Psyllid ID: psy5138

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-----
MTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS
ccHHHHHHccccccccccEEEEccccccccccccccEEEEEcccEEEEcccccEEEccccccEEEEEEEccccccccccEEEEEcccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHcccccccccEEEccccccHHHHHcccccHHHHHcccccccccccEEEEccccccccccccccEEEEEcccEEEEcccEEEEEccccccEEEEEEEccccccccccEEEEEcccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHcc
ccHHHHHHHcHHHHcccEEEEEccEccEcccHHHcccEEEEcccEEEEEEEEEEEEccccccEEEEEEEccHHHHHHcEEEEEEEcccccEEEcccccEcccccccEEEEEEEEEEEEHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHcccHHHHHHHcHHHHcccEEEEEccEccEcccHHHcccEEEEcccEEEEEEEEEEEEccccccEEEEEEEccHHHHHHcEEEEEEEcccccEEEcccccEcccccccEEEEEEEEEEEEHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc
mtteqkekylprlaqtdagsfalsepgsgsdafAMKTtatkdgnhyilngskmwisNADIANIFLVMANvdvskgyrgITCFIVErsmegfsvgkkenklgmkasgtcslhfdnvrvpeeniisgvgEGYKIAAGFLNQGRIGIAAQMTGLAQgcldatipytlersqvghrifdfqacnggsvqHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFEsglgtteqkekylprlaqtdagsfalsepgsgsdafAMKTtatkdgnhyilngskmwisNADIANIFLVMANvdvskgyrgITCFIVErsmegfsvgkkenklgmkasgtcslhfdnvrvpeeniisgvgEGYKIAAGFLNQGRIGIAAQMTGLAQgcldatipytlersqfghrifdFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDwmgglgftkdypqekfyrdckmagHITRQCIDwmgglgftkdypqekyyrdckvgtiyegtsniqLSTIAKYIAKEYTS
mtteqkekylprlaqtdagsfalsepgsGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESglgtteqkekylpRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIyegtsniqlstiAKYIAKEYTS
MTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS
*****************************************DGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQK********ETVLKTLFE*******************************************KDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAK****
MTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEY**
********YLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS
*TTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQVGHRIFDFQACNGGSVQHQISQAVTQVECARLLTYNAARLLEAGQPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query575 2.2.26 [Sep-21-2011]
Q9DBL1432 Short/branched chain spec yes N/A 0.547 0.729 0.512 1e-111
P70584432 Short/branched chain spec yes N/A 0.594 0.791 0.489 1e-111
P45954432 Short/branched chain spec yes N/A 0.568 0.756 0.5 1e-110
Q5RF40432 Short/branched chain spec yes N/A 0.568 0.756 0.5 1e-109
Q5EAD4432 Short/branched chain spec yes N/A 0.568 0.756 0.497 1e-109
Q54RR5413 Probable short/branched c yes N/A 0.547 0.762 0.428 4e-82
P45867379 Acyl-CoA dehydrogenase OS yes N/A 0.481 0.730 0.422 6e-62
P15651412 Short-chain specific acyl no N/A 0.490 0.684 0.384 3e-59
Q07417412 Short-chain specific acyl no N/A 0.490 0.684 0.384 4e-59
P45857379 Acyl-CoA dehydrogenase OS no N/A 0.48 0.728 0.420 1e-58
>sp|Q9DBL1|ACDSB_MOUSE Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadsb PE=1 SV=1 Back     alignment and function desciption
 Score =  404 bits (1037), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 253/398 (63%), Gaps = 83/398 (20%)

Query: 227 SVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL------------------------ 262
           +V K A+E +AP V  M+   K++++V++ LF+ GL                        
Sbjct: 67  TVKKFAQEHVAPLVSSMDENSKMEKSVIQGLFQQGLMGIEVEAQYGGTEASFFCSVLVIE 126

Query: 263 ---------------------------GTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAF 295
                                       + EQK  YLP+L     GSF LSE G+GSD+F
Sbjct: 127 ELAKVDASVALLCDIQNTIINNLFRKHASEEQKATYLPKLVTEKLGSFCLSEAGAGSDSF 186

Query: 296 AMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSV 355
           AMKT A K GN+Y+LNGSKMWIS+A+ A +FLV ANVD S GYRGITCF+V+R  EGF +
Sbjct: 187 AMKTRADKSGNYYVLNGSKMWISHAEHAELFLVFANVDPSSGYRGITCFLVDRDTEGFQI 246

Query: 356 GKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQ 415
           GK+ENK+G++AS TC L F+NV+VPE NI+  +G GYK A G LN+GRIGIAAQM GLAQ
Sbjct: 247 GKRENKMGIRASSTCQLTFENVKVPETNILGKIGHGYKYAIGSLNEGRIGIAAQMLGLAQ 306

Query: 416 GCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQ 475
           GC D TIPY  ER QFG RIFDFQ +QHQ++Q ATQ+E  RLLTYNAARL+EAG+PFIK+
Sbjct: 307 GCFDYTIPYIKERMQFGKRIFDFQGLQHQVAQVATQLEATRLLTYNAARLVEAGRPFIKE 366

Query: 476 ASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGF 535
           ASMAKY+ASE+AG  T +CI+WMGG+G+TKDYP EKF                       
Sbjct: 367 ASMAKYYASEVAGLTTSKCIEWMGGVGYTKDYPVEKF----------------------- 403

Query: 536 TKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEY 573
                    +RD K+GTIYEG SNIQL+TIAK+I  EY
Sbjct: 404 ---------FRDAKIGTIYEGASNIQLNTIAKHIDAEY 432
Has greatest activity toward short branched chain acyl-CoA derivative such as (s)-2-methylbutyryl-CoA, isobutyryl-CoA, and 2-methylhexanoyl-CoA as well as toward short straight chain acyl-CoAs such as butyryl-CoA and hexanoyl-CoA. Can use valproyl-CoA as substrate and may play a role in controlling the metabolic flux of valproic acid in the development of toxicity of this agent.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 3EC: .EC: 9EC: 9EC: .EC: -
>sp|P70584|ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acadsb PE=1 SV=1 Back     alignment and function description
>sp|P45954|ACDSB_HUMAN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADSB PE=1 SV=1 Back     alignment and function description
>sp|Q5RF40|ACDSB_PONAB Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADSB PE=2 SV=1 Back     alignment and function description
>sp|Q5EAD4|ACDSB_BOVIN Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADSB PE=2 SV=1 Back     alignment and function description
>sp|Q54RR5|ACDSB_DICDI Probable short/branched chain specific acyl-CoA dehydrogenase OS=Dictyostelium discoideum GN=acadsb PE=3 SV=1 Back     alignment and function description
>sp|P45867|ACDA_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=acdA PE=2 SV=1 Back     alignment and function description
>sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 Back     alignment and function description
>sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=2 SV=2 Back     alignment and function description
>sp|P45857|ACDB_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=mmgC PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
158298698417 AGAP009783-PA [Anopheles gambiae str. PE 0.551 0.760 0.557 1e-123
328709833422 PREDICTED: short/branched chain specific 0.547 0.746 0.555 1e-122
312385227425 hypothetical protein AND_01014 [Anophele 0.551 0.745 0.55 1e-121
157116344422 acyl-coa dehydrogenase [Aedes aegypti] g 0.551 0.751 0.547 1e-119
170046519424 acyl-CoA dehydrogenase [Culex quinquefas 0.551 0.747 0.545 1e-118
340725543414 PREDICTED: short/branched chain specific 0.549 0.763 0.546 1e-115
350403749414 PREDICTED: short/branched chain specific 0.549 0.763 0.541 1e-115
389609191418 acyl-coa dehydrogenase [Papilio xuthus] 0.547 0.753 0.535 1e-115
332020079416 Short/branched chain specific acyl-CoA d 0.617 0.853 0.502 1e-115
307182564404 Short/branched chain specific acyl-CoA d 0.591 0.841 0.515 1e-115
>gi|158298698|ref|XP_318878.3| AGAP009783-PA [Anopheles gambiae str. PEST] gi|157014010|gb|EAA14306.3| AGAP009783-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/400 (55%), Positives = 271/400 (67%), Gaps = 83/400 (20%)

Query: 227 SVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL------------------------ 262
           +VAKLA+E IAP V+KM+ E + D +V++ LF++GL                        
Sbjct: 50  TVAKLAQEQIAPLVKKMDEEHQFDPSVVRALFDNGLMGIEVSDEYGGSACNFMTTMLVVE 109

Query: 263 ---------------------------GTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAF 295
                                      GT EQK KYLP+L+Q  +GSFALSEP +GSDAF
Sbjct: 110 ELSKVCPATAAFVDIHNTLVNSLMIKLGTAEQKSKYLPKLSQEYSGSFALSEPSAGSDAF 169

Query: 296 AMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSV 355
           ++KTTA KDGNHYILNG+KMWISN+D++ +FL+MAN + S GYRGIT FIVER  EGF+V
Sbjct: 170 SLKTTAKKDGNHYILNGTKMWISNSDLSGVFLIMANANPSAGYRGITTFIVEREYEGFTV 229

Query: 356 GKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQ 415
           GKKE+KLG+ ASGTC+LH DNVRVPEENI+   G+GY+ AAGFLN+GRIGI AQM GLAQ
Sbjct: 230 GKKESKLGICASGTCTLHMDNVRVPEENILGEFGKGYQYAAGFLNEGRIGIGAQMIGLAQ 289

Query: 416 GCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQ 475
           GCLDATIPY LER QFG  ++ FQS+QHQI+  AT++E ARLLTYNAARL EAG PF+KQ
Sbjct: 290 GCLDATIPYLLERKQFGSDLYSFQSMQHQIATIATEIEAARLLTYNAARLQEAGAPFLKQ 349

Query: 476 ASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGF 535
           A+MAKY+ASE+A   T +CIDWMGG+GFTKD+PQEKFYRD                    
Sbjct: 350 AAMAKYYASEVAQRTTVKCIDWMGGVGFTKDFPQEKFYRD-------------------- 389

Query: 536 TKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEYTS 575
                       CK+G IYEGT+N+QLSTIAK + KEY S
Sbjct: 390 ------------CKIGAIYEGTTNMQLSTIAKVMKKEYQS 417

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328709833|ref|XP_001947176.2| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312385227|gb|EFR29779.1| hypothetical protein AND_01014 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157116344|ref|XP_001658431.1| acyl-coa dehydrogenase [Aedes aegypti] gi|108876518|gb|EAT40743.1| AAEL007555-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170046519|ref|XP_001850810.1| acyl-CoA dehydrogenase [Culex quinquefasciatus] gi|167869287|gb|EDS32670.1| acyl-CoA dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340725543|ref|XP_003401128.1| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403749|ref|XP_003486890.1| PREDICTED: short/branched chain specific acyl-CoA dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|389609191|dbj|BAM18207.1| acyl-coa dehydrogenase [Papilio xuthus] Back     alignment and taxonomy information
>gi|332020079|gb|EGI60525.1| Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307182564|gb|EFN69757.1| Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query575
FB|FBgn0036824414 CG3902 [Drosophila melanogaste 0.467 0.649 0.644 2e-102
RGD|2013432 Acadsb "acyl-CoA dehydrogenase 0.467 0.622 0.644 3.2e-102
UNIPROTKB|P45954432 ACADSB "Short/branched chain s 0.469 0.625 0.634 4.6e-101
MGI|MGI:1914135432 Acadsb "acyl-Coenzyme A dehydr 0.511 0.680 0.616 3.7e-96
ZFIN|ZDB-GENE-070410-109422 acadsb "acyl-CoA dehydrogenase 0.612 0.834 0.530 3.8e-94
UNIPROTKB|Q5EAD4432 ACADSB "Short/branched chain s 0.511 0.680 0.592 2.1e-91
UNIPROTKB|F1NZ81433 ACADSB "Uncharacterized protei 0.511 0.678 0.603 2.1e-93
UNIPROTKB|B4DQ51330 ACADSB "cDNA FLJ57418, highly 0.469 0.818 0.634 9e-93
WB|WBGene00019433419 acdh-3 [Caenorhabditis elegans 0.446 0.613 0.614 3.4e-92
UNIPROTKB|F1PP63432 ACADSB "Uncharacterized protei 0.511 0.680 0.572 1.5e-90
FB|FBgn0036824 CG3902 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 932 (333.1 bits), Expect = 2.0e-102, Sum P(2) = 2.0e-102
 Identities = 174/270 (64%), Positives = 213/270 (78%)

Query:   249 IDETVLKTLFESGLGTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHY 308
             I  T++ +L     G  EQK KYLP+LAQ  AGSFAL+EPG+GSDAF++KT A KDG+HY
Sbjct:   121 IHNTLVNSLMIK-FGNAEQKAKYLPKLAQEYAGSFALTEPGAGSDAFSLKTVAKKDGSHY 179

Query:   309 ILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASG 368
             ++NGSKMWISN+D+A +FL+ AN     GYRGIT FIV+R   G  V K E+KLG++ASG
Sbjct:   180 VINGSKMWISNSDVAGVFLIFANAKPEDGYRGITTFIVDRETPGLIVNKPEDKLGIRASG 239

Query:   369 TCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQGCLDATIPYTLER 428
             TC L FDNVRVPEENI+   G GYK AAGFLN+GRIGIAAQM GLAQG  DATIPY LER
Sbjct:   240 TCQLTFDNVRVPEENILGTFGHGYKYAAGFLNEGRIGIAAQMVGLAQGTFDATIPYLLER 299

Query:   429 SQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYFASEMAG 488
              QFG  I++FQS+QHQI+  AT++E ARL+TYNAARL E G PF K+A+MAKY+ASE+A 
Sbjct:   300 KQFGDAIYNFQSMQHQIATVATEIEAARLMTYNAARLQEQGVPFQKEAAMAKYYASEVAQ 359

Query:   489 HITRQCIDWMGGLGFTKDYPQEKFYRDCKM 518
                 +C+DWMGG+GFT+D+PQEK+YRD K+
Sbjct:   360 RAAIKCVDWMGGVGFTRDFPQEKYYRDVKI 389
GO:0016937 "short-branched-chain-acyl-CoA dehydrogenase activity" evidence=ISS
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
RGD|2013 Acadsb "acyl-CoA dehydrogenase, short/branched chain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P45954 ACADSB "Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914135 Acadsb "acyl-Coenzyme A dehydrogenase, short/branched chain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-109 acadsb "acyl-CoA dehydrogenase, short/branched chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EAD4 ACADSB "Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZ81 ACADSB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQ51 ACADSB "cDNA FLJ57418, highly similar to Short/branched chain specific acyl-CoAdehydrogenase, mitochondrial (EC 1.3.99.-)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00019433 acdh-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP63 ACADSB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DBL1ACDSB_MOUSE1, ., 3, ., 9, 9, ., -0.51250.54780.7291yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.990.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 1e-154
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 1e-117
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 1e-107
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 2e-95
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 2e-83
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 2e-82
cd01161409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 2e-78
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 1e-73
cd01162375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 8e-73
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 7e-70
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 5e-67
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 3e-66
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 2e-62
cd01161409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 5e-61
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 1e-60
cd01162375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 3e-59
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 6e-57
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 8e-56
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 5e-54
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 2e-53
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 7e-46
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 2e-45
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, 2e-44
cd01153407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 1e-41
cd01152380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 3e-40
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 8e-39
PRK12341381 PRK12341, PRK12341, putative acyl-CoA dehydrogenas 1e-38
cd01155394 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases simil 9e-37
PLN02526412 PLN02526, PLN02526, acyl-coenzyme A oxidase 3e-36
PLN02526412 PLN02526, PLN02526, acyl-coenzyme A oxidase 6e-33
cd01154418 cd01154, AidB, Proteins involved in DNA damage res 1e-31
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 4e-31
cd01152380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 3e-30
cd01155394 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases simil 7e-28
PRK03354380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogen 9e-28
PRK12341381 PRK12341, PRK12341, putative acyl-CoA dehydrogenas 7e-27
cd01153407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 2e-25
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, 3e-23
PTZ00456 622 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provis 3e-23
PLN02876822 PLN02876, PLN02876, acyl-CoA dehydrogenase 1e-20
PRK13026 774 PRK13026, PRK13026, acyl-CoA dehydrogenase; Review 2e-20
pfam0277052 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, 2e-19
pfam0277052 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, 2e-19
cd01154418 cd01154, AidB, Proteins involved in DNA damage res 2e-18
PRK03354380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogen 5e-18
TIGR03204395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 5e-18
TIGR03204395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 3e-17
TIGR03203378 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, 1e-16
PTZ00456622 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provis 2e-16
pfam08028134 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, 2e-16
PRK09463 777 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed 8e-16
PLN02876822 PLN02876, PLN02876, acyl-CoA dehydrogenase 1e-15
PLN02636 686 PLN02636, PLN02636, acyl-coenzyme A oxidase 7e-15
PRK13026774 PRK13026, PRK13026, acyl-CoA dehydrogenase; Review 8e-14
cd01150 610 cd01150, AXO, Peroxisomal acyl-CoA oxidase 2e-13
TIGR03203378 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, 4e-11
PLN02636686 PLN02636, PLN02636, acyl-coenzyme A oxidase 2e-10
TIGR04022391 TIGR04022, sulfur_SfnB, sulfur acquisition oxidore 2e-10
TIGR04022391 TIGR04022, sulfur_SfnB, sulfur acquisition oxidore 9e-10
cd01150610 cd01150, AXO, Peroxisomal acyl-CoA oxidase 2e-09
PRK09463777 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed 8e-09
PTZ00460 646 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provis 1e-08
cd01163377 cd01163, DszC, Dibenzothiophene (DBT) desulfurizat 5e-08
cd01159370 cd01159, NcnH, Naphthocyclinone hydroxylase 1e-07
cd01163377 cd01163, DszC, Dibenzothiophene (DBT) desulfurizat 4e-07
PLN02312 680 PLN02312, PLN02312, acyl-CoA oxidase 6e-07
pfam08028134 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, 2e-06
PRK11561538 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; 2e-06
PLN02443 664 PLN02443, PLN02443, acyl-coenzyme A oxidase 3e-06
PLN02312680 PLN02312, PLN02312, acyl-CoA oxidase 1e-05
cd01159370 cd01159, NcnH, Naphthocyclinone hydroxylase 3e-05
PTZ00460646 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provis 4e-05
PLN02443664 PLN02443, PLN02443, acyl-coenzyme A oxidase 4e-05
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information 
 Score =  447 bits (1151), Expect = e-154
 Identities = 176/397 (44%), Positives = 225/397 (56%), Gaps = 84/397 (21%)

Query: 227 SVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL------------------------ 262
           +V   A++ IAP   +M+ + +    V+K + E GL                        
Sbjct: 9   TVRDFAEKEIAPLAAEMDEKGEFPREVIKEMAELGLMGIPIPEEYGGAGLDFLAYAIAIE 68

Query: 263 ---------------------------GTTEQKEKYLPRLAQTDA-GSFALSEPGSGSDA 294
                                      GT EQK+KYLP LA  +  G+FALSEPG+GSDA
Sbjct: 69  ELAKVDASVAVIVSVHNSLGANPIIKFGTEEQKKKYLPPLATGEKIGAFALSEPGAGSDA 128

Query: 295 FAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFS 354
            A+KTTA KDG+ Y+LNGSKMWI+N   A+ ++V A  D SKGYRGIT FIVER   G S
Sbjct: 129 AALKTTAKKDGDDYVLNGSKMWITNGGEADFYIVFAVTDPSKGYRGITAFIVERDTPGLS 188

Query: 355 VGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLA 414
           VGKKE+KLG++ S T  L F++VRVP+ENI+   GEG+KIA   L+ GRIGIAAQ  G+A
Sbjct: 189 VGKKEDKLGIRGSSTTELIFEDVRVPKENILGEEGEGFKIAMQTLDGGRIGIAAQALGIA 248

Query: 415 QGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIK 474
           Q  LDA + Y  ER QFG  I DFQ +Q +++  AT++E ARLLTY AARL + G+PFIK
Sbjct: 249 QAALDAAVDYAKERKQFGKPIADFQGIQFKLADMATEIEAARLLTYKAARLKDNGEPFIK 308

Query: 475 QASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLG 534
           +A+MAK FASE                                +A  +T   +   GG G
Sbjct: 309 EAAMAKLFASE--------------------------------VAMRVTTDAVQIFGGYG 336

Query: 535 FTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAK 571
           +TKDYP E+YYRD K+  IYEGTS IQ   IAK++ K
Sbjct: 337 YTKDYPVERYYRDAKITEIYEGTSEIQRLVIAKHLLK 373

Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers. Length = 373
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|201229 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173844 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|173844 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|201229 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|185635 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215473 PLN02876, PLN02876, acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|237277 PRK13026, PRK13026, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|145755 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>gnl|CDD|145755 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|132247 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>gnl|CDD|185635 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|219705 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|236528 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215473 PLN02876, PLN02876, acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215342 PLN02636, PLN02636, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|237277 PRK13026, PRK13026, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|132247 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>gnl|CDD|215342 PLN02636, PLN02636, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|188537 TIGR04022, sulfur_SfnB, sulfur acquisition oxidoreductase, SfnB family Back     alignment and domain information
>gnl|CDD|188537 TIGR04022, sulfur_SfnB, sulfur acquisition oxidoreductase, SfnB family Back     alignment and domain information
>gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|236528 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173852 cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>gnl|CDD|173848 cd01159, NcnH, Naphthocyclinone hydroxylase Back     alignment and domain information
>gnl|CDD|173852 cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>gnl|CDD|215178 PLN02312, PLN02312, acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|219705 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|183199 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178062 PLN02443, PLN02443, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|215178 PLN02312, PLN02312, acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|173848 cd01159, NcnH, Naphthocyclinone hydroxylase Back     alignment and domain information
>gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178062 PLN02443, PLN02443, acyl-coenzyme A oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 575
KOG0139|consensus398 100.0
KOG0140|consensus408 100.0
KOG0141|consensus421 100.0
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 100.0
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 100.0
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 100.0
PLN02519404 isovaleryl-CoA dehydrogenase 100.0
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 100.0
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 100.0
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 100.0
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 100.0
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 100.0
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 100.0
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 100.0
PLN02526412 acyl-coenzyme A oxidase 100.0
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 100.0
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 100.0
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 100.0
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subun 100.0
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 100.0
PLN02636 686 acyl-coenzyme A oxidase 100.0
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 100.0
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 100.0
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 100.0
cd01154418 AidB Proteins involved in DNA damage response, sim 100.0
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 100.0
PLN02876822 acyl-CoA dehydrogenase 100.0
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 100.0
PLN02312 680 acyl-CoA oxidase 100.0
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 100.0
KOG0138|consensus432 100.0
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 100.0
KOG0137|consensus 634 100.0
KOG0139|consensus398 100.0
PRK11561538 isovaleryl CoA dehydrogenase; Provisional 100.0
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme 100.0
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 100.0
PLN02443 664 acyl-coenzyme A oxidase 100.0
KOG0140|consensus408 100.0
cd01159370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 100.0
KOG0141|consensus421 100.0
KOG1469|consensus392 100.0
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 100.0
PLN02519404 isovaleryl-CoA dehydrogenase 100.0
KOG0137|consensus634 100.0
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 100.0
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 100.0
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 100.0
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 100.0
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 100.0
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 100.0
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 100.0
KOG0138|consensus432 100.0
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 100.0
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 100.0
PRK09463777 fadE acyl-CoA dehydrogenase; Reviewed 100.0
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 100.0
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 100.0
PLN02526412 acyl-coenzyme A oxidase 100.0
PRK13026774 acyl-CoA dehydrogenase; Reviewed 100.0
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 100.0
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 100.0
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 100.0
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 100.0
PRK11561538 isovaleryl CoA dehydrogenase; Provisional 100.0
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subun 100.0
PLN02636686 acyl-coenzyme A oxidase 100.0
PTZ00460646 acyl-CoA dehydrogenase; Provisional 100.0
cd01154418 AidB Proteins involved in DNA damage response, sim 100.0
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 100.0
PLN02312680 acyl-CoA oxidase 100.0
PLN02876822 acyl-CoA dehydrogenase 99.98
KOG1469|consensus392 99.97
KOG0135|consensus 661 99.97
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.97
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 99.97
PTZ00456622 acyl-CoA dehydrogenase; Provisional 99.97
PLN02443664 acyl-coenzyme A oxidase 99.97
cd01150610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 99.97
PTZ00457520 acyl-CoA dehydrogenase; Provisional 99.97
TIGR02309477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.94
cd01159370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 99.93
KOG0136|consensus 670 99.93
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 99.88
TIGR02309477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.87
PF08028134 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal 99.72
KOG0135|consensus661 99.71
COG2368493 Aromatic ring hydroxylase [Secondary metabolites b 99.65
TIGR02310519 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.6
KOG0136|consensus670 99.53
PF0277052 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle doma 99.5
PF0277052 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle doma 99.47
COG2368493 Aromatic ring hydroxylase [Secondary metabolites b 99.41
TIGR02310519 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.32
PF11794264 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N ter 99.01
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 98.92
PF11794264 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N ter 98.79
PF08028134 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal 98.11
PF02771113 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal 97.69
PF03241205 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C termi 97.39
PF03241205 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C termi 84.37
>KOG0139|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-64  Score=470.76  Aligned_cols=312  Identities=61%  Similarity=1.030  Sum_probs=304.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHhhhHHHhchhcCCccHHHHHHHHHhCC-------------------------------
Q psy5138         214 PFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL-------------------------------  262 (575)
Q Consensus       214 ~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~G~-------------------------------  262 (575)
                      .+++.+.+++  .++++|+.+.+.|.++++|++.++|..+++.+.+.|+                               
T Consensus        36 ~l~E~e~~l~--~tvrkfa~~~i~Plv~~mD~~~~~~~~v~k~~fe~Glmgv~vpeeyGGsG~df~~~~~v~EEisk~d~  113 (398)
T KOG0139|consen   36 ILSETEQMLQ--KTVRKFAQEEIKPLVREMDRESRYPASVIKGLFELGLMGVEVPEEYGGSGLDFFAAAIVIEEISKVDA  113 (398)
T ss_pred             hcCcHHHHHH--HHHHHHHHHhcchHHHhhhhhccCCHHHHHHHhhcCcceeecChhhCCCchhHHHHHHHHHHHhccCc
Confidence            3578888888  9999999999999999999999999999999999997                               


Q ss_pred             --------------------CCHHHHHhcccccCCCceeEEeecCCCCCCccccceeEEEEeCCEEEEeeeeccccCCcc
Q psy5138         263 --------------------GTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADI  322 (575)
Q Consensus       263 --------------------g~~~~~~~~l~~~~~~~~~~~~~te~~~gs~~~~~~~~a~~~~~g~~l~G~k~~~s~~~~  322 (575)
                                          |+++||+.|+|.+.++.+++++++||++|||..+..|+|+++++.|+|||+|.|+||+.+
T Consensus       114 sv~~~v~v~ntL~~~~i~~fGteeqK~~~~P~~~~d~vgsfAlSEpgaGSDa~A~~T~Ak~~Gd~~viNGsKmWItN~~~  193 (398)
T KOG0139|consen  114 SVGVIVDVQNTLYLPLIIQFGTEEQKEKYLPKLTGDLVGSFALSEPGAGSDAFALKTTAKKDGDDYVINGSKMWITNAGE  193 (398)
T ss_pred             cceeEEEecccccchHHHHhCcHHHHhhhcchhhccccceeeecCCCCCcchHHhhhhHhhcCCeEEEecceeeecCCcc
Confidence                                999999988888999999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEEEEeCCCCCCCceEEEEEeCCCCCeeecccCccCCCCCccceeEEEcceeeCCCCcccCCCchHHHHHHHHhhh
Q psy5138         323 ANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQG  402 (575)
Q Consensus       323 a~~~~v~a~~~~~~~~~~~~~~lv~~~~~gv~i~~~~~~~G~rg~~s~~l~f~~v~Vp~~~~l~~~~~~~~~~~~~~~~~  402 (575)
                      |+|++|++.+++..+.+++++|+||+++||+++....+++|||++.++.|+||||+||.+++||+.+.|+++....++.+
T Consensus       194 A~~~lVfan~d~~~~~Kgit~fiV~rd~~Gl~~~k~eDKLGmRaSsTcql~fedVrVpks~IlGe~G~GykyAm~~Ln~g  273 (398)
T KOG0139|consen  194 ADWFLVFANADPSKGYKGITCFIVPRDTPGLSLGKKEDKLGMRASSTCQLHFEDVRVPKSSILGEYGKGYKYAIEVLNAG  273 (398)
T ss_pred             cceEEEEEecChhhccCceeEEEeeCCCCCcccCCccccccccccceeeEEeccccccchhhcccCCcchHHHHHhcCcc
Confidence            99999999998888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhccccCccCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHH
Q psy5138         403 RIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYF  482 (575)
Q Consensus       403 r~~~~a~~~G~~~~al~~~~~~~~~r~~~g~~l~~~~~~~~~la~~~~~~~aar~~~~~a~~~~~~~~~~~~~~~~ak~~  482 (575)
                      |+.++++.+|+++.|+|.++.|+++|.+||++|.++|.+|++||++.+++|++|+++|++++.-+.+.|...+++|+|++
T Consensus       274 RIgi~AqmlglaQ~c~d~tI~Y~q~R~~FGk~l~d~Q~iQhqiA~~~teiEaaRlL~ynaAr~k~~G~pf~keAAMAKl~  353 (398)
T KOG0139|consen  274 RIGIGAQMLGLAQGCFDETIPYAQERLQFGKRLLDFQGLQHQIADMATEIEAARLLVYNAARMKDQGLPFVKEAAMAKLY  353 (398)
T ss_pred             ceeehhhhhhhhHhHHHhhhHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCchHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCcCCcchhhhhhhhcccccccccccccccccccCCChHHHHhhhhccceeccchHH
Q psy5138         483 ASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSN  559 (575)
Q Consensus       483 ~~~~~~~~~~~~~~~~G~~~~~~~~p~~R~~RD~~~~~~~~~~~~~~~Gg~g~~~~~~~~~~~rd~~~~~~~~G~~~  559 (575)
                      +++.+..+...|+++                                .||+||+.+.|++++|||++...|++|+++
T Consensus       354 ase~A~~~t~qCiq~--------------------------------lGG~Gyt~d~paek~yRDarI~~IyeGtsn  398 (398)
T KOG0139|consen  354 ASEVATKTTHQCIQW--------------------------------LGGVGYTKDFPAEKFYRDARIGEIYEGTSN  398 (398)
T ss_pred             hhhhhhHHHHHHHHH--------------------------------HhcccccccccHHHHhhhceeeeeecCCCC
Confidence            999999999999999                                999999999999999999999999999864

>KOG0140|consensus Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>KOG0139|consensus Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>KOG0140|consensus Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>KOG0135|consensus Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>PF08028 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR013107 Acyl Co-A dehydrogenases (1 Back     alignment and domain information
>KOG0135|consensus Back     alignment and domain information
>COG2368 Aromatic ring hydroxylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02310 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>PF02770 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle domain; InterPro: IPR006091 Acyl-CoA dehydrogenases (1 Back     alignment and domain information
>PF02770 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle domain; InterPro: IPR006091 Acyl-CoA dehydrogenases (1 Back     alignment and domain information
>COG2368 Aromatic ring hydroxylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02310 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>PF11794 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N terminal; InterPro: IPR024674 This domain is found in the N terminus of HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PF11794 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N terminal; InterPro: IPR024674 This domain is found in the N terminus of HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information
>PF08028 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR013107 Acyl Co-A dehydrogenases (1 Back     alignment and domain information
>PF02771 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal domain; InterPro: IPR006092 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PF03241 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C terminal; InterPro: IPR024719 This C-terminal domain is found in HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information
>PF03241 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C terminal; InterPro: IPR024719 This C-terminal domain is found in HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
2jif_A404 Structure Of Human Short-Branched Chain Acyl-Coa De 1e-111
1jqi_A388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 3e-60
2vig_A391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 3e-57
1ukw_A379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 7e-57
3pfd_A393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 9e-57
1buc_A383 Three-Dimensional Structure Of Butyryl-Coa Dehydrog 3e-55
3b96_A 587 Structural Basis For Substrate Fatty-Acyl Chain Spe 1e-50
2uxw_A 607 Crystal Structure Of Human Very Long Chain Acyl-coa 1e-50
1ivh_A394 Structure Of Human Isovaleryl-coa Dehydrogenase At 2e-49
2z1q_A 577 Crystal Structure Of Acyl Coa Dehydrogenase Length 4e-48
3nf4_A387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 4e-47
1egd_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 8e-47
1ege_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 8e-47
2a1t_A421 Structure Of The Human Mcad:etf E165betaa Complex L 1e-46
1ws9_A387 Crystal Structure Of Project Id Tt0172 From Thermus 1e-46
3mdd_A385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 1e-46
1udy_A396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 1e-46
3mpi_A397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 1e-46
2dvl_A372 Crystal Structure Of Project Tt0160 From Thermus Th 1e-44
1rx0_A393 Crystal Structure Of Isobutyryl-Coa Dehydrogenase C 5e-42
2pg0_A385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 2e-40
3owa_A 597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 2e-39
3swo_A399 Crystal Structure Of A Glutaryl-Coa Dehydrogenase F 5e-35
3oib_A403 Crystal Structure Of A Putative Acyl-Coa Dehydrogen 1e-34
3r7k_A403 Crystal Structure Of A Probable Acyl Coa Dehydrogen 4e-34
3gqt_A399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 1e-32
3d6b_A395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 1e-32
3eom_A396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 1e-32
3sf6_A403 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 1e-31
1siq_A392 The Crystal Structure And Mechanism Of Human Glutar 2e-31
2r0m_A394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 2e-31
1sir_A394 The Crystal Structure And Mechanism Of Human Glutar 2e-31
2ix5_A436 Short Chain Specific Acyl-Coa Oxidase From Arabidop 9e-30
2ix6_A449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 9e-30
2eba_A385 Crystal Structure Of The Putative Glutaryl-coa Dehy 2e-24
4hr3_A415 Structure Of A Putative Acyl-Coa Dehydrogenase From 3e-23
2wbi_A428 Crystal Structure Of Human Acyl-Coa Dehydrogenase 1 3e-23
1r2j_A366 Fkbi For Biosynthesis Of Methoxymalonyl Extender Un 2e-18
3mkh_A438 Podospora Anserina Nitroalkane Oxidase Length = 438 1e-16
3m9v_A439 X-Ray Structure Of A Kijd3 In Complex With Dtdp Len 1e-12
3mxl_A395 Crystal Structure Of Nitrososynthase From Micromono 7e-12
3djl_A541 Crystal Structure Of Alkylation Response Protein E. 9e-10
1is2_A 661 Crystal Structure Of Peroxisomal Acyl-coa Oxidase-i 1e-06
4doy_A437 Crystal Structure Of Dibenzothiophene Desulfurizati 5e-06
2fon_A 683 X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxid 9e-06
2zaf_A439 Mechanistic And Structural Analyses Of The Roles Of 1e-04
2reh_A439 Mechanistic And Structural Analyses Of The Roles Of 1e-04
2c12_A439 Crystal Structure Of Nitroalkane Oxidase In Complex 1e-04
3d9g_A438 Nitroalkane Oxidase: Wild Type Crystallized In A Tr 1e-04
3d9d_A438 Nitroalkane Oxidase: Mutant D402n Crystallized With 1e-04
2c0u_A439 Crystal Structure Of A Covalent Complex Of Nitroalk 2e-04
3d9f_A438 Nitroalkane Oxidase: Active Site Mutant S276a Cryst 2e-04
1w07_A 659 Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 65 3e-04
>pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure 
Iteration: 1

 Score =  399 bits (1024), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/412 (50%), Positives = 258/412 (62%), Gaps = 85/412 (20%)
Query: 213 QPFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL---------- 262
           Q F  +  M K  +SV K A+E IAP V  M+   K++++V++ LF+ GL          
Sbjct: 27  QTFTDEEMMIK--SSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYG 84
Query: 263 -----------------------------------------GTTEQKEKYLPRLAQTDAG 281
                                                    GT EQK  YLP+L     G
Sbjct: 85  GTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVG 144
Query: 282 SFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGI 341
           SF LSE G+GSD+FA+KT A K+G++Y+LNGSKMWIS+A+ A +FLVMANVD + GY+GI
Sbjct: 145 SFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGI 204
Query: 342 TCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQ 401
           T F+V+R   G  +GK ENKLG++AS TC L F+NV+VPE NI+  +G GYK A G LN+
Sbjct: 205 TSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNE 264
Query: 402 GRIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYN 461
           GRIGIAAQM GLAQGC D TIPY  ER QFG R+FDFQ +QHQ++  ATQ+E ARLLTYN
Sbjct: 265 GRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYN 324
Query: 462 AARLLEAGQPFIKQASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGH 521
           AARLLEAG+PFIK+ASMAKY+ASE+AG  T +CI+WMGG+G+TKDYP EK++        
Sbjct: 325 AARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYF-------- 376
Query: 522 ITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEY 573
                                   RD K+GTIYEG SNIQL+TIAK+I  EY
Sbjct: 377 ------------------------RDAKIGTIYEGASNIQLNTIAKHIDAEY 404
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase From Megasphaera Elsdenii Length = 383 Back     alignment and structure
>pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-coa Dehydrogenase (acadvl) Length = 607 Back     alignment and structure
>pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>pdb|1EGD|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|1EGE|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|2A1T|A Chain A, Structure Of The Human Mcad:etf E165betaa Complex Length = 421 Back     alignment and structure
>pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure
>pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>pdb|1RX0|A Chain A, Crystal Structure Of Isobutyryl-Coa Dehydrogenase Complexed With SubstrateLIGAND. Length = 393 Back     alignment and structure
>pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
>pdb|3SWO|A Chain A, Crystal Structure Of A Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis In Complex With Fadh2 Length = 399 Back     alignment and structure
>pdb|3OIB|A Chain A, Crystal Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Smegmatis, Iodide Soak Length = 403 Back     alignment and structure
>pdb|3R7K|A Chain A, Crystal Structure Of A Probable Acyl Coa Dehydrogenase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 403 Back     alignment and structure
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3SF6|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis Length = 403 Back     alignment and structure
>pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
>pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa Length = 436 Back     alignment and structure
>pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure
>pdb|2EBA|A Chain A, Crystal Structure Of The Putative Glutaryl-coa Dehydrogenase From Thermus Thermophilus Length = 385 Back     alignment and structure
>pdb|4HR3|A Chain A, Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Abscessus Length = 415 Back     alignment and structure
>pdb|2WBI|A Chain A, Crystal Structure Of Human Acyl-Coa Dehydrogenase 11 Length = 428 Back     alignment and structure
>pdb|1R2J|A Chain A, Fkbi For Biosynthesis Of Methoxymalonyl Extender Unit Of Fk520 Polyketide Immunosuppresant Length = 366 Back     alignment and structure
>pdb|3MKH|A Chain A, Podospora Anserina Nitroalkane Oxidase Length = 438 Back     alignment and structure
>pdb|3M9V|A Chain A, X-Ray Structure Of A Kijd3 In Complex With Dtdp Length = 439 Back     alignment and structure
>pdb|3MXL|A Chain A, Crystal Structure Of Nitrososynthase From Micromonospora Carbonacea Var. Africana Length = 395 Back     alignment and structure
>pdb|3DJL|A Chain A, Crystal Structure Of Alkylation Response Protein E. Coli Aidb Length = 541 Back     alignment and structure
>pdb|1IS2|A Chain A, Crystal Structure Of Peroxisomal Acyl-coa Oxidase-ii From Rat Liver Length = 661 Back     alignment and structure
>pdb|4DOY|A Chain A, Crystal Structure Of Dibenzothiophene Desulfurization Enzyme C Length = 437 Back     alignment and structure
>pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Back     alignment and structure
>pdb|2ZAF|A Chain A, Mechanistic And Structural Analyses Of The Roles Of Arg409 And Asp402 In The Reaction Of The Flavoprotein Nitroalkane Oxidase Length = 439 Back     alignment and structure
>pdb|2REH|A Chain A, Mechanistic And Structural Analyses Of The Roles Of Arg409 And Asp402 In The Reaction Of The Flavoprotein Nitroalkane Oxidase Length = 439 Back     alignment and structure
>pdb|2C12|A Chain A, Crystal Structure Of Nitroalkane Oxidase In Complex With Spermine, A Competitive Inhibitor Length = 439 Back     alignment and structure
>pdb|3D9G|A Chain A, Nitroalkane Oxidase: Wild Type Crystallized In A Trapped State Forming A Cyanoadduct With Fad Length = 438 Back     alignment and structure
>pdb|3D9D|A Chain A, Nitroalkane Oxidase: Mutant D402n Crystallized With 1-Nitrohexane Length = 438 Back     alignment and structure
>pdb|2C0U|A Chain A, Crystal Structure Of A Covalent Complex Of Nitroalkane Oxidase Trapped During Substrate Turnover Length = 439 Back     alignment and structure
>pdb|3D9F|A Chain A, Nitroalkane Oxidase: Active Site Mutant S276a Crystallized With 1- Nitrohexane Length = 438 Back     alignment and structure
>pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 659 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query575
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 1e-170
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 1e-127
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 1e-143
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 1e-111
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-139
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-110
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 1e-138
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 1e-109
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 1e-138
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 1e-110
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-137
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-108
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 1e-137
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 1e-109
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 1e-135
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 1e-107
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 1e-134
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 1e-106
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 1e-132
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 1e-104
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 1e-129
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 1e-102
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 1e-128
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 1e-103
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 1e-127
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 1e-101
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 1e-124
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; f 1e-96
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 1e-123
2z1q_A577 Acyl-COA dehydrogenase; FAD, structural genomics, 8e-96
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 1e-121
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 5e-96
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 1e-121
3owa_A597 Acyl-COA dehydrogenase; structural genomics, cente 6e-94
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 1e-119
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 2e-94
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 1e-119
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 8e-93
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 1e-119
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 6e-95
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 1e-117
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 1e-92
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 1e-113
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 1e-88
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 1e-112
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 2e-88
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 1e-112
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 2e-91
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 1e-109
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 3e-89
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 1e-108
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 3e-88
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 1e-108
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 3e-88
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 1e-105
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 7e-86
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 4e-99
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 6e-81
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 3e-66
2ddh_A661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 7e-48
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 2e-61
1w07_A659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 6e-44
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 3e-58
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 4e-43
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 6e-51
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 2e-38
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 4e-43
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 2e-26
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 5e-42
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 3e-31
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 1e-36
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 1e-28
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 4e-32
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 2e-26
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 5e-30
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 1e-20
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 9e-29
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 1e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
 Score =  487 bits (1255), Expect = e-170
 Identities = 203/398 (51%), Positives = 252/398 (63%), Gaps = 83/398 (20%)

Query: 227 SVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL------------------------ 262
           SV K A+E IAP V  M+   K++++V++ LF+ GL                        
Sbjct: 39  SVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIE 98

Query: 263 ---------------------------GTTEQKEKYLPRLAQTDAGSFALSEPGSGSDAF 295
                                      GT EQK  YLP+L     GSF LSE G+GSD+F
Sbjct: 99  ELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSF 158

Query: 296 AMKTTATKDGNHYILNGSKMWISNADIANIFLVMANVDVSKGYRGITCFIVERSMEGFSV 355
           A+KT A K+G++Y+LNGSKMWIS+A+ A +FLVMANVD + GY+GIT F+V+R   G  +
Sbjct: 159 ALKTRADKEGDYYVLNGSKMWISSAEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHI 218

Query: 356 GKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQGRIGIAAQMTGLAQ 415
           GK ENKLG++AS TC L F+NV+VPE NI+  +G GYK A G LN+GRIGIAAQM GLAQ
Sbjct: 219 GKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQ 278

Query: 416 GCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQ 475
           GC D TIPY  ER QFG R+FDFQ +QHQ++  ATQ+E ARLLTYNAARLLEAG+PFIK+
Sbjct: 279 GCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKE 338

Query: 476 ASMAKYFASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGF 535
           ASMAKY+ASE                                +AG  T +CI+WMGG+G+
Sbjct: 339 ASMAKYYASE--------------------------------IAGQTTSKCIEWMGGVGY 366

Query: 536 TKDYPQEKYYRDCKVGTIYEGTSNIQLSTIAKYIAKEY 573
           TKDYP EKY+RD K+GTIYEG SNIQL+TIAK+I  EY
Sbjct: 367 TKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDAEY 404
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Length = 490 Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Length = 490 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 100.0
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 100.0
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 100.0
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 100.0
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 100.0
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 100.0
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 100.0
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 100.0
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 100.0
4hr3_A415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 100.0
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 100.0
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 100.0
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 100.0
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 100.0
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 100.0
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 100.0
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 100.0
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 100.0
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 100.0
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 100.0
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 100.0
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 100.0
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 100.0
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 100.0
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 100.0
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 100.0
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 100.0
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 100.0
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 100.0
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 100.0
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 100.0
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 100.0
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 100.0
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 100.0
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 100.0
3owa_A597 Acyl-COA dehydrogenase; structural genomics, cente 100.0
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 100.0
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 100.0
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 100.0
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 100.0
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 100.0
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 100.0
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 100.0
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 100.0
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 100.0
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 100.0
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 100.0
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 100.0
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 100.0
4hr3_A415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 100.0
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 100.0
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 100.0
2z1q_A577 Acyl-COA dehydrogenase; FAD, structural genomics, 100.0
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 100.0
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 100.0
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 100.0
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 100.0
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; f 100.0
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 100.0
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 100.0
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 100.0
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 100.0
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 100.0
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 100.0
3djl_A541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 100.0
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 99.98
2ddh_A661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 99.98
1w07_A659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 99.97
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.97
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 99.97
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 99.97
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 99.97
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 99.97
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 99.96
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 99.96
4g5e_A517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 99.95
3hwc_A515 Chlorophenol-4-monooxygenase component 2; beta bar 99.95
4g5e_A517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 99.88
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
Probab=100.00  E-value=6.3e-55  Score=450.80  Aligned_cols=326  Identities=39%  Similarity=0.634  Sum_probs=310.7

Q ss_pred             chHHHHHHHHHHHHHHHHHHHhhhHHHhchhcCCccHHHHHHHHHhCC--------------------------------
Q psy5138         215 FIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL--------------------------------  262 (575)
Q Consensus       215 ~~~~~~~~~~~~~a~~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~G~--------------------------------  262 (575)
                      +++++.+++  ..+++|+.+.+.+.+.+.|+.+.+|+++|++|.+.||                                
T Consensus         6 ~~~~~~~l~--~~~r~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~Gl~~~~~P~~~GG~g~~~~~~~~v~eel~~~~~~   83 (391)
T 2vig_A            6 LPETHQMLL--QTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCAS   83 (391)
T ss_dssp             CCHHHHHHH--HHHHHHHHHHTTTTHHHHHHHTCCCHHHHHHHHHHTTTSTTSCGGGTSCCCCHHHHHHHHHHHHHHCHH
T ss_pred             CCHHHHHHH--HHHHHHHHHhCcccHHHHHhcCCCCHHHHHHHHHCCCCCCCCCHhhCCCCCCHHHHHHHHHHHHhhccH
Confidence            467777888  8999999999998888899999999999999999997                                


Q ss_pred             -------------------CCHHHHHhcccc-cCCCceeEEeecCCCCCCccccceeEEEEeCCEEEEeeeeccccCCcc
Q psy5138         263 -------------------GTTEQKEKYLPR-LAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNADI  322 (575)
Q Consensus       263 -------------------g~~~~~~~~l~~-~~~~~~~~~~~te~~~gs~~~~~~~~a~~~~~g~~l~G~k~~~s~~~~  322 (575)
                                         |+++|+++||++ ++|+.++++++|||++|||...+.|+|++++|||+|||+|.|+||+.+
T Consensus        84 ~~~~~~~~~~~~~~~l~~~g~~~q~~~~l~~~~~g~~~~~~a~tEp~~Gsd~~~~~t~A~~~~~g~~lnG~K~~~s~~~~  163 (391)
T 2vig_A           84 TGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWE  163 (391)
T ss_dssp             HHHHHHHHHHTTHHHHHHHCCHHHHHHHTGGGSSSSCCEEEECCBTTBSSSGGGCCCEEEEETTEEEEEEEEEEEETTTT
T ss_pred             HHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHhCCCceEEEEecCCCCCCCcccceeEEEEeCCEEEEeeEEEeecCCCc
Confidence                               899999999999 899999999999999999999999999999999999999999999999


Q ss_pred             ccEEEEEEEeCCCCCCCceEEEEEeCCCCCeeecccCccCCCCCccceeEEEcceeeCCCCcccCCCchHHHHHHHHhhh
Q psy5138         323 ANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVGEGYKIAAGFLNQG  402 (575)
Q Consensus       323 a~~~~v~a~~~~~~~~~~~~~~lv~~~~~gv~i~~~~~~~G~rg~~s~~l~f~~v~Vp~~~~l~~~~~~~~~~~~~~~~~  402 (575)
                      |||++|.+++++++++.++++|+||++.|||++.+.|+++|+++++++++.||||+||++++||.++.|+......+...
T Consensus       164 Ad~~~v~a~~~~~~~~~g~~~flV~~~~pGv~v~~~~~~~g~r~~~~~~v~fd~v~Vp~~~~lg~~g~g~~~~~~~l~~~  243 (391)
T 2vig_A          164 ASAAVVFASTDRALQNKSISAFLVPMPTPGLTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMG  243 (391)
T ss_dssp             CSEEEEEEECCSSSTTSCEEEEEEESSCTTEEECCCCCBSSCTTSCEEEEEEEEEEEEGGGEESSTTBHHHHHHHHHHHH
T ss_pred             CCEEEEEEEeCCCCCCCceEEEEEeCCCCCeEecCccccccCCCCCeeEEEECcEEECHHHcCCCCCchHHHHHHHHHHH
Confidence            99999999987544556799999999999999999999999999999999999999999999999999999888889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhccccCccCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHH
Q psy5138         403 RIGIAAQMTGLAQGCLDATIPYTLERSQFGHRIFDFQSVQHQISQAATQVECARLLTYNAARLLEAGQPFIKQASMAKYF  482 (575)
Q Consensus       403 r~~~~a~~~G~~~~al~~~~~~~~~r~~~g~~l~~~~~~~~~la~~~~~~~aar~~~~~a~~~~~~~~~~~~~~~~ak~~  482 (575)
                      |+.+++.++|+++++++.+++|+++|++||+||+++|.+|++|++|.++++++|++++++++.++.+.+....++++|++
T Consensus       244 r~~~aa~~~G~a~~al~~a~~ya~~R~~fg~~i~~~q~v~~~la~~~~~~~aar~~~~~aa~~~~~g~~~~~~~~~aK~~  323 (391)
T 2vig_A          244 RIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLA  323 (391)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHCEETTEEGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhCccCCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999877777789999999


Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCcCCcchhhhhhhhcccccccccccccccccccCCChHHHHhhhhccceeccchHHHHH
Q psy5138         483 ASEMAGHITRQCIDWMGGLGFTKDYPQEKFYRDCKMAGHITRQCIDWMGGLGFTKDYPQEKYYRDCKVGTIYEGTSNIQL  562 (575)
Q Consensus       483 ~~~~~~~~~~~~~~~~G~~~~~~~~p~~R~~RD~~~~~~~~~~~~~~~Gg~g~~~~~~~~~~~rd~~~~~~~~G~~~~~~  562 (575)
                      +++.+.++++.++|+                                |||.||+.++++++++||++...+++|++++++
T Consensus       324 a~~~a~~~~~~a~q~--------------------------------~Gg~g~~~~~~~~r~~Rda~~~~i~~G~~~~~~  371 (391)
T 2vig_A          324 ASEAATAISHQAIQI--------------------------------LGGMGYVTEMPAERHYRDARITEIYEGTSEIQR  371 (391)
T ss_dssp             HHHHHHHHHHHHHHH--------------------------------HGGGGGBTTSSHHHHHHHHHHHTTTTSCHHHHH
T ss_pred             HHHHHHHHHHHHHHh--------------------------------hCCeEecCCChHHHHHHHhhcceeecCHHHHHH
Confidence            999999999999999                                999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhc
Q psy5138         563 STIAKYIAKEYT  574 (575)
Q Consensus       563 ~~i~~~~~~~~~  574 (575)
                      ..|++.++++|.
T Consensus       372 ~~ia~~~l~~~~  383 (391)
T 2vig_A          372 LVIAGHLLRSYR  383 (391)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHhhcc
Confidence            999999999885
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 575
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 2e-42
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 1e-41
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 8e-36
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 3e-35
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 1e-33
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 2e-33
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 3e-32
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 2e-31
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 5e-32
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 3e-31
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 1e-30
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 5e-30
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 1e-28
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 1e-28
d1ukwa1152 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydro 3e-28
d1ukwa1152 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydro 1e-13
d1w07a1189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 6e-28
d1w07a1189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 2e-09
d1u8va2275 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase 3e-27
d1u8va2275 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase 3e-27
d1buca1151 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C- 2e-26
d1buca1151 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C- 4e-10
d2d29a1153 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Therm 2e-26
d2d29a1153 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Therm 2e-12
d1w07a3271 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domai 8e-26
d1w07a3271 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domai 8e-25
d2ddha3267 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, 3e-25
d2ddha3267 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, 3e-24
d1jqia1153 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C- 3e-24
d1jqia1153 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C- 2e-07
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 2e-23
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 4e-23
d3mdea1154 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydro 1e-22
d3mdea1154 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydro 6e-08
d2ddha1183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 6e-22
d2ddha1183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 2e-04
d1ivha1151 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, 1e-21
d1ivha1151 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, 3e-06
d1rx0a1153 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase 3e-21
d1rx0a1153 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase 6e-07
d1siqa1154 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GC 2e-19
d1siqa1154 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GC 7e-08
d1r2ja1153 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hy 1e-18
d1r2ja1153 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hy 5e-07
d2c12a1170 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium 2e-16
d2c12a1170 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium 5e-04
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 4e-16
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 4e-16
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 8e-16
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 8e-16
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Isovaleryl-coa dehydrogenase, NM domains
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  150 bits (379), Expect = 2e-42
 Identities = 63/126 (50%), Positives = 83/126 (65%), Gaps = 3/126 (2%)

Query: 263 GTTEQKEKYLPRLAQTDA-GSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNAD 321
           G   QKEKYLP+L   +  G+ A+SEP +GSD  +MK  A K GNHYILNG+K WI+N  
Sbjct: 107 GNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITNGP 166

Query: 322 IANIFLVMANVDV--SKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRV 379
            A++ +V A  D+      RGIT FIVE+ M GFS  KK +KLGM+ S TC L F++ ++
Sbjct: 167 DADVLIVYAKTDLAAVPASRGITAFIVEKGMPGFSTSKKLDKLGMRGSNTCELIFEDCKI 226

Query: 380 PEENII 385
           P  NI+
Sbjct: 227 PAANIL 232
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Length = 152 Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Length = 152 Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Length = 275 Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Length = 275 Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Length = 151 Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Length = 151 Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 153 Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 153 Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 271 Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 271 Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 267 Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 267 Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 153 Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 153 Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 170 Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 170 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query575
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 100.0
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 100.0
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 99.98
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.97
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.97
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.97
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 99.97
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 99.97
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.96
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 99.95
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.94
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.94
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 99.94
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 99.94
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 99.93
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.93
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 99.93
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 99.93
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.92
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 99.92
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.92
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 99.92
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 99.92
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.92
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.92
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.92
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.92
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 99.91
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.91
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 99.9
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 99.9
d1w07a1189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 99.89
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 99.88
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 99.88
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.87
d2ddha1183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 99.86
d1u8va2275 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains 99.79
d1u8va2275 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains 99.78
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 99.32
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 99.31
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.3
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.29
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 99.28
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 99.23
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.19
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 99.13
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.13
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.05
d1w07a1189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 98.61
d2ddha1183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 98.23
d1u8va1215 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal 97.8
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Butyryl-CoA dehydrogenase, NM domains
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=5.5e-33  Score=262.91  Aligned_cols=174  Identities=36%  Similarity=0.639  Sum_probs=166.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHhhhHHHhchhcCCccHHHHHHHHHhCC-------------------------------
Q psy5138         214 PFIKQASMAKYFASVAKLAKETIAPYVQKMESEEKIDETVLKTLFESGL-------------------------------  262 (575)
Q Consensus       214 ~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~G~-------------------------------  262 (575)
                      ++++++.+++  +++++|+.+++.|.+.++|+.+.+|.+.|++|.+.||                               
T Consensus         6 ~L~ee~~~l~--~~~r~f~~~~i~p~a~~~d~~~~~p~e~~~~l~~~Gl~~~~~p~~~GG~g~~~~~~~~~~ee~~~~~~   83 (231)
T d1jqia2           6 ELPETHQMLR--QTCRDFAEKELVPIAAQLDKEHLFPTSQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCA   83 (231)
T ss_dssp             CCCHHHHHHH--HHHHHHHHHHTTTTHHHHHHHTCCCHHHHHHHHHHTTTSSSSCGGGTCCCCCHHHHHHHHHHHHHHCH
T ss_pred             CCCHHHHHHH--HHHHHHHHHhChHHHHHHHhcCCCCHHHHHHHHHhCCcccccccccCCCchhHHHHHHHHHHHHhhcc
Confidence            4689999999  9999999999999999999999999999999999998                               


Q ss_pred             --------------------CCHHHHHhcccc-cCCCceeEEeecCCCCCCccccceeEEEEeCCEEEEeeeeccccCCc
Q psy5138         263 --------------------GTTEQKEKYLPR-LAQTDAGSFALSEPGSGSDAFAMKTTATKDGNHYILNGSKMWISNAD  321 (575)
Q Consensus       263 --------------------g~~~~~~~~l~~-~~~~~~~~~~~te~~~gs~~~~~~~~a~~~~~g~~l~G~k~~~s~~~  321 (575)
                                          |+++|+++||++ +.|+.++++++|||++|||...+.|+|++++++|+|||+|.|+|++.
T Consensus        84 ~~~~~~~~~~~~~~~~l~~~g~~~qk~~~l~~~~~g~~~~~~a~tEp~~gsd~~~~~t~a~~~~~~~~lnG~K~~vt~~~  163 (231)
T d1jqia2          84 STGVIMSVNNSLYLGPILKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLNGTKAWITNSW  163 (231)
T ss_dssp             HHHHHHHHHHHTTHHHHHHHCCHHHHHHHTGGGSSSSCCEEEECCBTTBSSSTTCCCCEEEECSSEEEEEEEEEEEETTT
T ss_pred             ccccceeeeccchhhhhhhcCCHHHHHHHhCcccCCCccccceeccCCCCccCcccceEEEEECCEEEEeeeeeeEeecc
Confidence                                999999999999 99999999999999999999999999999999999999999999999


Q ss_pred             cccEEEEEEEeCCCCCCCceEEEEEeCCCCCeeecccCccCCCCCccceeEEEcceeeCCCCcccCCC
Q psy5138         322 IANIFLVMANVDVSKGYRGITCFIVERSMEGFSVGKKENKLGMKASGTCSLHFDNVRVPEENIISGVG  389 (575)
Q Consensus       322 ~a~~~~v~a~~~~~~~~~~~~~~lv~~~~~gv~i~~~~~~~G~rg~~s~~l~f~~v~Vp~~~~l~~~~  389 (575)
                      .++++++.++++..++..++.+|+||+++|||++.+.|+++|+|++++++|.||||+||++++||+++
T Consensus       164 ~a~~~~v~a~~~~~~~~~g~~~~~Vp~~~~Gv~i~~~~~~~G~r~~~~~~v~fd~v~Vp~~~~lG~~G  231 (231)
T d1jqia2         164 EASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPG  231 (231)
T ss_dssp             TCSEEEEEEESCGGGGGGSEEEEEEESSCTTEEECCCCCBSSCTTSCEEEEEEEEEEEEGGGEESSTT
T ss_pred             cccccccccccccccccCCceEEEEeCCCCCeEECCccCccccCCCceEEEEEeeEEEcHHHCCCCCC
Confidence            99999999998776666789999999999999999999999999999999999999999999999764
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8va1 a.29.3.1 (A:276-490) 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure