 89.37
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 89.36
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 89.34
PRK07429327 phosphoribulokinase; Provisional 89.34
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 89.32
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 89.32
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 89.32
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 89.3
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 89.29
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 89.29
PRK10619257 histidine/lysine/arginine/ornithine transporter su 89.28
KOG2485|consensus335 89.27
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 89.27
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 89.26
PLN03046460 D-glycerate 3-kinase; Provisional 89.26
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 89.25
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 89.25
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 89.2
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 89.2
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 89.2
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 89.19
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 89.19
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 89.01
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 89.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 88.99
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 88.96
PRK10253265 iron-enterobactin transporter ATP-binding protein; 88.95
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 88.93
PRK14731208 coaE dephospho-CoA kinase; Provisional 88.91
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 88.89
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 88.88
COG5019 373 CDC3 Septin family protein [Cell division and chro 88.87
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 88.85
PRK09435332 membrane ATPase/protein kinase; Provisional 88.84
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 88.82
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 88.81
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 88.8
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 88.79
PRK04182180 cytidylate kinase; Provisional 88.74
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 88.68
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 88.65
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 88.64
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 88.64
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 88.62
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 88.61
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 88.6
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 88.6
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 88.58
PRK08118167 topology modulation protein; Reviewed 88.55
PF05729166 NACHT: NACHT domain 88.53
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 88.53
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 88.51
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 88.5
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 88.49
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 88.47
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 88.47
PRK11153343 metN DL-methionine transporter ATP-binding subunit 88.44
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 88.39
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 88.36
PRK03695248 vitamin B12-transporter ATPase; Provisional 88.35
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 88.34
PRK04213201 GTP-binding protein; Provisional 88.34
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 88.33
PRK14236272 phosphate transporter ATP-binding protein; Provisi 88.28
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 88.22
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 88.21
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 88.2
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 88.13
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 88.08
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 88.06
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 87.95
KOG0410|consensus410 87.95
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 87.86
PRK04040188 adenylate kinase; Provisional 87.85
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 87.84
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 87.84
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 87.84
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 87.82
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 87.8
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 87.73
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 87.73
PRK05541176 adenylylsulfate kinase; Provisional 87.73
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 87.73
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 87.73
PRK10218 607 GTP-binding protein; Provisional 87.67
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 87.66
PRK10938 490 putative molybdenum transport ATP-binding protein 87.65
COG1100219 GTPase SAR1 and related small G proteins [General 87.65
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 87.63
PRK05433 600 GTP-binding protein LepA; Provisional 87.57
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 87.56
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 87.52
PLN03108210 Rab family protein; Provisional 87.52
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 87.5
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.46
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 87.44
PRK00049 396 elongation factor Tu; Reviewed 87.43
PRK13546264 teichoic acids export protein ATP-binding subunit; 87.41
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 87.4
PLN03127 447 Elongation factor Tu; Provisional 87.4
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 87.4
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 87.38
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 87.32
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 87.19
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 87.19
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 87.18
PRK15467158 ethanolamine utilization protein EutP; Provisional 87.18
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 87.14
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 87.11
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 87.06
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 87.04
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 87.01
KOG2655|consensus 366 86.99
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 86.86
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 86.85
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 86.85
PRK14737186 gmk guanylate kinase; Provisional 86.84
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 86.8
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 86.79
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 86.75
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 86.74
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 86.74
PRK14738206 gmk guanylate kinase; Provisional 86.73
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 86.72
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 86.69
PLN03071219 GTP-binding nuclear protein Ran; Provisional 86.67
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 86.61
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 86.6
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 86.59
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 86.58
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 86.57
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 86.46
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 86.45
cd01881176 Obg_like The Obg-like subfamily consists of five w 86.45
COG0486454 ThdF Predicted GTPase [General function prediction 86.44
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 86.43
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 86.4
PRK00889175 adenylylsulfate kinase; Provisional 86.37
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 86.28
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 86.25
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 86.25
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 86.23
PRK14730195 coaE dephospho-CoA kinase; Provisional 86.22
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 86.13
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 86.12
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 86.11
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 86.06
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 86.05
PRK10261 623 glutathione transporter ATP-binding protein; Provi 86.02
PRK08356195 hypothetical protein; Provisional 86.01
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 85.97
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 85.91
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 85.87
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 85.78
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
Probab=100.00  E-value=1.3e-43  Score=325.13  Aligned_cols=149  Identities=50%  Similarity=0.725  Sum_probs=130.1

Q ss_pred             CceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCCCCc
Q psy5031          32 KHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSE  111 (281)
Q Consensus        32 ~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~e  111 (281)
                      +++|++|+||++.| .   ..++||+||||+|+||||||||||+|++                                 
T Consensus         1 ~~~~~~~~~al~~l-~---~~~~~v~vvsi~G~~rtGKSfLln~l~~---------------------------------   43 (260)
T PF02263_consen    1 DNKLELNEEALEIL-Q---QIDQPVAVVSIVGPYRTGKSFLLNQLLG---------------------------------   43 (260)
T ss_dssp             TTEEEE-HHHHHHH-C---TTTSBEEEEEEEEETTSSHHHHHHHHCC---------------------------------
T ss_pred             CCeEEECHHHHHHH-h---cCCCCEEEEEeecCCccchHHHHHHHhc---------------------------------
Confidence            58999999999966 2   3689999999999999999999999942                                 


Q ss_pred             ccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCCCCCCcccceEe
Q psy5031         112 RDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILM  191 (281)
Q Consensus       112 ~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~~~~~~TkGIWm  191 (281)
                                                                                  ...||+|+++.++||+||||
T Consensus        44 ------------------------------------------------------------~~~gF~~~~~~~~~T~Giw~   63 (260)
T PF02263_consen   44 ------------------------------------------------------------PQSGFSWGPTVEPCTKGIWM   63 (260)
T ss_dssp             ------------------------------------------------------------BSSSSESSSCSSST-SCEEE
T ss_pred             ------------------------------------------------------------ccccccccCCCCCCCcceee
Confidence                                                                        13799999999999999999


Q ss_pred             eecceeecCCCCCceEEEEEecCCCCC-CCcCcccchhhHHHHHhhhhhhhhccCCCCChhhhhHhHHHHHHHHHHh---
Q psy5031         192 WSHVYIATLPTGEKAAVILLDTQGTFD-SESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLAL---  267 (281)
Q Consensus       192 Ws~P~~~~~~~g~~v~VlLlDTEG~~d-~~~s~~~d~~IFaLs~LLSS~~IYNs~~~Ide~~L~~L~l~t~~a~~i~---  267 (281)
                      |++|    .+.+++++|+||||||++| ...+..+|++||+|++||||++|||+++.|++++|++|++++++|++|+   
T Consensus        64 w~~~----~~~~~~~~v~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~  139 (260)
T PF02263_consen   64 WSEP----LPDGEKVAVVLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKY  139 (260)
T ss_dssp             ECCE-----TTSTCEEEEEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTH
T ss_pred             eecc----cccccceeEEEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhc
Confidence            9999    3688899999999999999 4556788999999999999999999999999999999999999998764   


Q ss_pred             -----hccCCCCCcccccC
Q psy5031         268 -----ADTGTKPFQRLQFL  281 (281)
Q Consensus       268 -----~~~~~~pfq~L~fl  281 (281)
                           .+....|||+|.||
T Consensus       140 ~~~~~~~~~~~~fp~l~wl  158 (260)
T PF02263_consen  140 GDSADSEDLGKPFPSLVWL  158 (260)
T ss_dssp             HHHHHHHCTTTTCEEEEEE
T ss_pred             ccccchhhhcccchHHHHH
Confidence                 34468999999886



GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.

>KOG2037|consensus Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG2203|consensus Back     alignment and domain information
>KOG2037|consensus Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>KOG4181|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
3qnu_A 459 Crystal Structure Of The Cytosolic Domain Of Human 1e-54
4idq_A 447 Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44 1e-54
3q5e_A 447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 1e-54
4idn_A 457 Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 1e-54
3q5d_A 447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 1e-51
4idp_A 447 Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 1e-51
>pdb|3QNU|A Chain A, Crystal Structure Of The Cytosolic Domain Of Human Atlastin-1 In Complex With Gdp, Hexagonal Form Length = 459 Back     alignment and structure

Iteration: 1

Score = 209 bits (532), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 102/146 (69%), Positives = 122/146 (83%), Gaps = 5/146 (3%) Query: 136 AFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHV 195 AFRKGKSFL+DF+LRYM Y +E S DW+G + PL GFSWRGGSER+TTGI +WS + Sbjct: 87 AFRKGKSFLMDFMLRYM---YNQE--SVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEI 141 Query: 196 YIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQH 255 ++ P G+K AV+L+DTQGTFDS+ST+RD ATVFALSTM+SSIQ+YNLSQN+QEDDLQH Sbjct: 142 FLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQH 201 Query: 256 LQLFTEYGRLALADTGTKPFQRLQFL 281 LQLFTEYGRLA+ +T KPFQ L FL Sbjct: 202 LQLFTEYGRLAMEETFLKPFQSLIFL 227
>pdb|4IDQ|A Chain A, Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 447 Back     alignment and structure
>pdb|3Q5E|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 2 Length = 447 Back     alignment and structure
>pdb|4IDN|A Chain A, Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 Back     alignment and structure
>pdb|3Q5D|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 1 Length = 447 Back     alignment and structure
>pdb|4IDP|A Chain A, Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 9e-36
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 6e-29
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 4e-25
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 3e-15
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 Back     alignment and structure
 Score =  132 bits (331), Expect = 9e-36
 Identities = 100/146 (68%), Positives = 119/146 (81%), Gaps = 5/146 (3%)

Query: 136 AFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHV 195
           AFRKGKSFL+DF+LRYM         S DW+G  + PL GFSWRGGSER+TTGI +WS +
Sbjct: 75  AFRKGKSFLMDFMLRYMY-----NQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEI 129

Query: 196 YIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQH 255
           ++   P G+K AV+L+DTQGTFDS+ST+RD ATVFALSTM+SSIQ+YNLSQN+QEDDLQH
Sbjct: 130 FLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQH 189

Query: 256 LQLFTEYGRLALADTGTKPFQRLQFL 281
           LQLFTEYGRLA+ +T  KPFQ L FL
Sbjct: 190 LQLFTEYGRLAMEETFLKPFQSLIFL 215


>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 100.0
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 100.0
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 99.93
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 98.09
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.27
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.22
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.0
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.9
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.88
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.64
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 96.22
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 96.19
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.09
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 96.07
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.05
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.01
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.0
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.98
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 95.95
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.93
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.93
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.91
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 95.84
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 95.79
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.74
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.69
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.66
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.63
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.58
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.57
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 95.53
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 95.49
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 95.43
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.41
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.37
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.37
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.34
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.32
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.32
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.25
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.21
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.18
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.14
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.12
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.1
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.04
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.01
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.92
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.88
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.85
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.85
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.74
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.71
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 94.66
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.63
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.63
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.59
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.56
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.39
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.36
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.07
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.99
2www_A349 Methylmalonic aciduria type A protein, mitochondri 93.84
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.79
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.77
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 93.77
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 93.71
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 93.7
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 93.68
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.62
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 93.54
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 93.52
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 93.46
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.39
1kag_A173 SKI, shikimate kinase I; transferase, structural g 93.38
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.36
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.28
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.25
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.25
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.13
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.08
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.07
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.04
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.04
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.03
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 93.01
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.96
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 92.94
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 92.93
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 92.92
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.91
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.87
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.86
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 92.86
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.85
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.82
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.82
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.73
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.71
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.71
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.69
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.65
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.63
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 92.63
1g6h_A257 High-affinity branched-chain amino acid transport 92.61
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.6
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.58
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.55
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.55
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 92.53
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.53
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 92.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 92.44
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.42
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.38
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 92.37
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.36
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 92.34
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 92.33
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.31
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.27
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 92.26
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.24
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.23
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.23
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 92.22
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 92.21
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.21
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.2
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.19
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.18
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.18
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 92.17
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.15
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.13
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.11
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 92.06
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.03
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.01
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.98
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 91.97
3llu_A196 RAS-related GTP-binding protein C; structural geno 91.94
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.86
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 91.85
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 91.84
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.83
2ghi_A260 Transport protein; multidrug resistance protein, M 91.81
2ged_A193 SR-beta, signal recognition particle receptor beta 91.8
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 91.74
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.73
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 91.73
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 91.72
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 91.72
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 91.66
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.63
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 91.61
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.61
2kjq_A149 DNAA-related protein; solution structure, NESG, st 91.58
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 91.56
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 91.54
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.53
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 91.49
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.46
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 91.45
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 91.44
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.43
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.42
1xjc_A169 MOBB protein homolog; structural genomics, midwest 91.39
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 91.37
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 91.33
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 91.33
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.27
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 91.23
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 91.19
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.19
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 91.14
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 91.02
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 90.99
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.97
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 90.95
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 90.9
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 90.89
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 90.88
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 90.8
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 90.79
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 90.78
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 90.74
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 90.73
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 90.69
1p9r_A418 General secretion pathway protein E; bacterial typ 90.66
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.62
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.62
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.61
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 90.6
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.53
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 90.48
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.45
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.38
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 90.37
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 90.37
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 90.33
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 90.31
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 90.31
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 90.3
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.25
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 90.25
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 90.19
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 90.19
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.18
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.18
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 90.16
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 90.12
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 90.11
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 90.1
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 90.03
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 90.03
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 90.01
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 89.93
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 89.93
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 89.9
3vaa_A199 Shikimate kinase, SK; structural genomics, center 89.9
1nrj_B218 SR-beta, signal recognition particle receptor beta 89.89
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 89.85
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 89.83
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 89.79
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 89.77
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 89.75
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 89.71
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.7
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.49
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 89.47
1via_A175 Shikimate kinase; structural genomics, transferase 89.46
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 89.46
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 89.45
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 89.41
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 89.39
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 89.36
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 89.35
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 89.34
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 89.33
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 89.31
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 89.28
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 89.27
2fh5_B214 SR-beta, signal recognition particle receptor beta 89.26
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 89.25
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.16
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.16
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 89.04
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 89.03
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 89.03
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 89.02
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 89.01
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 89.0
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 88.98
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 88.97
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 88.95
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 88.95
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 88.94
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.9
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 88.87
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.86
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 88.8
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 88.72
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 88.58
3r20_A233 Cytidylate kinase; structural genomics, seattle st 88.49
2og2_A359 Putative signal recognition particle receptor; nuc 88.48
2cvh_A220 DNA repair and recombination protein RADB; filamen 88.48
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 88.47
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 88.42
3t1o_A198 Gliding protein MGLA; G domain containing protein, 88.4
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 88.34
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 88.32
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 88.21
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 88.21
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 88.14
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 88.04
3bos_A242 Putative DNA replication factor; P-loop containing 88.03
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 87.9
2chg_A226 Replication factor C small subunit; DNA-binding pr 87.9
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 87.89
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.88
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 87.87
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 87.85
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 87.82
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 87.82
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 87.81
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 87.8
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 87.8
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 87.79
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 87.78
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.72
2vli_A183 Antibiotic resistance protein; transferase, tunica 87.72
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 87.67
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 87.62
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 87.55
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 87.52
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 87.52
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 87.49
3iby_A256 Ferrous iron transport protein B; G protein, G dom 87.42
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 87.37
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 87.25
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 87.22
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 87.19
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 87.17
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 87.16
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 87.08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 87.07
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 87.04
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 87.04
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 87.02
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 87.02
3kta_A182 Chromosome segregation protein SMC; structural mai 86.99
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 86.98
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 86.96
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 86.82
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.78
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 86.78
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 86.77
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 86.75
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 86.74
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 86.72
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 86.71
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 86.7
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 86.66
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 86.63
2oap_1511 GSPE-2, type II secretion system protein; hexameri 86.54
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 86.51
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 86.46
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 86.37
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 86.34
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 86.21
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 86.18
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 86.1
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 86.09
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 85.91
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 85.88
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 85.73
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 85.67
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 85.65
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 85.65
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 85.51
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 85.36
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 85.27
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 85.26
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 85.16
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 85.11
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 85.1
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 84.89
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 85.12
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 84.8
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 84.74
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 84.74
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 84.72
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 84.71
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.68
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 84.68
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 84.48
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 84.48
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.47
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 84.43
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 84.4
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 84.31
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 84.29
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 84.1
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 84.08
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 84.04
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 83.85
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 83.83
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 83.66
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 83.61
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.49
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 83.46
1vma_A306 Cell division protein FTSY; TM0570, structural gen 83.39
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 83.36
2fna_A 357 Conserved hypothetical protein; structural genomic 83.2
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 83.05
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 82.99
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 82.93
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 82.92
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 82.86
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 82.83
1wxq_A 397 GTP-binding protein; structural genomics, riken st 82.8
3tlx_A243 Adenylate kinase 2; structural genomics, structura 82.72
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 82.68
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 82.59
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 82.57
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 82.55
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 82.5
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 82.31
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 82.25
3cnl_A262 YLQF, putative uncharacterized protein; circular p 82.18
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 82.11
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 81.95
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 81.88
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 81.83
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 81.82
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 81.6
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 81.4
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 81.31
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 81.23
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 81.19
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 81.11
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 81.08
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 80.35
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 80.26
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 80.22
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.1
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 80.02
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
Probab=100.00  E-value=7.5e-51  Score=398.49  Aligned_cols=190  Identities=65%  Similarity=1.036  Sum_probs=172.2

Q ss_pred             cccCCCCCeeEEEEeCCCceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCC
Q psy5031          15 EDSLPQYGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWM   94 (281)
Q Consensus        15 ~~~~~~~~pvqLV~~~~~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~   94 (281)
                      ++...+++|+|||+++++++|.||+|||+.||+++.++++||+||||+|++|||||||||+|++++.+.           
T Consensus        26 ~~~~~~~~pvqlV~~~~~~~l~ln~eAl~~iL~~~~i~~~~v~vvsv~G~~~~gks~l~N~ll~~~~~~-----------   94 (457)
T 4ido_A           26 EEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQ-----------   94 (457)
T ss_dssp             -----CCCEEEEEEECTTSCEEECHHHHHHHHSSTTTTTSBEEEEEEEEBTTSSHHHHHHHHHHHHHCT-----------
T ss_pred             ccccCCCCceeEEEECCCCCEEECHHHHHHHHhccccCCCceEEEEEECCCCCchhHHHHHHHHHhhcc-----------
Confidence            445778999999999888999999999999887666678999999999999999999999999986542           


Q ss_pred             CCCCCCCCCcccCCCCcccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCC
Q psy5031          95 GPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLE  174 (281)
Q Consensus        95 ~~~~~~~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (281)
                                                                                        +..+|+++.+.+..
T Consensus        95 ------------------------------------------------------------------~~~~w~~~~~~~~~  108 (457)
T 4ido_A           95 ------------------------------------------------------------------ESVDWVGDYNEPLT  108 (457)
T ss_dssp             ------------------------------------------------------------------TCTTTTCCTTCCCC
T ss_pred             ------------------------------------------------------------------cccccccccccCCC
Confidence                                                                              12467777777789


Q ss_pred             CcccCCCCCCcccceEeeecceeecCCCCCceEEEEEecCCCCCCCcCcccchhhHHHHHhhhhhhhhccCCCCChhhhh
Q psy5031         175 GFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQ  254 (281)
Q Consensus       175 gF~~~~~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d~~~s~~~d~~IFaLs~LLSS~~IYNs~~~Ide~~L~  254 (281)
                      ||+|++++++||+|||||++|+.+..++|++++|+||||||++|.+++.++|++||+|++||||++|||++++|++++|+
T Consensus       109 gF~~~~~~~~~TkGIWmw~~p~~~~~~~g~~~~vlllDTEG~~d~~~~~~~d~~ifaLa~LLSS~~IyN~~~~i~~~~L~  188 (457)
T 4ido_A          109 GFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQ  188 (457)
T ss_dssp             SSCCCCSSSCCCCSEEEESSCEEEECTTSCEEEEEEEEECCBTCTTCCHHHHHHHHHHHHHHCSEEEEEEESSCCHHHHH
T ss_pred             CceeCCCCCCcCceEEEecCcccccCCCCCeeEEEEEeccCCCCcccCccccHHHHHHHHHHhhheeecccccCCHHHHH
Confidence            99999999999999999999999998999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHHHHHHHHHhhccCCCCCcccccC
Q psy5031         255 HLQLFTEYGRLALADTGTKPFQRLQFL  281 (281)
Q Consensus       255 ~L~l~t~~a~~i~~~~~~~pfq~L~fl  281 (281)
                      +|++|++||++|+++....|||+|.||
T Consensus       189 ~L~~~tel~~~i~~~~~~~~Fp~f~wl  215 (457)
T 4ido_A          189 HLQLFTEYGRLAMEETFLKPFQSLIFL  215 (457)
T ss_dssp             HHHHHHHHHHHHSCCCSSCSEEEEEEE
T ss_pred             HHHHHHHHHHHHhhhcccccCCceEEE
Confidence            999999999999999999999999875



>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1f5na2 277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 5e-23
d1f5na2277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 2e-12
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 93.2 bits (231), Expect = 5e-23
 Identities = 34/132 (25%), Positives = 52/132 (39%), Gaps = 26/132 (19%)

Query: 136 AFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHV 195
            +R GKS+L++ L                          GFS     +  T GI MW   
Sbjct: 40  LYRTGKSYLMNKLAGKKK---------------------GFSLGSTVQSHTKGIWMWCVP 78

Query: 196 YIATLPTGEKAAVILLDTQGTFDSE-STVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQ 254
           +    P      ++LLDT+G  D E    ++ + +FAL+ +LSS  +YN    I +  + 
Sbjct: 79  H----PKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD 134

Query: 255 HLQLFTEYGRLA 266
            L   TE     
Sbjct: 135 QLYYVTELTHRI 146


>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 100.0
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.29
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.09
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.01
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.87
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.64
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.48
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.4
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 96.32
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.81
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.77
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.62
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.43
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 95.22
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.19
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.9
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.85
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.82
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.8
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.76
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.73
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.55
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.52
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.51
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.49
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.3
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.27
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.22
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.22
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.1
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.04
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.01
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.95
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.95
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.94
d1okkd2207 GTPase domain of the signal recognition particle r 93.89
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.85
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.79
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.75
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.67
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.67
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.51
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.41
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.36
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.07
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.06
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.04
d1vmaa2213 GTPase domain of the signal recognition particle r 93.01
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 92.99
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.93
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.92
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.91
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.74
d2qy9a2211 GTPase domain of the signal recognition particle r 92.72
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.7
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.65
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.62
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.62
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.59
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.44
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.41
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.4
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.36
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.31
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.3
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.27
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.18
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.16
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.14
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.06
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.03
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.99
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.98
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.72
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.7
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.64
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.61
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.56
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.42
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.41
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.38
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.36
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.35
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.32
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.31
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.27
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.17
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.15
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.09
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.08
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.07
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.95
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.87
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.8
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.71
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.68
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.65
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.63
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.59
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.58
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 90.21
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.2
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.17
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 90.16
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.14
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.11
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.07
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.05
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.02
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.02
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.94
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.91
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.87
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.82
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.81
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.76
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.73
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.59
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.41
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.31
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 89.31
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.24
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.16
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.08
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.06
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 88.94
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.79
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 88.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.66
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.53
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.42
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.26
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 88.24
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.11
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.08
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.77
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.65
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.46
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 87.35
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.33
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 87.27
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.24
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 87.23
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.19
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 87.14
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.06
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 86.99
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 86.83
d1ls1a2207 GTPase domain of the signal sequence recognition p 86.7
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 86.7
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.64
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.56
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.55
d1tuea_205 Replication protein E1 helicase domain {Human papi 86.47
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 86.26
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 85.95
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 85.69
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 85.69
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 85.65
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.16
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 85.12
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.86
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 84.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.82
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 84.43
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.41
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 84.4
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.05
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 83.38
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.27
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 83.24
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 82.6
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 82.53
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 82.36
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 82.09
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.72
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 81.57
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 81.22
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 81.17
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 80.99
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 80.92
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 80.57
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 80.57
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.55
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 80.43
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.22
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.7e-40  Score=300.98  Aligned_cols=159  Identities=27%  Similarity=0.430  Sum_probs=138.2

Q ss_pred             CCeeEEEEeCCCceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCC
Q psy5031          21 YGAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVP  100 (281)
Q Consensus        21 ~~pvqLV~~~~~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~  100 (281)
                      +.|+|||. +++++|++|+||++.|..    .++||+||||+|++|||||||||+|++.                     
T Consensus         2 ~~p~~li~-~~~~~l~~~~e~l~~l~~----~~~~v~vvsi~G~~~sGKS~llN~l~~~---------------------   55 (277)
T d1f5na2           2 TGPMCLIE-NTNGRLMANPEALKILSA----ITQPMVVVAIVGLYRTGKSYLMNKLAGK---------------------   55 (277)
T ss_dssp             CSCEEEEE-EETTEEEECHHHHHHHHT----CCSBEEEEEEEEBTTSSHHHHHHHHTTC---------------------
T ss_pred             CCCeEEEE-cCCCeEEECHHHHHHHHc----CCCCEEEEEEECCCCCCHHHHHHHHcCC---------------------
Confidence            57999997 678999999999995532    4789999999999999999999999421                     


Q ss_pred             CCCcccCCCCcccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCC
Q psy5031         101 LEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRG  180 (281)
Q Consensus       101 ~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~  180 (281)
                                                                                              ..||.|++
T Consensus        56 ------------------------------------------------------------------------~~~f~~~~   63 (277)
T d1f5na2          56 ------------------------------------------------------------------------KKGFSLGS   63 (277)
T ss_dssp             ------------------------------------------------------------------------SSCSCCCC
T ss_pred             ------------------------------------------------------------------------CCCCccCC
Confidence                                                                                    25899999


Q ss_pred             CCCCcccceEeeecceeecCCCCCceEEEEEecCCCCCCCc-CcccchhhHHHHHhhhhhhhhccCCCCChhhhhHhHHH
Q psy5031         181 GSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSES-TVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLF  259 (281)
Q Consensus       181 ~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d~~~-s~~~d~~IFaLs~LLSS~~IYNs~~~Ide~~L~~L~l~  259 (281)
                      ++++||+|||||+.|+    +++++++|++|||||+.+.+. +..+|++||+|++||||++|||+.+.|++.++++|+++
T Consensus        64 ~~~~~T~Giw~~~~~~----~~~~~~~~~~lDteG~~~~~~~~~~~~~~i~~l~~llSs~~i~N~~~~~~~~~l~~L~~~  139 (277)
T d1f5na2          64 TVQSHTKGIWMWCVPH----PKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYV  139 (277)
T ss_dssp             SSSCCCCSEEEEEEEC----SSSTTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHH
T ss_pred             CCCCCCCceEEEEeec----cCCCCceEEEEecccccccccccchhHHHHHHHHHHHhCEEEEeccccCcHHHHHHHHHH
Confidence            9999999999999999    467788999999999999875 56689999999999999999999999999999999999


Q ss_pred             HHHHHHHhhccC--------------CCCCcccccC
Q psy5031         260 TEYGRLALADTG--------------TKPFQRLQFL  281 (281)
Q Consensus       260 t~~a~~i~~~~~--------------~~pfq~L~fl  281 (281)
                      +++++.+.....              ..|||+|.|+
T Consensus       140 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~l~~v  175 (277)
T d1f5na2         140 TELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWT  175 (277)
T ss_dssp             HTHHHHCBSCCC-------CCGGGGHHHHCCEEEEE
T ss_pred             HHHHHHHHHhhcccccccccccchhhcccCCceEEE
Confidence            999998754332              2378888774



>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure