Psyllid ID: psy5101

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY
cEEEccccccEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEEEEEEEEEcccccEEEEEcccccEEEEcEEEEcccccc
cEEEEcccccEEEEEccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHccEEEEEEEEEcccEEEEEEEccccccEEccEEEEcHHHHH
AYVANRvadkltrvtdniyccrsgsaadtQAISDFVSYNLDLqrmelgeeplvysGAKLFQELVYSYRDSLTAgiicagwdrkkggqvyciplggmLMRQKmamggsgsty
ayvanrvadkltrvtdniyccrsgsaadtqaISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIicagwdrkkGGQVYCIPLGGMLMRQKMAMGGSGSTY
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY
*****RVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLM*************
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGS**
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKM*********
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
P28073238 Proteasome subunit beta t yes N/A 1.0 0.466 0.603 4e-38
Q60692238 Proteasome subunit beta t yes N/A 1.0 0.466 0.603 4e-38
Q3MHN0239 Proteasome subunit beta t yes N/A 1.0 0.464 0.603 7e-38
P28072239 Proteasome subunit beta t yes N/A 1.0 0.464 0.603 9e-38
Q55GJ6214 Proteasome subunit beta t yes N/A 1.0 0.518 0.594 7e-33
O43063226 Probable proteasome subun yes N/A 1.0 0.491 0.549 9e-33
P38624215 Proteasome subunit beta t yes N/A 0.990 0.511 0.576 2e-30
Q3SZC2219 Proteasome subunit beta t no N/A 0.972 0.493 0.532 7e-28
P93395234 Proteasome subunit beta t N/A N/A 0.990 0.470 0.5 7e-28
Q8LD27233 Proteasome subunit beta t yes N/A 0.990 0.472 0.490 8e-28
>sp|P28073|PSB6_RAT Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 Back     alignment and function desciption
 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 89/111 (80%)

Query: 1   AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
           +Y+ANRV DKLT + D+I+CCRSGSAADTQA++D V+Y L    +EL E PLV++ A LF
Sbjct: 57  SYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLF 116

Query: 61  QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           +E+ Y YR+ L AGII AGWD ++GGQVY +P+GGM++RQ  A+GGSGS+Y
Sbjct: 117 KEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSY 167
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 Back     alignment and function description
>sp|Q3MHN0|PSB6_BOVIN Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 Back     alignment and function description
>sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 Back     alignment and function description
>sp|Q55GJ6|PSB6_DICDI Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 Back     alignment and function description
>sp|O43063|PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 Back     alignment and function description
>sp|P38624|PSB1_YEAST Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 Back     alignment and function description
>sp|Q3SZC2|PSB9_BOVIN Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 Back     alignment and function description
>sp|P93395|PSB6_TOBAC Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
389609335 220 proteasome beta1 subunit [Papilio xuthus 1.0 0.504 0.666 3e-42
443696644 231 hypothetical protein CAPTEDRAFT_156053 [ 1.0 0.480 0.711 4e-42
321464090 225 hypothetical protein DAPPUDRAFT_306867 [ 1.0 0.493 0.702 5e-42
357607058208 hypothetical protein KGM_11399 [Danaus p 1.0 0.533 0.675 8e-42
91087659 224 PREDICTED: similar to predicted protein 1.0 0.495 0.702 8e-42
350425330 232 PREDICTED: proteasome subunit beta type- 1.0 0.478 0.702 3e-41
332372981 217 unknown [Dendroctonus ponderosae] 1.0 0.511 0.693 4e-41
307206411197 Proteasome subunit beta type-6 [Harpegna 1.0 0.563 0.675 3e-40
380027365 232 PREDICTED: proteasome subunit beta type- 1.0 0.478 0.684 3e-40
346472801 242 hypothetical protein [Amblyomma maculatu 1.0 0.458 0.702 3e-40
>gi|389609335|dbj|BAM18279.1| proteasome beta1 subunit [Papilio xuthus] Back     alignment and taxonomy information
 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 74/111 (66%), Positives = 98/111 (88%)

Query: 1   AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
           AY+ANRV DKLT++TD+IYCCRSGSAADTQAI+D V+Y+L+  +MELGE PLV + A +F
Sbjct: 49  AYIANRVTDKLTKITDHIYCCRSGSAADTQAIADIVTYHLNFHKMELGEPPLVQTAAAIF 108

Query: 61  QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           +EL Y+YRDSL AGI+ AGWD+K+GGQ+YC+P+GGM+ RQ +++GGSGS+Y
Sbjct: 109 RELCYNYRDSLVAGILVAGWDKKEGGQIYCVPIGGMVQRQAVSIGGSGSSY 159

Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|443696644|gb|ELT97307.1| hypothetical protein CAPTEDRAFT_156053 [Capitella teleta] Back     alignment and taxonomy information
>gi|321464090|gb|EFX75100.1| hypothetical protein DAPPUDRAFT_306867 [Daphnia pulex] Back     alignment and taxonomy information
>gi|357607058|gb|EHJ65339.1| hypothetical protein KGM_11399 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91087659|ref|XP_973571.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270009417|gb|EFA05865.1| hypothetical protein TcasGA2_TC008665 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350425330|ref|XP_003494087.1| PREDICTED: proteasome subunit beta type-6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332372981|gb|AEE61632.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307206411|gb|EFN84449.1| Proteasome subunit beta type-6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380027365|ref|XP_003697397.1| PREDICTED: proteasome subunit beta type-6-like [Apis florea] Back     alignment and taxonomy information
>gi|346472801|gb|AEO36245.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
ZFIN|ZDB-GENE-990415-216232 psmb6 "proteasome (prosome, ma 1.0 0.478 0.621 5.1e-35
MGI|MGI:104880238 Psmb6 "proteasome (prosome, ma 1.0 0.466 0.603 6.5e-35
RGD|61881238 Psmb6 "proteasome (prosome, ma 1.0 0.466 0.603 6.5e-35
UNIPROTKB|E2R0B6239 PSMB6 "Proteasome subunit beta 1.0 0.464 0.603 8.3e-35
UNIPROTKB|P28072239 PSMB6 "Proteasome subunit beta 1.0 0.464 0.603 8.3e-35
UNIPROTKB|Q3MHN0239 PSMB6 "Proteasome subunit beta 1.0 0.464 0.603 1.1e-34
UNIPROTKB|F1RFV5241 PSMB6 "Proteasome subunit beta 1.0 0.460 0.603 1.1e-34
FB|FBgn0010590224 Prosbeta1 "Proteasome beta1 su 1.0 0.495 0.612 2.8e-34
CGD|CAL0000411214 PRE3 [Candida albicans (taxid: 1.0 0.518 0.575 7.7e-32
DICTYBASE|DDB_G0267390214 psmB6 "proteasome subunit beta 1.0 0.518 0.594 2.6e-31
ZFIN|ZDB-GENE-990415-216 psmb6 "proteasome (prosome, macropain) subunit, beta type, 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 379 (138.5 bits), Expect = 5.1e-35, P = 5.1e-35
 Identities = 69/111 (62%), Positives = 88/111 (79%)

Query:     1 AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
             AY+ANRV DKLT + D I+CCRSGSAADTQAI+D V+Y L    +EL E PLV + A LF
Sbjct:    56 AYIANRVTDKLTPIHDRIFCCRSGSAADTQAIADAVTYQLGFHSIELDEAPLVQTAASLF 115

Query:    61 QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
             +++ Y YR+ L AGII AGWDR++GGQVY +P+GGML RQ +++GGSGS+Y
Sbjct:   116 RDMCYRYREELMAGIIVAGWDRRRGGQVYTVPVGGMLTRQPVSVGGSGSSY 166
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005839 "proteasome core complex" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0000502 "proteasome complex" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
MGI|MGI:104880 Psmb6 "proteasome (prosome, macropain) subunit, beta type 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61881 Psmb6 "proteasome (prosome, macropain) subunit, beta type 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0B6 PSMB6 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P28072 PSMB6 "Proteasome subunit beta type-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHN0 PSMB6 "Proteasome subunit beta type-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFV5 PSMB6 "Proteasome subunit beta type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0010590 Prosbeta1 "Proteasome beta1 subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0000411 PRE3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267390 psmB6 "proteasome subunit beta type 6" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q60692PSB6_MOUSE3, ., 4, ., 2, 5, ., 10.60361.00.4663yesN/A
Q3MHN0PSB6_BOVIN3, ., 4, ., 2, 5, ., 10.60361.00.4644yesN/A
P28073PSB6_RAT3, ., 4, ., 2, 5, ., 10.60361.00.4663yesN/A
O43063PSB1_SCHPO3, ., 4, ., 2, 5, ., 10.54951.00.4911yesN/A
P28072PSB6_HUMAN3, ., 4, ., 2, 5, ., 10.60361.00.4644yesN/A
Q55GJ6PSB6_DICDI3, ., 4, ., 2, 5, ., 10.59451.00.5186yesN/A
P38624PSB1_YEAST3, ., 4, ., 2, 5, ., 10.57650.99090.5116yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.824
3rd Layer3.4.250.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
cd03762188 cd03762, proteasome_beta_type_6, proteasome beta t 6e-62
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 3e-31
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 2e-25
pfam00227188 pfam00227, Proteasome, Proteasome subunit 1e-22
cd03763189 cd03763, proteasome_beta_type_7, proteasome beta t 6e-18
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 7e-16
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 3e-15
PTZ00488247 PTZ00488, PTZ00488, Proteasome subunit beta type-5 3e-09
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 2e-08
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 3e-08
cd03761188 cd03761, proteasome_beta_type_5, proteasome beta t 2e-06
>gnl|CDD|239731 cd03762, proteasome_beta_type_6, proteasome beta type-6 subunit Back     alignment and domain information 
 Score =  186 bits (475), Expect = 6e-62
 Identities = 75/111 (67%), Positives = 91/111 (81%)

Query: 1   AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
           +YVANRV DKLT++ D IYCCRSGSAADTQAI+D+V Y LD+  +ELGE PLV + A LF
Sbjct: 24  SYVANRVTDKLTQLHDRIYCCRSGSAADTQAIADYVRYYLDMHSIELGEPPLVKTAASLF 83

Query: 61  QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           + L Y+Y++ L+AGII AGWD + GGQVY IPLGGML+RQ  A+GGSGSTY
Sbjct: 84  KNLCYNYKEMLSAGIIVAGWDEQNGGQVYSIPLGGMLIRQPFAIGGSGSTY 134

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 188
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185666 PTZ00488, PTZ00488, Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|239730 cd03761, proteasome_beta_type_5, proteasome beta type-5 subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 99.98
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 99.98
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 99.97
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 99.97
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 99.97
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 99.97
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.97
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 99.97
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 99.97
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.97
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 99.97
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.97
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.97
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.97
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 99.97
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.97
PTZ00488247 Proteasome subunit beta type-5; Provisional 99.96
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 99.96
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 99.96
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.96
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 99.96
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 99.96
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.96
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 99.96
PRK03996241 proteasome subunit alpha; Provisional 99.96
PTZ00246253 proteasome subunit alpha; Provisional 99.95
KOG0175|consensus285 99.95
KOG0176|consensus241 99.95
KOG0179|consensus235 99.95
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.94
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.94
KOG0174|consensus224 99.94
KOG0177|consensus200 99.94
KOG0183|consensus249 99.9
KOG0181|consensus233 99.9
KOG0173|consensus 271 99.9
KOG0178|consensus249 99.9
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.89
KOG0184|consensus254 99.89
KOG0863|consensus264 99.89
KOG0180|consensus204 99.89
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.88
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.88
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.88
KOG0182|consensus246 99.87
KOG0185|consensus256 99.76
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 98.53
COG3484 255 Predicted proteasome-type protease [Posttranslatio 96.12
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information 
Probab=100.00  E-value=5.9e-32  Score=185.56  Aligned_cols=108  Identities=26%  Similarity=0.478  Sum_probs=103.7

Q ss_pred             ccccCCCCceEEecCcEEEEecCcHHHHHHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHhcCC-ceeEEEEEeee
Q psy5101           2 YVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRD-SLTAGIICAGW   80 (111)
Q Consensus         2 ~i~~~~~~Ki~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~ls~~l~~~~~-p~~~~~lv~G~   80 (111)
                      ++.+++.+|||+|++|++|+++|..+|++.+++++|.++++|+.+++++|+++.+|+++++++|.+|+ ||++++|||||
T Consensus        25 ~~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~y~~~~~~~i~~~~la~~ls~~l~~~~~~~~~v~~li~G~  104 (188)
T cd03761          25 YIASQTVKKVIEINPYLLGTMAGGAADCQYWERVLGRECRLYELRNKERISVAAASKLLSNMLYQYKGMGLSMGTMICGW  104 (188)
T ss_pred             EEEcCCcceEEEccCcEEEEeCccHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHhcCCCCeEEEEEEEEE
Confidence            45678999999999999999999999999999999999999999999999999999999999999987 89999999999


Q ss_pred             cCCCCeEEEEecCCCceeeeceEEeecCCC
Q psy5101          81 DRKKGGQVYCIPLGGMLMRQKMAMGGSGST  110 (111)
Q Consensus        81 D~~~gp~Ly~vd~~G~~~~~~~~~~Gsgs~  110 (111)
                      |+ .||+||++||+|++.+++++++|+|+.
T Consensus       105 D~-~g~~L~~~dp~G~~~~~~~~a~G~g~~  133 (188)
T cd03761         105 DK-TGPGLYYVDSDGTRLKGDLFSVGSGST  133 (188)
T ss_pred             eC-CCCEEEEEcCCceEEEcCeEEEcccHH
Confidence            96 799999999999999999999999985

The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>KOG0185|consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
3unb_N205 Mouse Constitutive 20s Proteasome In Complex With P 4e-39
1iru_H205 Crystal Structure Of The Mammalian 20s Proteasome A 7e-39
1ryp_H205 Crystal Structure Of The 20s Proteasome From Yeast 1e-31
1vsy_H196 Proteasome Activator Complex Length = 196 2e-31
3nzj_N215 Crystal Structure Of Yeast 20s Proteasome In Comple 2e-31
1g65_N196 Crystal Structure Of Epoxomicin:20s Proteasome Reve 2e-31
3unf_N199 Mouse 20s Immunoproteasome In Complex With Pr-957 L 2e-23
1iru_I 234 Crystal Structure Of The Mammalian 20s Proteasome A 4e-11
3unb_H 234 Mouse Constitutive 20s Proteasome In Complex With P 2e-10
3nzj_H261 Crystal Structure Of Yeast 20s Proteasome In Comple 9e-10
1ryp_I222 Crystal Structure Of The 20s Proteasome From Yeast 9e-10
1fnt_I232 Crystal Structure Of The 20s Proteasome From Yeast 1e-09
3unf_H 234 Mouse 20s Immunoproteasome In Complex With Pr-957 L 9e-09
3h4p_a219 Proteasome 20s Core Particle From Methanocaldococcu 1e-06
1g0u_K212 A Gated Channel Into The Proteasome Core Particle L 1e-05
3nzj_K287 Crystal Structure Of Yeast 20s Proteasome In Comple 1e-05
1j2q_H202 20s Proteasome In Complex With Calpain-inhibitor I 1e-05
4b4t_5287 Near-Atomic Resolution Structural Model Of The Yeas 2e-05
1ryp_L212 Crystal Structure Of The 20s Proteasome From Yeast 2e-05
3unf_K204 Mouse 20s Immunoproteasome In Complex With Pr-957 L 3e-05
3unb_K205 Mouse Constitutive 20s Proteasome In Complex With P 5e-04
1iru_L204 Crystal Structure Of The Mammalian 20s Proteasome A 5e-04
>pdb|3UNB|N Chain N, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (393), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 89/111 (80%)
Query: 1   AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
           +Y+ANRV DKLT + D+I+CCRSGSAADTQA++D V+Y L    +EL E PLV++ A LF
Sbjct: 24  SYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLF 83
Query: 61  QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           +E+ Y YR+ L AGII AGWD ++GGQVY +P+GGM++RQ  A+GGSGS+Y
Sbjct: 84  KEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSY 134
>pdb|1IRU|H Chain H, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 Back     alignment and structure
>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 205 Back     alignment and structure
>pdb|1VSY|H Chain H, Proteasome Activator Complex Length = 196 Back     alignment and structure
>pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 215 Back     alignment and structure
>pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A Molecular Basis For Selectivity Of Alpha,Beta-Epoxyketone Proteasome Inhibitors Length = 196 Back     alignment and structure
>pdb|3UNF|N Chain N, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 199 Back     alignment and structure
>pdb|1IRU|I Chain I, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 234 Back     alignment and structure
>pdb|3UNB|H Chain H, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 261 Back     alignment and structure
>pdb|1RYP|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 222 Back     alignment and structure
>pdb|1FNT|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 232 Back     alignment and structure
>pdb|3UNF|H Chain H, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 Back     alignment and structure
>pdb|1G0U|K Chain K, A Gated Channel Into The Proteasome Core Particle Length = 212 Back     alignment and structure
>pdb|3NZJ|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 287 Back     alignment and structure
>pdb|1J2Q|H Chain H, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 202 Back     alignment and structure
>pdb|4B4T|5 Chain 5, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 287 Back     alignment and structure
>pdb|1RYP|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 212 Back     alignment and structure
>pdb|3UNF|K Chain K, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 204 Back     alignment and structure
>pdb|3UNB|K Chain K, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 Back     alignment and structure
>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1iru_H205 20S proteasome; cell cycle, immune response, prote 2e-45
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 1e-43
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 2e-42
1iru_I 234 20S proteasome; cell cycle, immune response, prote 3e-42
3unf_N199 Proteasome subunit beta type-9; antigen presentati 3e-42
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 4e-42
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 5e-42
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 9e-42
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 2e-41
1iru_M213 20S proteasome; cell cycle, immune response, prote 4e-40
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 4e-39
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 4e-39
1iru_L204 20S proteasome; cell cycle, immune response, prote 6e-39
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 8e-39
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 2e-38
1iru_K201 20S proteasome; cell cycle, immune response, prote 2e-37
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 2e-37
1iru_J205 20S proteasome; cell cycle, immune response, prote 8e-37
1iru_N219 20S proteasome; cell cycle, immune response, prote 2e-35
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 6e-35
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 3e-32
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 5e-32
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 7e-32
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 3e-29
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 1e-28
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 3e-11
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 2e-05
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 4e-05
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
 Score =  144 bits (366), Expect = 2e-45
 Identities = 67/111 (60%), Positives = 88/111 (79%)

Query: 1   AYVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLF 60
           +Y+ANRV DKLT + D I+CCRSGSAADTQA++D V+Y L    +EL E PLV++ A LF
Sbjct: 24  SYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLF 83

Query: 61  QELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           +E+ Y YR+ L AGII AGWD ++GGQVY +P+GGM++RQ  A+GGSGS+Y
Sbjct: 84  KEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSY 134
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Length = 174 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
1iru_H205 20S proteasome; cell cycle, immune response, prote 99.98
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 99.97
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 99.97
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 99.97
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.97
1iru_M213 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 99.97
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 99.97
1iru_L204 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 99.97
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 99.97
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.97
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 99.97
1iru_I 234 20S proteasome; cell cycle, immune response, prote 99.97
1iru_D248 20S proteasome; cell cycle, immune response, prote 99.97
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 99.97
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 99.97
1iru_G254 20S proteasome; cell cycle, immune response, prote 99.97
1iru_C261 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 99.97
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.97
1iru_K201 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 99.97
1iru_J205 20S proteasome; cell cycle, immune response, prote 99.97
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 99.96
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 99.96
1iru_N219 20S proteasome; cell cycle, immune response, prote 99.96
1iru_B233 20S proteasome; cell cycle, immune response, prote 99.96
3unf_N199 Proteasome subunit beta type-9; antigen presentati 99.96
1iru_A246 20S proteasome; cell cycle, immune response, prote 99.96
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 99.96
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 99.96
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 99.96
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 99.96
1iru_E241 20S proteasome; cell cycle, immune response, prote 99.96
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 99.96
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 99.96
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 99.96
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.96
1iru_F263 20S proteasome; cell cycle, immune response, prote 99.96
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 99.96
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 99.95
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.95
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.95
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 99.94
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.9
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.89
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.87
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
Probab=99.98  E-value=1.1e-31  Score=184.90  Aligned_cols=110  Identities=61%  Similarity=1.124  Sum_probs=105.7

Q ss_pred             ccccCCCCceEEecCcEEEEecCcHHHHHHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHhcCCceeEEEEEeeec
Q psy5101           2 YVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWD   81 (111)
Q Consensus         2 ~i~~~~~~Ki~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~ls~~l~~~~~p~~~~~lv~G~D   81 (111)
                      ++.+++.+||++|++|++|++||..||++.+.+++|.++++|+++++++|+++.+|+++++++|.+++||++++||||||
T Consensus        25 ~~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~~~~~~~~~~~~~~~~~v~~la~~l~~~~~~~~~p~~~~~lvaG~D  104 (205)
T 1iru_H           25 YIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWD  104 (205)
T ss_dssp             EEEESSCCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTTTTCCEEEEEEEEE
T ss_pred             EEecCCcCceEEcCCCEEEEcCccHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHhcCcCccEEEEEEEEe
Confidence            56778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEecCCCceeeeceEEeecCCCC
Q psy5101          82 RKKGGQVYCIPLGGMLMRQKMAMGGSGSTY  111 (111)
Q Consensus        82 ~~~gp~Ly~vd~~G~~~~~~~~~~Gsgs~~  111 (111)
                      +++||+||.+||+|++.+++++++|+|+.|
T Consensus       105 ~~~gp~ly~~d~~G~~~~~~~~a~Gsgs~~  134 (205)
T 1iru_H          105 PQEGGQVYSVPMGGMMVRQSFAIGGSGSSY  134 (205)
T ss_dssp             TTTEEEEEEECTTSCCEECSEEEESGGGGG
T ss_pred             CCCCCEEEEECCCCcEEecCEEEECCCHHH
Confidence            877999999999999999999999999864
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 7e-23
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-19
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 2e-17
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 1e-16
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 7e-16
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 9e-16
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 8e-15
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 4e-14
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 5e-14
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 6e-14
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 8e-14
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 4e-13
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 8e-13
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 1e-12
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 2e-12
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 4e-12
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 8e-12
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 4e-11
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 5e-11
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 1e-10
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 1e-10
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 3e-10
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 6e-10
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 9e-10
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 9e-10
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 1e-09
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 1e-09
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-09
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 2e-08
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-08
d1m4ya_171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 3e-07
d1g3ka_173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 6e-07
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 85.9 bits (212), Expect = 7e-23
 Identities = 67/110 (60%), Positives = 87/110 (79%)

Query: 2   YVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQ 61
           Y+ANRV DKLT + D I+CCRSGSAADTQA++D V+Y L    +EL E PLV++ A LF+
Sbjct: 25  YIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK 84

Query: 62  ELVYSYRDSLTAGIICAGWDRKKGGQVYCIPLGGMLMRQKMAMGGSGSTY 111
           E+ Y YR+ L AGII AGWD ++GGQVY +P+GGM++RQ  A+GGSGS+Y
Sbjct: 85  EMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSY 134
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.97
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 99.97
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.97
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.97
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 99.96
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.96
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.96
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.96
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.96
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 99.96
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.96
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.96
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 99.96
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.96
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 99.96
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 99.95
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.95
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.95
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 99.95
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.95
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.95
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 99.94
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 99.94
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.94
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.93
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.93
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.93
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.92
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.91
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.44
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.39
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.04
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 83.6
d1rp3a177 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 81.11
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.97  E-value=1.1e-30  Score=177.97  Aligned_cols=110  Identities=61%  Similarity=1.124  Sum_probs=106.2

Q ss_pred             ccccCCCCceEEecCcEEEEecCcHHHHHHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHHhcCCceeEEEEEeeec
Q psy5101           2 YVANRVADKLTRVTDNIYCCRSGSAADTQAISDFVSYNLDLQRMELGEEPLVYSGAKLFQELVYSYRDSLTAGIICAGWD   81 (111)
Q Consensus         2 ~i~~~~~~Ki~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~ls~~l~~~~~p~~~~~lv~G~D   81 (111)
                      +|.+++.+||++|+||++|+++|..+|++.+.+.++.+++.|+++++++++++.+++++++.+|.+++|+++++|++|+|
T Consensus        25 ~i~~~~~~KI~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~p~~~~~lvaG~d  104 (202)
T d1iruh_          25 YIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWD  104 (202)
T ss_dssp             EEEESSCCCEEEEETTEEEEEEECHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHTTTTCCEEEEEEEEE
T ss_pred             eeecCCcceEEEcCCcEEEEeccchHHHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHhhccceeEEEEEEEee
Confidence            57789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCeEEEEecCCCceeeeceEEeecCCCC
Q psy5101          82 RKKGGQVYCIPLGGMLMRQKMAMGGSGSTY  111 (111)
Q Consensus        82 ~~~gp~Ly~vd~~G~~~~~~~~~~Gsgs~~  111 (111)
                      +.++|+||.+||.|+..+.+++++|+|+.+
T Consensus       105 ~~~~~~l~~~d~~g~~~~~~~~a~G~g~~~  134 (202)
T d1iruh_         105 PQEGGQVYSVPMGGMMVRQSFAIGGSGSSY  134 (202)
T ss_dssp             TTTEEEEEEECTTSCCEECSEEEESGGGGG
T ss_pred             cCCCcEEEEECCCCceeecceeEEeCCHHH
Confidence            988999999999999999999999999854
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp3a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure