Psyllid ID: psy5168

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLCEKE
cccccEEEEEEEccccccccHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccHHHHHHHHcccEEEEEEEccccHHHHHHHHccccccccccccccccccccc
ccccccEEEEEEcHHHHHcccHHHHHHHHHHHccEEEEEccEcccHHHHHHHcHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHcccc
maepkertflmikpdgvqrglVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYsdlatkpffpglvkymssgpvvpmcwarpevqrprraqrrplrppnrpdlgapadlceke
maepkertflmikpdgvqrglVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARpevqrprraqrrplrppnrpdlgapadlceke
MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWArpevqrprraqrrplrppnrpDLGAPADLCEKE
********FLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWAR********************************
****KERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLCE**
MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLCEKE
****KERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLG*P*DLCEK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLCEKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
P08879153 Nucleoside diphosphate ki no N/A 0.973 0.718 0.581 3e-32
Q6XI71150 Nucleoside diphosphate ki N/A N/A 0.938 0.706 0.584 3e-31
O57535153 Nucleoside diphosphate ki yes N/A 0.973 0.718 0.590 4e-30
Q90380153 Nucleoside diphosphate ki N/A N/A 0.973 0.718 0.581 5e-30
Q3T0Q4152 Nucleoside diphosphate ki yes N/A 0.929 0.690 0.609 1e-29
P70011154 Nucleoside diphosphate ki N/A N/A 0.973 0.714 0.554 2e-29
Q5RFH3152 Nucleoside diphosphate ki yes N/A 0.929 0.690 0.6 3e-29
Q2EN76152 Nucleoside diphosphate ki yes N/A 0.929 0.690 0.590 3e-29
P70010154 Nucleoside diphosphate ki N/A N/A 0.973 0.714 0.554 5e-29
P22392152 Nucleoside diphosphate ki no N/A 0.929 0.690 0.6 6e-29
>sp|P08879|NDKA_DROME Nucleoside diphosphate kinase OS=Drosophila melanogaster GN=awd PE=1 SV=3 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 77/110 (70%)

Query: 1   MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60
           MA  KERTF+M+KPDGVQRGLVG II+RFE KGFKLVA+KF W S+ELL++HY+DL+ +P
Sbjct: 1   MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARP 60

Query: 61  FFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLC 110
           FFPGLV YM+SGPVVPM W    V +  R       P +        D C
Sbjct: 61  FFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFC 110
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|Q6XI71|NDKA_DROYA Nucleoside diphosphate kinase (Fragment) OS=Drosophila yakuba GN=awd PE=2 SV=1 Back     alignment and function description
>sp|O57535|NDK_CHICK Nucleoside diphosphate kinase OS=Gallus gallus PE=2 SV=1 Back     alignment and function description
>sp|Q90380|NDK_COLLI Nucleoside diphosphate kinase OS=Columba livia PE=2 SV=2 Back     alignment and function description
>sp|Q3T0Q4|NDKB_BOVIN Nucleoside diphosphate kinase B OS=Bos taurus GN=NME2 PE=1 SV=1 Back     alignment and function description
>sp|P70011|NDKA2_XENLA Nucleoside diphosphate kinase A2 OS=Xenopus laevis PE=2 SV=1 Back     alignment and function description
>sp|Q5RFH3|NDKB_PONAB Nucleoside diphosphate kinase B OS=Pongo abelii GN=NME2 PE=2 SV=1 Back     alignment and function description
>sp|Q2EN76|NDKB_PIG Nucleoside diphosphate kinase B OS=Sus scrofa GN=NME2 PE=2 SV=1 Back     alignment and function description
>sp|P70010|NDKA1_XENLA Nucleoside diphosphate kinase A1 OS=Xenopus laevis PE=2 SV=1 Back     alignment and function description
>sp|P22392|NDKB_HUMAN Nucleoside diphosphate kinase B OS=Homo sapiens GN=NME2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
110671458153 putative abnormal wing disc-like protein 0.973 0.718 0.754 8e-41
189235892169 PREDICTED: similar to putative nucleosid 0.973 0.650 0.672 4e-36
270003279154 hypothetical protein TcasGA2_TC002492 [T 0.973 0.714 0.672 6e-36
389608603153 nucleoside-diphosphate kinase NBR-A [Pap 0.973 0.718 0.672 6e-36
389611091153 nucleoside-diphosphate kinase NBR-A [Pap 0.973 0.718 0.663 1e-35
294459457153 abnormal wing disc protein [Antheraea pe 0.973 0.718 0.663 3e-35
153791847154 abnormal wing disc-like protein [Bombyx 0.973 0.714 0.654 6e-35
357625368153 abnormal wing disc-like protein [Danaus 0.973 0.718 0.645 2e-34
307173082170 Nucleoside diphosphate kinase [Camponotu 0.973 0.647 0.636 4e-34
328777933171 PREDICTED: nucleoside diphosphate kinase 0.973 0.643 0.636 6e-34
>gi|110671458|gb|ABG81980.1| putative abnormal wing disc-like protein [Diaphorina citri] Back     alignment and taxonomy information
 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 86/110 (78%)

Query: 1   MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60
           MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP
Sbjct: 1   MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60

Query: 61  FFPGLVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRPPNRPDLGAPADLC 110
           FFPGLVKYMSSGPVVPM W    + +  R       P +        DLC
Sbjct: 61  FFPGLVKYMSSGPVVPMVWEGLNIVKTGRVMLGATNPADSAPGTVRGDLC 110

Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189235892|ref|XP_967503.2| PREDICTED: similar to putative nucleoside diphosphate kinase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270003279|gb|EEZ99726.1| hypothetical protein TcasGA2_TC002492 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|389608603|dbj|BAM17911.1| nucleoside-diphosphate kinase NBR-A [Papilio xuthus] Back     alignment and taxonomy information
>gi|389611091|dbj|BAM19156.1| nucleoside-diphosphate kinase NBR-A [Papilio polytes] Back     alignment and taxonomy information
>gi|294459457|gb|ADE75591.1| abnormal wing disc protein [Antheraea pernyi] Back     alignment and taxonomy information
>gi|153791847|ref|NP_001093284.1| abnormal wing disc-like protein [Bombyx mori] gi|95103130|gb|ABF51506.1| abnormal wing disc-like protein [Bombyx mori] Back     alignment and taxonomy information
>gi|357625368|gb|EHJ75834.1| abnormal wing disc-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|307173082|gb|EFN64212.1| Nucleoside diphosphate kinase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328777933|ref|XP_393351.3| PREDICTED: nucleoside diphosphate kinase [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
FB|FBgn0000150153 awd "abnormal wing discs" [Dro 0.699 0.516 0.746 6.2e-30
UNIPROTKB|Q6XI71150 awd "Nucleoside diphosphate ki 0.663 0.5 0.76 2.7e-29
UNIPROTKB|O57535153 O57535 "Nucleoside diphosphate 0.699 0.516 0.759 1e-27
UNIPROTKB|F1MPL4114 NME2 "Nucleoside diphosphate k 0.654 0.649 0.797 1e-27
UNIPROTKB|Q3T0Q4152 NME2 "Nucleoside diphosphate k 0.654 0.486 0.797 1e-27
UNIPROTKB|Q2EN76152 NME2 "Nucleoside diphosphate k 0.654 0.486 0.770 3.5e-27
ZFIN|ZDB-GENE-030131-7656170 nme2a "non-metastatic cells 2a 0.699 0.464 0.721 5.7e-27
UNIPROTKB|Q32Q12292 NME1-NME2 "Nucleoside diphosph 0.654 0.253 0.783 7.3e-27
UNIPROTKB|P22392152 NME2 "Nucleoside diphosphate k 0.654 0.486 0.783 7.3e-27
MGI|MGI:97356152 Nme2 "NME/NM23 nucleoside diph 0.654 0.486 0.783 7.3e-27
FB|FBgn0000150 awd "abnormal wing discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 6.2e-30, P = 6.2e-30
 Identities = 59/79 (74%), Positives = 70/79 (88%)

Query:     1 MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60
             MA  KERTF+M+KPDGVQRGLVG II+RFE KGFKLVA+KF W S+ELL++HY+DL+ +P
Sbjct:     1 MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARP 60

Query:    61 FFPGLVKYMSSGPVVPMCW 79
             FFPGLV YM+SGPVVPM W
Sbjct:    61 FFPGLVNYMNSGPVVPMVW 79
GO:0004550 "nucleoside diphosphate kinase activity" evidence=ISS;NAS;IMP;IDA
GO:0007017 "microtubule-based process" evidence=IMP
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=ISS;IMP
GO:0008017 "microtubule binding" evidence=IDA
GO:0005874 "microtubule" evidence=NAS;IDA
GO:0007067 "mitosis" evidence=IMP
GO:0005524 "ATP binding" evidence=IDA
GO:0016301 "kinase activity" evidence=IDA
GO:0000287 "magnesium ion binding" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IMP;IDA
GO:0018105 "peptidyl-serine phosphorylation" evidence=IDA
GO:0005525 "GTP binding" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0006183 "GTP biosynthetic process" evidence=ISS;NAS
GO:0006241 "CTP biosynthetic process" evidence=ISS;NAS
GO:0006228 "UTP biosynthetic process" evidence=ISS;NAS
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IEP;IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0034332 "adherens junction organization" evidence=IMP
GO:0035152 "regulation of tube architecture, open tracheal system" evidence=IMP
UNIPROTKB|Q6XI71 awd "Nucleoside diphosphate kinase" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|O57535 O57535 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPL4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0Q4 NME2 "Nucleoside diphosphate kinase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2EN76 NME2 "Nucleoside diphosphate kinase B" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7656 nme2a "non-metastatic cells 2a, protein (NM23B) expressed in" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q32Q12 NME1-NME2 "Nucleoside diphosphate kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22392 NME2 "Nucleoside diphosphate kinase B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97356 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3M7K5NDK_ANAVT2, ., 7, ., 4, ., 60.64860.65480.4966yesN/A
Q5V5M1NDK_HALMA2, ., 7, ., 4, ., 60.45710.89380.6558yesN/A
P61136NDK_HALSA2, ., 7, ., 4, ., 60.50560.78760.5527yesN/A
Q2EN76NDKB_PIG2, ., 7, ., 1, 3, ., 30.59040.92920.6907yesN/A
O49203NDK3_ARATH2, ., 7, ., 4, ., 60.53930.78760.3739yesN/A
Q50KA8NDKB_CANFA2, ., 7, ., 1, 3, ., 30.56600.93800.6973yesN/A
Q8TFN0NDK_EMENI2, ., 7, ., 4, ., 60.63950.76100.5620yesN/A
Q5RFH3NDKB_PONAB2, ., 7, ., 1, 3, ., 30.60.92920.6907yesN/A
Q2JVI1NDK_SYNJA2, ., 7, ., 4, ., 60.60810.65480.4966yesN/A
Q3AFJ7NDK_CARHZ2, ., 7, ., 4, ., 60.48620.87610.6644yesN/A
Q01768NDKB_MOUSE2, ., 7, ., 1, 3, ., 30.60.92920.6907yesN/A
Q07661NDK1_ORYSJ2, ., 7, ., 4, ., 60.51920.88490.6711yesN/A
Q7Z8P9NDK_ASPFU2, ., 7, ., 4, ., 60.59300.76100.5620yesN/A
Q8DM56NDK_THEEB2, ., 7, ., 4, ., 60.64860.65480.4933yesN/A
Q0W8X1NDK_UNCMA2, ., 7, ., 4, ., 60.64860.65480.4868yesN/A
Q8YRP2NDK_NOSS12, ., 7, ., 4, ., 60.64860.65480.4966yesN/A
P19804NDKB_RAT2, ., 7, ., 1, 3, ., 30.60.92920.6907yesN/A
Q75DD1NDK_ASHGO2, ., 7, ., 4, ., 60.50.83180.6225yesN/A
Q3T0Q4NDKB_BOVIN2, ., 7, ., 1, 3, ., 30.60950.92920.6907yesN/A
O57535NDK_CHICK2, ., 7, ., 4, ., 60.59090.97340.7189yesN/A
P36010NDK_YEAST2, ., 7, ., 4, ., 60.45870.92920.6862yesN/A
B0R502NDK_HALS32, ., 7, ., 4, ., 60.50560.78760.5527yesN/A
B0TBN6NDK_HELMI2, ., 7, ., 4, ., 60.55910.82300.6241yesN/A
B8HUM7NDK_CYAP42, ., 7, ., 4, ., 60.54250.83180.6308yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.921
4th Layer2.7.4.60.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 1e-49
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 2e-47
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 3e-45
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 1e-44
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 2e-40
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 5e-40
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 8e-34
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 8e-32
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 3e-22
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 7e-21
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 2e-19
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 1e-16
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 2e-16
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 4e-16
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 3e-14
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 8e-14
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 3e-12
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 8e-12
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 2e-10
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 7e-09
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information 
 Score =  153 bits (390), Expect = 1e-49
 Identities = 44/79 (55%), Positives = 58/79 (73%)

Query: 6  ERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGL 65
          ERT ++IKPDGVQRGL+G II RFE KG K+VA+K +  +EEL ++HY++   KPFFP L
Sbjct: 1  ERTLVIIKPDGVQRGLIGEIISRFERKGLKIVALKMLQLTEELAEEHYAEHKGKPFFPEL 60

Query: 66 VKYMSSGPVVPMCWARPEV 84
          V++M+SGPVV M       
Sbjct: 61 VEFMTSGPVVAMVLEGENA 79

The mammalian nm23/NDP kinase gene family can be divided into two distinct groups. The group I genes encode proteins that generally have highly homologous counterparts in other organisms and possess the classic enzymatic activity of a kinase. This group includes vertebrate NDP kinases A-D (Nm23- H1 to -H4), and its counterparts in bacteria, archea and other eukaryotes. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. They possess the NDP kinase active site motif (NXXH[G/A]SD) and the nine residues that are most essential for catalysis. Length = 130
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
KOG0888|consensus156 100.0
PF1445465 Prok_Ub: Prokaryotic Ubiquitin 88.09
TIGR0373866 PRTRC_C PRTRC system protein C. A novel genetic sy 86.84
COG1799167 Uncharacterized protein conserved in bacteria [Fun 81.38
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2e-42  Score=227.83  Aligned_cols=108  Identities=42%  Similarity=0.648  Sum_probs=106.5

Q ss_pred             ceeEEEEEcCcceecCchHHHHHHHHHCCCeEEEEEEecCCHHHHHHHHHHhcCCCCCcccccccccCCeEEEEEecCCc
Q psy5168           5 KERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPEV   84 (113)
Q Consensus         5 ~e~tl~liKPd~~~~~~~g~Ii~~i~~~g~~I~~~k~~~l~~~~a~~~y~~~~~~~~~~~lv~~~~sgp~v~l~l~g~na   84 (113)
                      +|+||+|||||+++++++|+|+++++++||+|+++||+++++++|++||..|+++|||.+|++||+|||+++++|+|+||
T Consensus         2 ~erT~~iiKPDaV~R~LIG~IisrfE~~Glkiva~K~~~~~~e~Ae~~Y~~h~~kpFf~~Lv~fitSgPvv~~VleGe~a   81 (135)
T COG0105           2 MERTLSIIKPDAVKRGLIGEIISRFEKKGLKIVALKMVQLSRELAENHYAEHKGKPFFGELVEFITSGPVVAMVLEGENA   81 (135)
T ss_pred             cceEEEEECcchhhhhhHHHHHHHHHHCCCEEEeeeeeccCHHHHHHHHHHHcCCCccHHHHhheecCcEEEEEEecHhH
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHhhhCCCCCCCCCCCCCccccccC
Q psy5168          85 QRPRRAQRRPLRPPNRPDLGAPADLCEK  112 (113)
Q Consensus        85 v~~~r~l~G~~~~~~A~p~slr~~~g~~  112 (113)
                      |+.+|.++|+|||..|.|||||++|+.+
T Consensus        82 i~~~R~l~GaTnp~~A~pGTIRgdfa~~  109 (135)
T COG0105          82 ISVVRKLMGATNPANAAPGTIRGDFALS  109 (135)
T ss_pred             HHHHHHHHCCCCcccCCCCeEeeehhcc
Confidence            9999999999999999999999999975

>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information
>PF14454 Prok_Ub: Prokaryotic Ubiquitin Back     alignment and domain information
>TIGR03738 PRTRC_C PRTRC system protein C Back     alignment and domain information
>COG1799 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 2e-32
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 3e-32
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 4e-29
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 4e-29
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 4e-29
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 5e-28
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 1e-27
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 3e-27
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 3e-27
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 3e-27
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 6e-27
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-27
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 1e-26
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-26
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 2e-25
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 3e-25
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 6e-25
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 1e-23
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-23
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 1e-23
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 8e-23
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 1e-22
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 1e-22
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 1e-22
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-22
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-22
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 5e-22
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 2e-20
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 2e-20
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 2e-20
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 2e-20
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 2e-20
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 2e-20
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 2e-20
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 2e-20
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 2e-20
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 2e-20
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 7e-20
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 8e-20
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 1e-19
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 1e-19
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 5e-19
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 3e-18
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-17
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 3e-16
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 2e-15
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 4e-15
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 1e-14
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 1e-13
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 4e-13
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 8e-13
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 8e-13
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 1e-12
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 1e-12
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 1e-12
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 1e-12
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 6e-12
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 7e-12
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 7e-12
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 8e-12
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 8e-12
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 1e-11
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 7e-11
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 1e-10
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 9e-08
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure 
Iteration: 1

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/79 (74%), Positives = 70/79 (88%)
Query: 1  MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60
          MA  KERTF+M+KPDGVQRGLVG II+RFE KGFKLVA+KF W S+ELL++HY+DL+ +P
Sbjct: 1  MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARP 60
Query: 61 FFPGLVKYMSSGPVVPMCW 79
          FFPGLV YM+SGPVVPM W
Sbjct: 61 FFPGLVNYMNSGPVVPMVW 79
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 9e-53
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 1e-52
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 2e-52
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 2e-52
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 4e-52
3js9_A156 Nucleoside diphosphate kinase family protein; niai 4e-52
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 6e-52
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 6e-52
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 7e-52
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 8e-52
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 1e-51
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 1e-51
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 1e-51
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 1e-51
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 2e-51
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 4e-51
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 6e-51
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 6e-51
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 6e-51
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 8e-51
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 1e-50
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 2e-50
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 4e-50
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 8e-50
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 4e-49
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 5e-49
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 1e-48
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 8e-48
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 2e-40
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
 Score =  161 bits (411), Expect = 9e-53
 Identities = 43/79 (54%), Positives = 58/79 (73%)

Query: 1  MAEPKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKP 60
          M+   ERTF+ +KPDGVQRGLV  I+ RFE KG+KLVA+K V   ++LL+QHY++   KP
Sbjct: 9  MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKP 68

Query: 61 FFPGLVKYMSSGPVVPMCW 79
          FFP +V +M SGP++   W
Sbjct: 69 FFPKMVSFMKSGPILATVW 87
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.94
3p04_A87 Uncharacterized BCR; SEPF homolog, DUF552, PSI-bio 83.04
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-44  Score=243.85  Aligned_cols=109  Identities=31%  Similarity=0.499  Sum_probs=107.0

Q ss_pred             CceeEEEEEcCcceecCchHHHHHHHHHCCCeEEEEEEecCCHHHHHHHHHHhcCCCCCcccccccccCCeEEEEEecCC
Q psy5168           4 PKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPE   83 (113)
Q Consensus         4 ~~e~tl~liKPd~~~~~~~g~Ii~~i~~~g~~I~~~k~~~l~~~~a~~~y~~~~~~~~~~~lv~~~~sgp~v~l~l~g~n   83 (113)
                      .+|+||+|||||++.++++|+||++|+++||.|+++|++++|+++|++||.+|.++|||++|++||+||||++++|+|+|
T Consensus         6 ~~ErTl~iIKPDav~~~l~g~Ii~rie~~Gf~I~~~k~~~lt~e~a~~fY~~h~~kpff~~Lv~~mtSGPvva~vleg~~   85 (145)
T 4hr2_A            6 ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGED   85 (145)
T ss_dssp             CEEEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEEEET
T ss_pred             hHHHeEEEEChHHhhcCCHHHHHHHHHHCCCEEEEEeeecCCHHHHHHHHHHHhcCchHHHHHHHhcCCCEEEEEEEcCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhHhhhCCCCCCCCCCCCCccccccC
Q psy5168          84 VQRPRRAQRRPLRPPNRPDLGAPADLCEK  112 (113)
Q Consensus        84 av~~~r~l~G~~~~~~A~p~slr~~~g~~  112 (113)
                      ||+.||+++|||||.+|+|+|||++||++
T Consensus        86 aV~~~R~l~G~tdp~~A~pgtIR~~fg~~  114 (145)
T 4hr2_A           86 AILKNRDLMGATDPKKAEKGTIRADFADS  114 (145)
T ss_dssp             HHHHHHHHHCCSSTTTSCTTSHHHHHCSB
T ss_pred             cHhHHhhccCCCCcccCCCCCcHHHhcCC
Confidence            99999999999999999999999999986
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure
>3p04_A Uncharacterized BCR; SEPF homolog, DUF552, PSI-biology, NESG, structural genomics structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 6e-34
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 2e-33
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 7e-33
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-32
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-31
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 6e-31
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 7e-31
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 1e-30
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 5e-30
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-29
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-29
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 3e-29
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-29
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-29
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 4e-28
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 9e-26
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human(Homo sapiens), NDK3 [TaxId: 9606]

 Score =  112 bits (282), Expect = 6e-34
 Identities = 55/93 (59%), Positives = 67/93 (72%)

Query: 5  KERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPG 64
           ERTFL +KPDGVQR LVG I++RFE KGFKLVA+K V  SEELL++HY++L  +PF+  
Sbjct: 4  HERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGR 63

Query: 65 LVKYMSSGPVVPMCWARPEVQRPRRAQRRPLRP 97
          LVKYM+SGPVV M W   +V R  RA      P
Sbjct: 64 LVKYMASGPVVAMVWQGLDVVRTSRALIGATNP 96
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]

Probab=100.00  E-value=2.1e-43  Score=236.62  Aligned_cols=109  Identities=45%  Similarity=0.787  Sum_probs=106.9

Q ss_pred             CceeEEEEEcCcceecCchHHHHHHHHHCCCeEEEEEEecCCHHHHHHHHHHhcCCCCCcccccccccCCeEEEEEecCC
Q psy5168           4 PKERTFLMIKPDGVQRGLVGNIIKRFEDKGFKLVAMKFVWPSEELLKQHYSDLATKPFFPGLVKYMSSGPVVPMCWARPE   83 (113)
Q Consensus         4 ~~e~tl~liKPd~~~~~~~g~Ii~~i~~~g~~I~~~k~~~l~~~~a~~~y~~~~~~~~~~~lv~~~~sgp~v~l~l~g~n   83 (113)
                      ..|+||+|||||++.++++|+||++|+++||.|+++|+++||+++|++||.+|.+++||+++++||+||||++++|.|+|
T Consensus         4 ~~E~Tl~iIKPDav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~m~sGp~~a~~l~g~n   83 (143)
T d1ehwa_           4 TRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYN   83 (143)
T ss_dssp             GGCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTT
T ss_pred             ccceEEEEECchhhhcCCHHHHHHHHHHcCCEEeeeeeeecCHHHHHHHHHHHhcchhhhhhhheecCCCEEEEecchhh
Confidence            46999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhHhhhCCCCCCCCCCCCCccccccC
Q psy5168          84 VQRPRRAQRRPLRPPNRPDLGAPADLCEK  112 (113)
Q Consensus        84 av~~~r~l~G~~~~~~A~p~slr~~~g~~  112 (113)
                      ||..||+++||+||.+|+|+|||+.||++
T Consensus        84 aV~~~R~l~Gpt~p~~a~p~siR~~yg~~  112 (143)
T d1ehwa_          84 VVRASRAMIGHTDSAEAAPGTIRGDFSVH  112 (143)
T ss_dssp             HHHHHHHHHCCSSGGGSCTTSHHHHHCCC
T ss_pred             HHHHHHHHhcCCCcccCCCCCcHhhhhCc
Confidence            99999999999999999999999999986
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure