Psyllid ID: psy5180


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
EPTPDPFADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRYSCDILVVSNAKQSKSLSNIRMCINCS
cccccccccHHccHHHHHHHcccccccccccccccccccHHHHHHHHHccccEEEEccccccccEEEEEEEccEEEEEEEEEEEEccccccccEEEEEcccccccHHHHHHHHHHcccccEEccEEEEcccccccccccccEEEEcccccccccccEEEEcccccccccHHHHHHccccccccccEEEEEEc
cccccccccHHHccccHHHHccccHHHHHccccHcccccHHHHHHHHHccccEEEEEcccccccEEEEEEccccccEEEEEEEEEEccccccccEEEEcccccccHHHHHHHHHHccccEEccccEEEEcccccccccEEEEEEccccccccccccEEEEEccccccHHHEEHcccccccccccccEEEccc
eptpdpfadplQLKKALEWELsldnrdlrshawyhgaiprsraEEIIENEGdflirdctsqpgnyvlscmsktqYLHFVINKVVIQPDTVYERVQFQfeddlfdtvpdLITFYVVIQPDTVYERVQFQfeddlfdtvpdlITFYvgsgkpisslsgakikspknryscDILVVSNakqskslsnirmcincs
eptpdpfadplQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVgsgkpisslsgakikspknrYSCDILVVsnakqskslsnirmcincs
EPTPDPFADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRYSCDILVVSNAKQSKSLSNIRMCINCS
**************KALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPI************NRYSCDILVVS******************
*****PF************************AWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVG**K**SSLSGAKIKSPKNRYSCDI***************RMCIN**
********DPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRYSCDILVVSNAKQSKSLSNIRMCINCS
******FADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRYSCDILVVSNAKQSKSLSNIR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EPTPDPFADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRYSCDILVVSNAKQSKSLSNIRMCINCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
Q6INP9 806 Breast cancer anti-estrog N/A N/A 0.473 0.112 0.538 2e-24
Q4R8R1 825 Breast cancer anti-estrog N/A N/A 0.562 0.130 0.410 3e-24
O75815 825 Breast cancer anti-estrog yes N/A 0.562 0.130 0.410 3e-24
Q9QZK2 820 Breast cancer anti-estrog yes N/A 0.562 0.131 0.410 3e-24
Q58DL5 826 Breast cancer anti-estrog no N/A 0.562 0.130 0.395 1e-22
Q8N5H7 860 SH2 domain-containing pro no N/A 0.562 0.125 0.402 2e-22
Q9QZS8 854 SH2 domain-containing pro no N/A 0.562 0.126 0.395 9e-22
Q9BRG2 576 SH2 domain-containing pro no N/A 0.479 0.159 0.369 3e-15
P70451 823 Tyrosine-protein kinase F no N/A 0.437 0.102 0.419 1e-14
P09760 823 Tyrosine-protein kinase F no N/A 0.437 0.102 0.408 4e-14
>sp|Q6INP9|BCAR3_XENLA Breast cancer anti-estrogen resistance protein 3 homolog OS=Xenopus laevis GN=bcar3 PE=2 SV=1 Back     alignment and function desciption
 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 65/91 (71%)

Query: 24  DNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKV 83
           ++ DLRSHAWYHG IPR  +E +++ +GDFLIRD  S PGN VL+C  K    HF INKV
Sbjct: 143 NSEDLRSHAWYHGRIPRQVSESLVKRDGDFLIRDSLSSPGNLVLTCQWKNLSQHFKINKV 202

Query: 84  VIQPDTVYERVQFQFEDDLFDTVPDLITFYV 114
           VI+ +  Y R+Q+Q E + FD++P L+ FYV
Sbjct: 203 VIRLNEAYCRIQYQLEHESFDSIPALVRFYV 233




May act as an adapter protein.
Xenopus laevis (taxid: 8355)
>sp|Q4R8R1|BCAR3_MACFA Breast cancer anti-estrogen resistance protein 3 OS=Macaca fascicularis GN=BCAR3 PE=2 SV=2 Back     alignment and function description
>sp|O75815|BCAR3_HUMAN Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens GN=BCAR3 PE=1 SV=1 Back     alignment and function description
>sp|Q9QZK2|BCAR3_MOUSE Breast cancer anti-estrogen resistance protein 3 OS=Mus musculus GN=Bcar3 PE=1 SV=1 Back     alignment and function description
>sp|Q58DL5|BCAR3_BOVIN Breast cancer anti-estrogen resistance protein 3 OS=Bos taurus GN=BCAR3 PE=2 SV=2 Back     alignment and function description
>sp|Q8N5H7|SH2D3_HUMAN SH2 domain-containing protein 3C OS=Homo sapiens GN=SH2D3C PE=1 SV=1 Back     alignment and function description
>sp|Q9QZS8|SH2D3_MOUSE SH2 domain-containing protein 3C OS=Mus musculus GN=Sh2d3c PE=1 SV=1 Back     alignment and function description
>sp|Q9BRG2|SH23A_HUMAN SH2 domain-containing protein 3A OS=Homo sapiens GN=SH2D3A PE=1 SV=1 Back     alignment and function description
>sp|P70451|FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus GN=Fer PE=1 SV=2 Back     alignment and function description
>sp|P09760|FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus GN=Fer PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
189242263 876 PREDICTED: similar to AGAP009560-PA, par 0.697 0.152 0.636 3e-55
270015784 767 hypothetical protein TcasGA2_TC004107 [T 0.697 0.174 0.636 4e-55
242011168 792 conserved hypothetical protein [Pediculu 0.697 0.169 0.618 5e-52
195473729 943 GE18960 [Drosophila yakuba] gi|194175246 0.807 0.164 0.542 8e-50
24582092 753 CG9098, isoform B [Drosophila melanogast 0.807 0.205 0.542 8e-50
194857013 944 GG24262 [Drosophila erecta] gi|190660745 0.807 0.164 0.542 8e-50
17863024 944 SD09109p [Drosophila melanogaster] gi|22 0.807 0.164 0.542 8e-50
195576894 944 GD22611 [Drosophila simulans] gi|1941903 0.807 0.164 0.542 9e-50
24582090 944 CG9098, isoform A [Drosophila melanogast 0.807 0.164 0.542 9e-50
158288244 940 AGAP009560-PA [Anopheles gambiae str. PE 0.807 0.164 0.540 4e-49
>gi|189242263|ref|XP_967708.2| PREDICTED: similar to AGAP009560-PA, partial [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/165 (63%), Positives = 121/165 (73%), Gaps = 31/165 (18%)

Query: 1   EPTPDPFADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTS 60
           EPT DP  + L+LKKALEWELSLD+RDLRSHAWYHGAIPRSRAE+I+  EG FL+RDCTS
Sbjct: 144 EPTADPSMNSLELKKALEWELSLDSRDLRSHAWYHGAIPRSRAEDIVREEGGFLVRDCTS 203

Query: 61  QPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDT 120
           QPGNYVL+C +KTQ LHFVINK+++QPDTVYE VQFQFE+D FDTVPDLIT         
Sbjct: 204 QPGNYVLTCRTKTQPLHFVINKIILQPDTVYEHVQFQFEEDAFDTVPDLIT--------- 254

Query: 121 VYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNR 165
                                 FYVGSGKPI++ SGA+I+ PKNR
Sbjct: 255 ----------------------FYVGSGKPITAASGARIQFPKNR 277




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270015784|gb|EFA12232.1| hypothetical protein TcasGA2_TC004107 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242011168|ref|XP_002426327.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510404|gb|EEB13589.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195473729|ref|XP_002089145.1| GE18960 [Drosophila yakuba] gi|194175246|gb|EDW88857.1| GE18960 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24582092|ref|NP_723142.1| CG9098, isoform B [Drosophila melanogaster] gi|442626283|ref|NP_001260121.1| CG9098, isoform C [Drosophila melanogaster] gi|17862626|gb|AAL39790.1| LD41184p [Drosophila melanogaster] gi|22945724|gb|AAN10570.1| CG9098, isoform B [Drosophila melanogaster] gi|220946852|gb|ACL85969.1| CG9098-PB [synthetic construct] gi|440213417|gb|AGB92657.1| CG9098, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194857013|ref|XP_001968878.1| GG24262 [Drosophila erecta] gi|190660745|gb|EDV57937.1| GG24262 [Drosophila erecta] Back     alignment and taxonomy information
>gi|17863024|gb|AAL39989.1| SD09109p [Drosophila melanogaster] gi|220951530|gb|ACL88308.1| CG9098-PB [synthetic construct] Back     alignment and taxonomy information
>gi|195576894|ref|XP_002078308.1| GD22611 [Drosophila simulans] gi|194190317|gb|EDX03893.1| GD22611 [Drosophila simulans] Back     alignment and taxonomy information
>gi|24582090|ref|NP_608979.2| CG9098, isoform A [Drosophila melanogaster] gi|22945723|gb|AAF52322.2| CG9098, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158288244|ref|XP_310126.4| AGAP009560-PA [Anopheles gambiae str. PEST] gi|157019156|gb|EAA05895.5| AGAP009560-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
FB|FBgn0031762 944 CG9098 [Drosophila melanogaste 0.833 0.169 0.573 5e-44
UNIPROTKB|E1C3C2 824 BCAR3 "Uncharacterized protein 0.546 0.127 0.533 3.4e-26
UNIPROTKB|Q5TEW3 734 BCAR3 "Breast cancer anti-estr 0.546 0.143 0.523 9.1e-26
RGD|1311688 819 Bcar3 "breast cancer anti-estr 0.546 0.128 0.523 1.2e-25
MGI|MGI:1352501 820 Bcar3 "breast cancer anti-estr 0.546 0.128 0.523 1.2e-25
UNIPROTKB|O75815 825 BCAR3 "Breast cancer anti-estr 0.546 0.127 0.523 1.2e-25
ZFIN|ZDB-GENE-080513-4 912 bcar3 "breast cancer anti-estr 0.546 0.115 0.523 3e-25
UNIPROTKB|E2RR67 816 BCAR3 "Uncharacterized protein 0.546 0.128 0.514 3.1e-25
UNIPROTKB|Q58DL5 826 BCAR3 "Breast cancer anti-estr 0.546 0.127 0.504 2.9e-24
UNIPROTKB|F1S536 825 BCAR3 "Uncharacterized protein 0.546 0.127 0.504 4.8e-24
FB|FBgn0031762 CG9098 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 473 (171.6 bits), Expect = 5.0e-44, P = 5.0e-44
 Identities = 97/169 (57%), Positives = 120/169 (71%)

Query:     1 EPTPDPFADPLQLKKALEWELSLDNRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTS 60
             +P+P    + + LKKALEWELSLD R+LRSHAWYHGA+PR RAEEI++ EGDFL+RDC S
Sbjct:   208 QPSPSEQQEAIALKKALEWELSLDARELRSHAWYHGALPRQRAEEIVQREGDFLVRDCAS 267

Query:    61 QPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVVI-QPD 119
             QP NYVLSC SK   LHFV+NK+V+QP+TVYERVQ+QFE+D FDTVPDLITFYV   +P 
Sbjct:   268 QPDNYVLSCRSKAAVLHFVLNKLVLQPETVYERVQYQFEEDAFDTVPDLITFYVGSGKPI 327

Query:   120 TVYERVQFQFEDDLFDTVPDLITFY----VGSGKPISSLSGAKIKSPKN 164
             +       QF  +   T P  ++FY    VG+      L+G +  SP N
Sbjct:   328 SSASGALIQFPCNR--TYP--LSFYGHKIVGNQLHTQMLAGLRGLSPLN 372


GO:0005070 "SH3/SH2 adaptor activity" evidence=ISS
GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|E1C3C2 BCAR3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TEW3 BCAR3 "Breast cancer anti-estrogen resistance 3, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311688 Bcar3 "breast cancer anti-estrogen resistance 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1352501 Bcar3 "breast cancer anti-estrogen resistance 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O75815 BCAR3 "Breast cancer anti-estrogen resistance protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080513-4 bcar3 "breast cancer anti-estrogen resistance 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR67 BCAR3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DL5 BCAR3 "Breast cancer anti-estrogen resistance protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S536 BCAR3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
cd10337136 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in 9e-56
smart0025284 smart00252, SH2, Src homology 2 domains 1e-20
cd1036190 cd10361, SH2_Fps_family, Src homology 2 (SH2) doma 5e-18
pfam0001777 pfam00017, SH2, SH2 domain 3e-17
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 3e-16
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 2e-15
cd09925104 cd09925, SH2_SHC, Src homology 2 (SH2) domain foun 5e-15
cd1035291 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 1e-11
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 1e-11
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 2e-10
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 5e-10
cd10343103 cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou 7e-09
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 1e-08
cd10397106 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain 1e-08
cd09934104 cd09934, SH2_Tec_family, Src homology 2 (SH2) doma 2e-08
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 5e-08
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 5e-08
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 7e-08
cd09944108 cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom 1e-07
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 1e-07
cd09938104 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src 2e-07
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 2e-07
cd10356113 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai 2e-07
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 4e-07
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 7e-07
cd10396108 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain 9e-07
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 9e-07
cd09946102 cd09946, SH2_HSH2_like, Src homology 2 domain foun 1e-06
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 1e-06
cd1038997 cd10389, SH2_SHB, Src homology 2 domain found in S 1e-06
cd1034977 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f 2e-06
cd1039298 cd10392, SH2_SHF, Src homology 2 domain found in S 6e-06
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 1e-05
cd10398106 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain 1e-05
cd10399106 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain 1e-05
cd1034697 cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom 3e-05
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 3e-05
cd10417102 cd10417, SH2_SH2D7, Src homology 2 domain found in 3e-05
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 3e-05
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 3e-05
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 3e-05
cd10351103 cd10351, SH2_SH2D4B, Src homology 2 domain found i 4e-05
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 5e-05
cd10415108 cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo 6e-05
cd10413108 cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou 6e-05
cd10414108 cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo 7e-05
cd1041297 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo 1e-04
cd1041197 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo 1e-04
cd10402105 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2e-04
cd1036996 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain 4e-04
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 5e-04
cd1039198 cd10391, SH2_SHE, Src homology 2 domain found in S 5e-04
cd0992381 cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom 7e-04
cd1039098 cd10390, SH2_SHD, Src homology 2 domain found in S 0.001
cd10405103 cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou 0.001
cd1037096 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai 0.001
cd10350103 cd10350, SH2_SH2D4A, Src homology 2 domain found i 0.002
cd1040199 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo 0.002
cd09929121 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom 0.002
cd10383103 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo 0.002
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 0.003
cd10416102 cd10416, SH2_SH2D2A, Src homology 2 domain found i 0.003
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 0.003
>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 Back     alignment and domain information
 Score =  172 bits (438), Expect = 9e-56
 Identities = 65/140 (46%), Positives = 81/140 (57%), Gaps = 31/140 (22%)

Query: 26  RDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVI 85
            DLRSHAWYHG IPR  AE +++ EGDFL+RD  S PG+YVL+C  K Q LHF IN+   
Sbjct: 1   EDLRSHAWYHGRIPRQVAESLVQREGDFLVRDSLSSPGDYVLTCRWKGQPLHFKINR--- 57

Query: 86  QPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYV 145
                                       VV++P   Y RVQ+QFED+ FD++P L+ FYV
Sbjct: 58  ----------------------------VVLRPSEAYTRVQYQFEDEQFDSIPALVHFYV 89

Query: 146 GSGKPISSLSGAKIKSPKNR 165
           G+ +PIS  SGA I  P NR
Sbjct: 90  GNRRPISQASGAIISRPVNR 109


BCAR3 is part of a growing family of guanine nucleotide exchange factors is responsible for activation of Ras-family GTPases, including Sos1 and 2, GRF1 and 2, CalDAG-GEF/GRP1-4, C3G, cAMP-GEF/Epac 1 and 2, PDZ-GEFs, MR-GEF, RalGDS family members, RalGPS, RasGEF, Smg GDS, and phospholipase C(epsilon). 12102558 21262352 BCAR3 binds to the carboxy-terminus of BCAR1/p130Cas, a focal adhesion adapter protein. Over expression of BCAR1 (p130Cas) and BCAR3 induces estrogen independent growth in normally estrogen-dependent cell lines. They have been linked to resistance to anti-estrogens in breast cancer, Rac activation, and cell motility, though the BCAR3/p130Cas complex is not required for this activity in BCAR3. Many BCAR3-mediated signaling events in epithelial and mesenchymal cells are independent of p130Cas association. Structurally these proteins contain a single SH2 domain upstream of their RasGEF domain, which is responsible for the ability of BCAR3 to enhance p130Cas over-expression-induced migration. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 136

>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) Back     alignment and domain information
>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) Back     alignment and domain information
>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) Back     alignment and domain information
>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) Back     alignment and domain information
>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk Back     alignment and domain information
>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx Back     alignment and domain information
>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins Back     alignment and domain information
>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins Back     alignment and domain information
>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) Back     alignment and domain information
>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) Back     alignment and domain information
>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) Back     alignment and domain information
>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins Back     alignment and domain information
>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) Back     alignment and domain information
>gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain containing protein 4A (SH2D4A) Back     alignment and domain information
>gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) Back     alignment and domain information
>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|198279 cd10416, SH2_SH2D2A, Src homology 2 domain found in the SH2 domain containing protein 2A (SH2D2A) Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.86
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.85
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.85
KOG0790|consensus 600 99.74
KOG4637|consensus 464 99.73
KOG4792|consensus 293 99.71
KOG0194|consensus 474 99.69
KOG4226|consensus379 99.67
KOG4278|consensus 1157 99.63
KOG1264|consensus 1267 99.6
KOG1264|consensus 1267 99.56
KOG2996|consensus865 99.55
KOG0197|consensus 468 99.43
KOG4637|consensus464 99.39
KOG0790|consensus 600 99.19
KOG3601|consensus222 99.17
KOG3697|consensus345 98.85
KOG1930|consensus483 98.75
KOG3751|consensus622 98.42
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 97.87
KOG4566|consensus258 96.87
KOG1856|consensus1299 96.11
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 95.8
KOG1856|consensus1299 93.0
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 91.79
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
Probab=99.86  E-value=2.2e-21  Score=135.91  Aligned_cols=80  Identities=36%  Similarity=0.704  Sum_probs=70.0

Q ss_pred             CcccccCCCHHHHHHhhhc--CCcEEEEecCCCCCcEEEEEeeCCeEEEEEEEEeeecCCccccceeEEeCC-CCcCCHH
Q psy5180          31 HAWYHGAIPRSRAEEIIEN--EGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFED-DLFDTVP  107 (192)
Q Consensus        31 ~~WyhG~isr~eAe~lL~~--~G~FLVR~S~~~~g~~~LSv~~~~~v~H~~I~~~~~~~~~~~~~~~~~~~~-~~F~sL~  107 (192)
                      ++||||.|+|++||++|.+  +|+||||.|.+.++.|+||++.++.++|++|....        .+.|.+++ ..|+||.
T Consensus         1 ~~w~~g~i~r~~Ae~lL~~~~~G~FLvR~s~~~~~~~~Lsv~~~~~~~h~~I~~~~--------~~~~~l~~~~~F~sl~   72 (84)
T smart00252        1 QPWYHGFISREEAEKLLKNEGDGDFLVRDSESEPGDYVLSVRVKGKVKHYRIRRNE--------DGKFYLDGGRKFPSLV   72 (84)
T ss_pred             CCeecccCCHHHHHHHHhcCCCcEEEEEcCCCCCCCEEEEEEECCEEEEEEEEECC--------CCcEEECCCCccCCHH
Confidence            4899999999999999986  79999999988789999999999999999998863        25677775 7888998


Q ss_pred             HHHHHhHHhcc
Q psy5180         108 DLITFYVVIQP  118 (192)
Q Consensus       108 eLI~~Y~~~~l  118 (192)
                      +||+||+.+++
T Consensus        73 eLI~~y~~~~~   83 (84)
T smart00252       73 ELVEHYQKNSL   83 (84)
T ss_pred             HHHHHHhhCCC
Confidence            88888887654



Src homology 2 domains bind phosphotyrosine-containing polypeptides via 2 surface pockets. Specificity is provided via interaction with residues that are distinct from the phosphotyrosine. Only a single occurrence of a SH2 domain has been found in S. cerevisiae.

>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2kk6_A116 Solution Structure Of Sh2 Domain Of Proto-Oncogene 1e-13
1mil_A104 Transforming Protein Length = 104 3e-10
1tce_A107 Solution Nmr Structure Of The Shc Sh2 Domain Comple 1e-09
2eo3_A111 Solution Structure Of The Sh2 Domain From Human Crk 5e-09
2lqw_A 303 Solution Structure Of Phosphorylated Crkl Length = 6e-09
2lqn_A 303 Solution Structure Of Crkl Length = 303 6e-09
1wqu_A114 Solution Structure Of The Human Fes Sh2 Domain Leng 4e-08
3cd3_A 377 Crystal Structure Of Phosphorylated Human Feline Sa 1e-07
3bkb_A 377 Crystal Structure Of Human Feline Sarcoma Viral Onc 1e-07
2eyv_A124 Sh2 Domain Of Ct10-Regulated Kinase Length = 124 2e-07
2dvj_A230 Phosphorylated Crk-Ii Length = 230 2e-07
2eyy_A204 Ct10-Regulated Kinase Isoform I Length = 204 2e-07
1ju5_A109 Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P 3e-07
2eyz_A 304 Ct10-Regulated Kinase Isoform Ii Length = 304 4e-07
1bmb_A123 Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 8e-07
1bm2_A117 Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet 8e-07
2h46_E116 Native Domain-Swapped Dimer Crystal Structure Of Th 9e-07
3ove_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 9e-07
3n84_A112 Crystal Structure Of The Grb2 Sh2 Domain In Complex 9e-07
3imd_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 9e-07
1fhs_A112 The Three-Dimensional Solution Structure Of The Src 9e-07
1fyr_A114 Dimer Formation Through Domain Swapping In The Crys 9e-07
1gri_A217 Grb2 Length = 217 1e-06
1x0n_A104 Nmr Structure Of Growth Factor Receptor Binding Pro 1e-06
2aoa_A99 Crystal Structures Of A High-affinity Macrocyclic P 2e-06
1tze_E98 Signal Transduction Adaptor Growth Factor, Grb2 Sh2 2e-06
3mxc_A101 Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp 2e-06
2ecd_A119 Solution Structure Of The Human Abl2 Sh2 Domain Len 2e-06
1jyq_A96 Xray Structure Of Grb2 Sh2 Domain Complexed With A 3e-06
1zfp_E98 Growth Factor Receptor Binding Protein Sh2 Domain C 3e-06
1cj1_A96 Growth Factor Receptor Binding Protein Sh2 Domain ( 4e-06
3t04_A123 Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C 6e-06
3k2m_A112 Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO 6e-06
1ab2_A109 Three-Dimensional Solution Structure Of The Src Hom 6e-06
2abl_A163 Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K 8e-06
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 9e-06
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 9e-06
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 9e-06
1ghu_A107 Nmr Solution Structure Of Growth Factor Receptor-Bo 1e-05
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 1e-05
2b3o_A 532 Crystal Structure Of Human Tyrosine Phosphatase Shp 1e-05
1x6c_A118 Solution Structures Of The Sh2 Domain Of Human Prot 2e-05
2dly_A121 Solution Structure Of The Sh2 Domain Of Murine Fyn- 2e-05
2ge9_A125 Solution Structures Of The Sh2 Domain Of Bruton's T 3e-05
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 3e-05
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 4e-05
2cia_A102 Human Nck2 Sh2-Domain In Complex With A Decaphospho 2e-04
1z3k_A98 Structural Insight Into The Binding Diversity Betwe 2e-04
1k9a_A 450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-04
3eaz_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 3e-04
2k79_B110 Solution Structure Of The Binary Complex Between Th 4e-04
3s9k_A118 Crystal Structure Of The Itk Sh2 Domain Length = 11 4e-04
1lui_A110 Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform 4e-04
2cs0_A119 Solution Structure Of The Sh2 Domain Of Human Hsh2d 4e-04
2etz_A109 The Nmr Minimized Average Structure Of The Itk Sh2 4e-04
2shp_A 525 Tyrosine Phosphatase Shp-2 Length = 525 5e-04
3eac_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 6e-04
>pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/85 (42%), Positives = 49/85 (57%), Gaps = 9/85 (10%) Query: 26 RDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVI 85 + L WYHGAIPR A+E+++ +GDFL+R+ +PG YVLS S Q HF+I V Sbjct: 12 KPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYV-- 69 Query: 86 QPDTVYERVQFQFEDDLFDTVPDLI 110 D +Y +FE F +P LI Sbjct: 70 --DNMY-----RFEGTGFSNIPQLI 87
>pdb|1MIL|A Chain A, Transforming Protein Length = 104 Back     alignment and structure
>pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 Back     alignment and structure
>pdb|2EO3|A Chain A, Solution Structure Of The Sh2 Domain From Human Crk-Like Protein Length = 111 Back     alignment and structure
>pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 Back     alignment and structure
>pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 Back     alignment and structure
>pdb|1WQU|A Chain A, Solution Structure Of The Human Fes Sh2 Domain Length = 114 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2EYV|A Chain A, Sh2 Domain Of Ct10-Regulated Kinase Length = 124 Back     alignment and structure
>pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 Back     alignment and structure
>pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 Back     alignment and structure
>pdb|1JU5|A Chain A, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 109 Back     alignment and structure
>pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 Back     alignment and structure
>pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 Back     alignment and structure
>pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 Back     alignment and structure
>pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 Back     alignment and structure
>pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 Back     alignment and structure
>pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 Back     alignment and structure
>pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 Back     alignment and structure
>pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 Back     alignment and structure
>pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 Back     alignment and structure
>pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 Back     alignment and structure
>pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 Back     alignment and structure
>pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 Back     alignment and structure
>pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 Back     alignment and structure
>pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 Back     alignment and structure
>pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 Back     alignment and structure
>pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 Back     alignment and structure
>pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 Back     alignment and structure
>pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 Back     alignment and structure
>pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 Back     alignment and structure
>pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|1X6C|A Chain A, Solution Structures Of The Sh2 Domain Of Human Protein- Tyrosine Phosphatase Shp-1 Length = 118 Back     alignment and structure
>pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 Back     alignment and structure
>pdb|2GE9|A Chain A, Solution Structures Of The Sh2 Domain Of Bruton's Tyrosine Kinase Length = 125 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 Back     alignment and structure
>pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 Back     alignment and structure
>pdb|2K79|B Chain B, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 110 Back     alignment and structure
>pdb|3S9K|A Chain A, Crystal Structure Of The Itk Sh2 Domain Length = 118 Back     alignment and structure
>pdb|1LUI|A Chain A, Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform, Ensemble Of 20 Low Energy Structures Length = 110 Back     alignment and structure
>pdb|2CS0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Hsh2d Protein Length = 119 Back     alignment and structure
>pdb|2ETZ|A Chain A, The Nmr Minimized Average Structure Of The Itk Sh2 Domain Bound To A Phosphopeptide Length = 109 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 6e-32
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 1e-31
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-29
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 8e-27
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 7e-23
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 1e-21
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 2e-21
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 4e-21
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 5e-21
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 8e-21
2dly_A121 FYN-related kinase; BRK family kinase, structural 5e-20
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 7e-20
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 1e-19
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 2e-19
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 2e-19
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 3e-19
2vif_A141 Suppressor of cytokine signalling 6; growth regula 4e-19
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 4e-19
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 5e-19
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 5e-19
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 8e-19
2aug_A126 Growth factor receptor-bound protein 14; phosphory 1e-18
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 1e-18
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-18
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-18
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 4e-18
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 7e-18
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 9e-18
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 9e-18
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 2e-17
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 2e-17
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 2e-17
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 3e-17
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 4e-17
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 5e-17
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 8e-17
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 8e-17
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 1e-16
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-16
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 1e-16
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 1e-16
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 2e-16
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 2e-16
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 3e-16
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 6e-16
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 7e-16
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-15
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 2e-12
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 1e-15
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-15
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-10
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 3e-15
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 7e-13
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 6e-15
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 7e-11
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 6e-15
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 8e-15
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-14
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 4e-14
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 1e-13
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-13
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 2e-13
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 3e-13
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 9e-13
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-12
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-11
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 5e-09
3maz_A125 Signal-transducing adaptor protein 1; modular doma 5e-09
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 3e-07
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-04
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 4e-07
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 6e-07
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 9e-07
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-06
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-06
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 2e-05
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 3e-04
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
 Score =  110 bits (278), Expect = 6e-32
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 40/140 (28%)

Query: 26  RDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVI 85
           + L    WYHGAIPR  A+E+++ +GDFL+R+   +PG YVLS  S  Q  HF+I     
Sbjct: 12  KPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQ---- 67

Query: 86  QPDTVYERVQFQFEDDLFDTVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYV 145
                                               Y    ++FE   F  +P LI  + 
Sbjct: 68  ------------------------------------YVDNMYRFEGTGFSNIPQLIDHHY 91

Query: 146 GSGKPISSLSGAKIKSPKNR 165
            + + I+  SG  + +P  +
Sbjct: 92  TTKQVITKKSGVVLLNPIPK 111


>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.95
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.94
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.93
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.92
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.92
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.92
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.92
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.92
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.92
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.92
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.91
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.91
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.91
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.91
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.91
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.91
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.91
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.91
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.91
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.91
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.91
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.91
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.91
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.91
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.91
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.91
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.91
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.91
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.91
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.91
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.91
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.9
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.9
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.9
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.9
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.9
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.9
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.9
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.9
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.9
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.89
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.89
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.89
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.89
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.88
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.87
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.87
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.87
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.87
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.87
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.85
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.85
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.85
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.84
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.84
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.84
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.84
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.83
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.83
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.82
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.82
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.7
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.81
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 99.81
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.8
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.78
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.78
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.77
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.76
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.76
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.74
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.74
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.73
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.72
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.69
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.67
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.65
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.63
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.61
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.6
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.59
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.57
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 99.33
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 98.5
1uur_A473 Stata protein, STAT protein; transcription activat 98.35
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 98.23
1yvl_A683 Signal transducer and activator of transcription 1 97.53
1y1u_A585 Signal transducer and activator of transcription; 97.44
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 97.39
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 97.36
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 97.0
1bf5_A575 Signal transducer and activator of transcription 1 96.85
3op0_A323 Signal transduction protein CBL-C; structural geno 96.75
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 96.17
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 95.14
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 93.69
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 93.26
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 90.74
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 90.57
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 90.42
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 90.29
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 90.05
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 89.97
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 89.72
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 89.71
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 89.68
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 89.54
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 89.54
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 89.51
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 89.36
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 89.34
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 89.27
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 89.11
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 88.96
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 88.84
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 88.78
3maz_A125 Signal-transducing adaptor protein 1; modular doma 88.65
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 88.63
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 88.5
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 88.34
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 88.06
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 88.0
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 87.9
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 87.5
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 87.19
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 87.19
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 87.12
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 86.93
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 86.85
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 86.8
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 86.59
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 86.54
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 85.97
2aug_A126 Growth factor receptor-bound protein 14; phosphory 85.79
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 85.59
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 85.56
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 85.18
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 84.61
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 84.51
2dly_A121 FYN-related kinase; BRK family kinase, structural 84.49
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 83.83
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 83.68
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 83.47
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 82.95
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 81.23
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=6e-28  Score=179.03  Aligned_cols=105  Identities=36%  Similarity=0.658  Sum_probs=91.9

Q ss_pred             ccCCCCCcccccCCCHHHHHHhhhcCCcEEEEecCCCCCcEEEEEeeCCeEEEEEEEEeeecCCccccceeEEeCCCCcC
Q psy5180          25 NRDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFD  104 (192)
Q Consensus        25 ~~~L~~~~WyhG~isr~eAe~lL~~~G~FLVR~S~~~~g~~~LSv~~~~~v~H~~I~~~~~~~~~~~~~~~~~~~~~~F~  104 (192)
                      ...++.++||||.|+|++||++|+.+|+||||.|++.+|.|+|||+.++.|+||+|...         ++.|.++     
T Consensus        11 ~~~~~~~~WyhG~isR~eAe~lL~~~G~FLVR~S~~~~g~y~LSv~~~~~v~H~~I~~~---------~g~y~~~-----   76 (116)
T 2kk6_A           11 MKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYV---------DNMYRFE-----   76 (116)
T ss_dssp             CCCTTTCTTEEESCCHHHHHHTCCSTTCEEEEECTTCTTCEEEEEEETTEEEEEEEEEE---------TTEEESS-----
T ss_pred             ccccccCCCccCCCCHHHHHHHhccCCcEEEEECCCCCCcEEEEEEECCeEEEEEEEec---------CCEEEEC-----
Confidence            45678899999999999999999999999999999999999999999999999999853         4567776     


Q ss_pred             CHHHHHHHhHHhccccchhhhcccccCCCCCCHHHHHHHHHhCCCCCcCCCCceecCcccCC-CCC
Q psy5180         105 TVPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLSGAKIKSPKNRY-SCD  169 (192)
Q Consensus       105 sL~eLI~~Y~~~~l~~~~~~l~~~~~~~~f~sv~~Li~~y~~~~~pi~~~~~~~L~~Pv~r~-~~~  169 (192)
                                                +..|+||.+||+||+.+..|+....++.|++||.|+ +|+
T Consensus        77 --------------------------~~~F~sl~eLV~~y~~~~~~i~~~~~~~L~~Pv~r~~~We  116 (116)
T 2kk6_A           77 --------------------------GTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPKDKKWI  116 (116)
T ss_dssp             --------------------------SCEESCHHHHHHHHHHTTCCSCTTTTCCCCSCCCCCCCCC
T ss_pred             --------------------------CCEeCCHHHHHHHHhhCCCCccCCCCCeECcccCCCCCCC
Confidence                                      567788888888888877788766778999999999 995



>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 4e-24
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 3e-20
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 7e-20
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 7e-20
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 8e-20
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 1e-19
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 2e-19
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 7e-19
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 2e-18
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-18
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 1e-17
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 1e-17
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 2e-17
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 4e-17
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 1e-16
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 2e-16
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 3e-16
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 4e-16
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 4e-16
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 6e-16
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 7e-16
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 2e-15
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 2e-15
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 2e-14
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 2e-14
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 3e-14
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 5e-14
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 5e-14
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 5e-14
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 5e-14
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 5e-13
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 1e-12
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 1e-12
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 9e-12
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Shc adaptor protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 89.2 bits (221), Expect = 4e-24
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 9/87 (10%)

Query: 27  DLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQ 86
            LR   W+HG + R  AE +++  GDFL+R+ T+ PG YVL+ +   Q  H ++      
Sbjct: 3   QLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLL------ 56

Query: 87  PDTVYERVQFQFEDDLFDTVPDLITFY 113
              V      + +D  F++V  LI+++
Sbjct: 57  ---VDPEGVVRTKDHRFESVSHLISYH 80


>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.95
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.93
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.92
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.92
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.92
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.92
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.92
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.92
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.91
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.91
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.91
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.91
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.91
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.91
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.9
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.9
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.9
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.89
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.89
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.89
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.89
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.89
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.89
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.89
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.88
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.88
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.88
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.88
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.87
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.87
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.86
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.81
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.49
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 95.21
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 95.09
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 93.78
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 93.65
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 92.88
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 92.64
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 91.63
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 91.44
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 91.3
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 91.11
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 90.85
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 90.83
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 90.67
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 90.09
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 90.04
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 89.92
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 89.71
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 89.5
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 89.22
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 89.19
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 88.67
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 88.29
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 88.23
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 87.3
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 87.2
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 86.03
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 85.42
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 85.38
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 83.15
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Shc adaptor protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.3e-28  Score=176.28  Aligned_cols=101  Identities=31%  Similarity=0.603  Sum_probs=82.3

Q ss_pred             cCCCCCcccccCCCHHHHHHhhhcCCcEEEEecCCCCCcEEEEEeeCCeEEEEEEEEeeecCCccccceeEEeCCCCcCC
Q psy5180          26 RDLRSHAWYHGAIPRSRAEEIIENEGDFLIRDCTSQPGNYVLSCMSKTQYLHFVINKVVIQPDTVYERVQFQFEDDLFDT  105 (192)
Q Consensus        26 ~~L~~~~WyhG~isr~eAe~lL~~~G~FLVR~S~~~~g~~~LSv~~~~~v~H~~I~~~~~~~~~~~~~~~~~~~~~~F~s  105 (192)
                      ++|+.++||||.|+|++||++|+++|+||||.|++.+|.|+|||++++.++||+|...         ++.|.++      
T Consensus         2 ~~l~~~pWyhG~i~R~~Ae~lL~~~G~FLVR~S~~~~g~~vLSv~~~~~v~H~~I~~~---------~~~~~~~------   66 (104)
T d1mila_           2 SQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDP---------EGVVRTK------   66 (104)
T ss_dssp             CSTTTCTTBCSSCCHHHHHTTCCSTTEEEEEECCSSCSSEEEEEEETTEEEEEEEBCT---------TSSEECS------
T ss_pred             cccccCCCcCCCCCHHHHHHHHhcCCcEEEEecCCCCCCEEEEEEEccccceEEEEeC---------CCEEEeC------
Confidence            5789999999999999999999999999999999999999999999999999999653         4567766      


Q ss_pred             HHHHHHHhHHhccccchhhhcccccCCCCCCHHHHHHHHHhCCCCCcCCC-CceecCcccCC
Q psy5180         106 VPDLITFYVVIQPDTVYERVQFQFEDDLFDTVPDLITFYVGSGKPISSLS-GAKIKSPKNRY  166 (192)
Q Consensus       106 L~eLI~~Y~~~~l~~~~~~l~~~~~~~~f~sv~~Li~~y~~~~~pi~~~~-~~~L~~Pv~r~  166 (192)
                                               +..|+||.+||+||+.+..|+.... .+.|++||.|+
T Consensus        67 -------------------------~~~F~sl~~LV~~y~~~~~~~~~~~~~~~L~~Pi~R~  103 (104)
T d1mila_          67 -------------------------DHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERK  103 (104)
T ss_dssp             -------------------------SCEESSHHHHHHHHHHHTCCEEETTEEECCCEECCCC
T ss_pred             -------------------------CeeECCHHHHHHHHhhCCCCcccCCcceEeCCCcCCc
Confidence                                     4456666666666666556654433 57788999885



>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure