Psyllid ID: psy5184

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MANGKEKISKTASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNGKNTSGSQEY
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccccccHHHHHHHcccEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHcccEEccccccccccccccccccccccccccccc
cccHHHHHHHHHccccccccccccccccccHHHHHcccccHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHccHHHHHHcccEEEccccccccccHHHccccccccccccccccHHHHHccccEEcHHHHHHHHHccHHHHHHcccEEEccccccccccHHHcccccccccccccccc
MANGKEKISKtasggkdlgsklkSNAARRTrsakanivfpVSRIQRYLKrgnyserigIGASVFLAATLEYLVAEILELAGnaasdnkksritpRYLMLAIKNDEELAKLLCGVtiaqggvlphiepvlltkKTNEYYIQQEYDiftasdnkksritpRYLMLAIKNDEELAKLLCGVtiaqggvlphiepvlltkktngkntsgsqey
mangkekisktasggkdlgsklksnaarrtrsakanivfpvsriqRYLKRGNYSERIGIGASVFLAATLEYLVAEILELagnaasdnkksriTPRYLMLAIKNDEELAKLLCGVTIaqggvlphiepvLLTKKTNEYYIQQEydiftasdnkksrITPRYLMLAIKNDEELAKLLCGVTIAQggvlphiepvlltkktngkntsgsqey
MANGKEKISKTASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNGKNTSGSQEY
**********************************ANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAAS***KSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLT**************
*************************************VFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPH**********************************RYLMLAIKNDEELAKLLCGVTIAQGGVLPHIE*******************
************SGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTN**********
***********************************NIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTK*******************KKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTK*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANGKEKISKTASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNGKNTSGSQEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q96QV6131 Histone H2A type 1-A OS=H yes N/A 0.555 0.885 0.663 5e-39
P02269125 Histone H2A OS=Asterias r N/A N/A 0.564 0.944 0.641 5e-39
P16886126 Late histone H2A.L3 OS=St yes N/A 0.545 0.904 0.657 6e-39
Q6L500163 Probable histone H2A.4 OS yes N/A 0.598 0.766 0.632 6e-39
A2Y5G8163 Probable histone H2A.4 OS N/A N/A 0.598 0.766 0.632 6e-39
P20671130 Histone H2A type 1-D OS=H no N/A 0.555 0.892 0.663 1e-38
P19177149 Histone H2A OS=Petroselin N/A N/A 0.511 0.718 0.700 1e-38
P06897130 Histone H2A type 1 OS=Xen N/A N/A 0.535 0.861 0.678 1e-38
Q75L11156 Probable histone H2A.6 OS no N/A 0.602 0.807 0.638 1e-38
A2XZN0156 Probable histone H2A.6 OS N/A N/A 0.602 0.807 0.638 1e-38
>sp|Q96QV6|H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens GN=HIST1H2AA PE=1 SV=3 Back     alignment and function desciption
 Score =  160 bits (406), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (81%)

Query: 23  KSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGN 82
           K+ A  ++RS++A + FPV RI R L++GNY+ERIG GA V+LAA LEYL AEILELAGN
Sbjct: 10  KARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGN 69

Query: 83  AASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYY 138
           A+ DNKK+RI PR+L LAI+NDEEL KLL GVTIAQGGVLP+I+ VLL KKT  ++
Sbjct: 70  ASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHH 125
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Homo sapiens (taxid: 9606)
>sp|P02269|H2A_ASTRU Histone H2A OS=Asterias rubens PE=1 SV=2 Back     alignment and function description
>sp|P16886|H2AL_STRPU Late histone H2A.L3 OS=Strongylocentrotus purpuratus PE=1 SV=2 Back     alignment and function description
>sp|Q6L500|H2A4_ORYSJ Probable histone H2A.4 OS=Oryza sativa subsp. japonica GN=Os05g0461400 PE=2 SV=1 Back     alignment and function description
>sp|A2Y5G8|H2A4_ORYSI Probable histone H2A.4 OS=Oryza sativa subsp. indica GN=OsI_019561 PE=3 SV=1 Back     alignment and function description
>sp|P20671|H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens GN=HIST1H2AD PE=1 SV=2 Back     alignment and function description
>sp|P19177|H2A_PETCR Histone H2A OS=Petroselinum crispum PE=2 SV=1 Back     alignment and function description
>sp|P06897|H2A1_XENLA Histone H2A type 1 OS=Xenopus laevis PE=1 SV=2 Back     alignment and function description
>sp|Q75L11|H2A6_ORYSJ Probable histone H2A.6 OS=Oryza sativa subsp. japonica GN=Os05g0113900 PE=2 SV=2 Back     alignment and function description
>sp|A2XZN0|H2A6_ORYSI Probable histone H2A.6 OS=Oryza sativa subsp. indica GN=OsI_017523 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
324544641126 Histone H2A, partial [Ascaris suum] 0.583 0.968 0.672 1e-39
170581034126 histone H2A [Brugia malayi] gi|312088904 0.583 0.968 0.647 2e-38
170576483127 Histone H2A [Brugia malayi] gi|170581286 0.569 0.937 0.672 2e-38
324534300126 Histone H2A [Ascaris suum] 0.583 0.968 0.647 3e-38
260808957135 hypothetical protein BRAFLDRAFT_199801 [ 0.569 0.881 0.669 3e-38
283468891128 histone H2A [Xenoturbella bocki] gi|2834 0.602 0.984 0.625 4e-38
197321810159 histone H2A variant H2Abd1 copy 2d [Adin 0.578 0.761 0.672 5e-38
197321808159 histone H2A variant H2Abd1 copy 2c [Adin 0.578 0.761 0.672 5e-38
197321804156 histone H2A variant H2Abd1 copy 1a [Adin 0.578 0.775 0.672 6e-38
170572153126 histone H2A [Brugia malayi] gi|312087727 0.583 0.968 0.639 6e-38
>gi|324544641|gb|ADY49685.1| Histone H2A, partial [Ascaris suum] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%)

Query: 15  GKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVA 74
           G+  G K KS+A  +TRS++A + FPV RI R L++GNY+ER+G GA V+LAA LEYL A
Sbjct: 3   GRGKGGKAKSSAKAKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAA 62

Query: 75  EILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKT 134
           E+LELAGNAA DNKKSRI PR+L LA++NDEEL KLL GVTIAQGGVLP+I+ VLL KKT
Sbjct: 63  EVLELAGNAARDNKKSRINPRHLQLAVRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 122

Query: 135 NE 136
            E
Sbjct: 123 AE 124

Source: Ascaris suum

Species: Ascaris suum

Genus: Ascaris

Family: Ascarididae

Order: Ascaridida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota
>gi|170581034|ref|XP_001895511.1| histone H2A [Brugia malayi] gi|312088904|ref|XP_003146043.1| histone H2A [Loa loa] gi|158597516|gb|EDP35644.1| histone H2A, putative [Brugia malayi] gi|307758795|gb|EFO18029.1| histone H2A [Loa loa] gi|393908098|gb|EJD74907.1| histone H2A, variant [Loa loa] Back     alignment and taxonomy information
>gi|170576483|ref|XP_001893648.1| Histone H2A [Brugia malayi] gi|170581286|ref|XP_001895618.1| Histone H2A [Brugia malayi] gi|312078672|ref|XP_003141840.1| hypothetical protein LOAG_06256 [Loa loa] gi|158597378|gb|EDP35544.1| Histone H2A, putative [Brugia malayi] gi|158600227|gb|EDP37517.1| Histone H2A, putative [Brugia malayi] gi|307762997|gb|EFO22231.1| hypothetical protein LOAG_06256 [Loa loa] gi|402591156|gb|EJW85086.1| histone H2A [Wuchereria bancrofti] Back     alignment and taxonomy information
>gi|324534300|gb|ADY49360.1| Histone H2A [Ascaris suum] Back     alignment and taxonomy information
>gi|260808957|ref|XP_002599273.1| hypothetical protein BRAFLDRAFT_199801 [Branchiostoma floridae] gi|229284550|gb|EEN55285.1| hypothetical protein BRAFLDRAFT_199801 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|283468891|emb|CAP53876.1| histone H2A [Xenoturbella bocki] gi|283468917|emb|CAP53895.1| histone H2A [Xenoturbella bocki] Back     alignment and taxonomy information
>gi|197321810|gb|ACH68796.1| histone H2A variant H2Abd1 copy 2d [Adineta vaga] Back     alignment and taxonomy information
>gi|197321808|gb|ACH68795.1| histone H2A variant H2Abd1 copy 2c [Adineta vaga] Back     alignment and taxonomy information
>gi|197321804|gb|ACH68793.1| histone H2A variant H2Abd1 copy 1a [Adineta vaga] gi|197321806|gb|ACH68794.1| histone H2A variant H2Abd1 copy 1b [Adineta vaga] Back     alignment and taxonomy information
>gi|170572153|ref|XP_001892003.1| histone H2A [Brugia malayi] gi|312087727|ref|XP_003145585.1| hypothetical protein LOAG_10010 [Loa loa] gi|158603138|gb|EDP39184.1| histone H2A, putative [Brugia malayi] gi|307759249|gb|EFO18483.1| hypothetical protein LOAG_10010 [Loa loa] gi|402587003|gb|EJW80939.1| histone H2A [Wuchereria bancrofti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
ZFIN|ZDB-GENE-081205-1138 zgc:195633 "zgc:195633" [Danio 0.622 0.942 0.613 1e-36
WB|WBGene00001877127 his-3 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001881127 his-7 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001886127 his-12 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001890127 his-16 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001893127 his-19 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001895127 his-21 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001904127 his-30 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001907127 his-33 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
WB|WBGene00001917127 his-43 [Caenorhabditis elegans 0.574 0.944 0.625 2.1e-36
ZFIN|ZDB-GENE-081205-1 zgc:195633 "zgc:195633" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 1.0e-36, P = 1.0e-36
 Identities = 81/132 (61%), Positives = 101/132 (76%)

Query:     5 KEKISKTASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVF 64
             +  IS   SG    G K ++ A  +TRS++A + FPV R+ R L++GNY+ER+G GA V+
Sbjct:     1 ESSISTKMSGRGKTGGKARAKA--KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVY 58

Query:    65 LAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPH 124
             LAA LEYL AEILELAGNAA DNKK+RI PR+L LA++NDEEL KLL GVTIAQGGVLP+
Sbjct:    59 LAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPN 118

Query:   125 IEPVLLTKKTNE 136
             I+ VLL KKT +
Sbjct:   119 IQAVLLPKKTEK 130
GO:0003677 "DNA binding" evidence=IEA
GO:0000786 "nucleosome" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006334 "nucleosome assembly" evidence=IEA
GO:0005694 "chromosome" evidence=IEA
WB|WBGene00001877 his-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001881 his-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001886 his-12 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001890 his-16 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001893 his-19 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001895 his-21 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001904 his-30 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001907 his-33 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001917 his-43 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96KK5H2A1H_HUMANNo assigned EC number0.65510.55500.9062yesN/A
Q4FZT6H2A3_RATNo assigned EC number0.65510.55500.8923yesN/A
P16886H2AL_STRPUNo assigned EC number0.65780.54540.9047yesN/A
P22752H2A1_MOUSENo assigned EC number0.66370.55500.8923yesN/A
Q8CGP6H2A1H_MOUSENo assigned EC number0.66370.55500.9062yesN/A
Q8CGP5H2A1F_MOUSENo assigned EC number0.66370.55500.8923yesN/A
P0CC09H2A2A_RATNo assigned EC number0.63790.55500.8923yesN/A
Q8IUE6H2A2B_HUMANNo assigned EC number0.65210.53110.8538yesN/A
Q96QV6H2A1A_HUMANNo assigned EC number0.66370.55500.8854yesN/A
Q8BFU2H2A3_MOUSENo assigned EC number0.65510.55500.8923yesN/A
Q64598H2A1F_RATNo assigned EC number0.65510.55500.8923yesN/A
P0C169H2A1C_RATNo assigned EC number0.64650.55500.8923yesN/A
Q99878H2A1J_HUMANNo assigned EC number0.65510.55500.9062yesN/A
P0C0S9H2A1_BOVINNo assigned EC number0.65510.55500.8923yesN/A
P02262H2A1_RATNo assigned EC number0.64650.55500.8923yesN/A
Q8CGP7H2A1K_MOUSENo assigned EC number0.66370.55500.8923yesN/A
Q6GSS7H2A2A_MOUSENo assigned EC number0.63790.55500.8923yesN/A
P0C170H2A1E_RATNo assigned EC number0.65510.55500.8923yesN/A
Q6L500H2A4_ORYSJNo assigned EC number0.6320.59800.7668yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 4e-57
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 2e-56
smart00414106 smart00414, H2A, Histone 2A 7e-55
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 6e-51
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 1e-44
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 4e-44
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 9e-42
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 1e-32
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 6e-28
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 2e-22
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 2e-21
smart00414106 smart00414, H2A, Histone 2A 4e-21
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 2e-20
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 8e-18
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 2e-16
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 5e-16
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 4e-15
PLN0015558 PLN00155, PLN00155, histone H2A; Provisional 4e-12
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 2e-09
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 2e-07
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 4e-05
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information 
 Score =  175 bits (447), Expect = 4e-57
 Identities = 76/111 (68%), Positives = 90/111 (81%)

Query: 23  KSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGN 82
           K  + +R+RSA+A + FPV RI RYLK+G Y+ER+G GA V+LAA LEYL AE+LELAGN
Sbjct: 5   KKKSKKRSRSARAGLQFPVGRIHRYLKKGRYAERVGAGAPVYLAAVLEYLTAEVLELAGN 64

Query: 83  AASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKK 133
           AA DNKK RITPR+L LA++NDEEL KLL GVTIA GGVLP+I  VLL KK
Sbjct: 65  AARDNKKKRITPRHLQLAVRNDEELNKLLKGVTIASGGVLPNIHKVLLPKK 115

The nucleosome is an octamer containing two H2A, H2B, H3, and H4 subunits. The H2A subunit performs essential roles in maintaining structural integrity of the nucleosome, chromatin condensation, and binding of specific chromatin-associated proteins. Length = 115
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
PLN00156139 histone H2AX; Provisional 100.0
PTZ00252134 histone H2A; Provisional 100.0
PLN00153129 histone H2A; Provisional 100.0
PLN00157132 histone H2A; Provisional 100.0
PTZ00017134 histone H2A; Provisional 100.0
PLN00154136 histone H2A; Provisional 100.0
KOG1756|consensus131 100.0
smart00414106 H2A Histone 2A. 100.0
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 100.0
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 100.0
KOG1757|consensus131 100.0
PLN00153129 histone H2A; Provisional 99.98
PLN00157132 histone H2A; Provisional 99.97
PTZ00017134 histone H2A; Provisional 99.97
PLN00154136 histone H2A; Provisional 99.97
KOG1756|consensus131 99.97
smart00414106 H2A Histone 2A. 99.97
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 99.96
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 99.95
KOG1757|consensus131 99.94
PLN0015558 histone H2A; Provisional 99.85
PLN00156139 histone H2AX; Provisional 99.41
PTZ00252134 histone H2A; Provisional 99.4
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.36
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.25
KOG1659|consensus224 98.96
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 98.52
PLN00035103 histone H4; Provisional 97.98
PTZ00015102 histone H4; Provisional 97.78
smart0080365 TAF TATA box binding protein associated factor. TA 97.47
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 97.28
cd0007685 H4 Histone H4, one of the four histones, along wit 97.23
KOG1657|consensus236 97.18
PLN0015558 histone H2A; Provisional 97.16
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 97.14
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 97.08
smart0041774 H4 Histone H4. 96.74
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 96.63
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 95.71
PTZ00463117 histone H2B; Provisional 94.93
PLN00158116 histone H2B; Provisional 94.5
KOG3219|consensus195 94.42
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 94.4
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 93.95
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 93.56
smart0042789 H2B Histone H2B. 93.15
PF0296966 TAF: TATA box binding protein associated factor (T 92.44
smart00428105 H3 Histone H3. 90.9
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 90.84
KOG1659|consensus 224 90.2
smart0057677 BTP Bromodomain transcription factors and PHD doma 87.94
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 87.07
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 86.31
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 84.31
CHL00095 821 clpC Clp protease ATP binding subunit 84.2
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 82.45
>PLN00156 histone H2AX; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.3e-49  Score=317.24  Aligned_cols=124  Identities=58%  Similarity=0.873  Sum_probs=111.3

Q ss_pred             CccccccCCCCcccccccChhhHHHHHhhCCccccccCCchhHHHHHHHHHHHHHHHHHhhhhcccCCcccchhhhHHHh
Q psy5184          22 LKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAI  101 (209)
Q Consensus        22 ~k~~~~~~s~s~RagL~FPV~ri~r~Lk~~~~~~ris~~A~VyLaAvLEYL~aEILelAgn~A~~~kk~rItP~hLq~AV  101 (209)
                      ++++++..|||+||||||||+||||||++++|+.||+++||||||||||||++||||||+|+                  
T Consensus        13 ~~~~~k~~srS~rAgL~FPVgRi~R~Lk~g~ya~RVga~ApVYLAAVLEYLtaEVLELAgNa------------------   74 (139)
T PLN00156         13 KPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNA------------------   74 (139)
T ss_pred             cccccCCcCcccccCcccchHHHHHHHhcCChhhccCCccHHHHHHHHHHHHHHHHHHHHHH------------------
Confidence            33567889999999999999999999999999999999999999999999999999999997                  


Q ss_pred             hccHHHHhhhcCceecCCCCCCccccccccccccccccccccccccccccccccccccchhhhccChHHHhhhhcccccc
Q psy5184         102 KNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYYIQQEYDIFTASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIA  181 (209)
Q Consensus       102 ~nD~EL~~ll~~~~ia~ggv~P~i~~~lL~~~~~~~~~~lelA~~~a~~~~k~rItPrhl~lAi~ndeeL~~L~~~~tia  181 (209)
                                                                    |+|++++|||||||+|||+||+||++||++|||+
T Consensus        75 ----------------------------------------------a~d~kk~RItPrHi~lAIrnDeEL~~Ll~~vTIa  108 (139)
T PLN00156         75 ----------------------------------------------ARDNKKNRIVPRHIQLAVRNDEELSKLLGSVTIA  108 (139)
T ss_pred             ----------------------------------------------HHHcCCCcCcHHHHHhhccCcHHHHHHHCCCccC
Confidence                                                          3456666999999999999999999999999999


Q ss_pred             CccccCCCCccccccccCCCCC---CCCCCC
Q psy5184         182 QGGVLPHIEPVLLTKKTNGKNT---SGSQEY  209 (209)
Q Consensus       182 ~ggv~p~i~~~l~~kk~~~~~~---~~~~~~  209 (209)
                      +|||+|+||++|+|||++++..   .+||+|
T Consensus       109 ~GGV~P~i~~~l~~kk~~~~~~~~~~~~~~~  139 (139)
T PLN00156        109 AGGVLPNIHQTLLPKKVGKGKGDIGSASQEF  139 (139)
T ss_pred             CCccCCCccHhhccccccccccccccccCCC
Confidence            9999999999999999754422   236665

>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>KOG1657|consensus Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>KOG3219|consensus Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 9e-40
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 6e-15
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 1e-39
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 7e-15
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 1e-39
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 6e-15
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 6e-39
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 3e-15
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 7e-39
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 3e-15
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 1e-38
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 5e-15
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 1e-38
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 5e-15
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 1e-38
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 6e-15
2nqb_C123 Drosophila Nucleosome Structure Length = 123 7e-38
2nqb_C123 Drosophila Nucleosome Structure Length = 123 4e-16
2pyo_C120 Drosophila Nucleosome Core Length = 120 8e-38
2pyo_C120 Drosophila Nucleosome Core Length = 120 6e-16
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 9e-38
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 4e-14
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 1e-37
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 5e-14
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 2e-37
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 2e-14
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 2e-37
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 1e-14
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 9e-37
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 4e-13
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 3e-36
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 3e-14
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 3e-35
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 3e-14
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-33
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 3e-11
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 4e-31
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 1e-08
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 4e-26
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 5e-08
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 2e-23
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 4e-07
1q9c_A191 Crystal Structure Of The Histone Domain Of Son Of S 4e-04
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (402), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%)
Query: 23  KSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGN 82
           K+ A  +TRS++A + FPV R+ R L++GNYSER+G GA V+LAA LEYL AEILELAGN
Sbjct: 13  KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGN 72
Query: 83  AASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNEYY 138
           AA DNKK+RI PR+L LAI+NDEEL KLL  VTIAQGGVLP+I+ VLL KKT  ++
Sbjct: 73  AARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHH 128
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 4e-41
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 1e-18
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 3e-39
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 1e-17
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 4e-38
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 3e-17
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 2e-37
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 6e-15
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 2e-36
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 7e-16
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 5e-35
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 5e-14
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 3e-24
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 7e-12
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 5e-17
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 8e-08
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 2e-07
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
 Score =  135 bits (341), Expect = 4e-41
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 3/135 (2%)

Query: 2   ANGKEKISKTASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGA 61
           ++G       +  GK  G   K+ A  +TRS++A + FPV R+ R L++GNYSER+G GA
Sbjct: 11  SSGLVPRGSMSGRGKQGG---KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGA 67

Query: 62  SVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGV 121
            V+LAA LEYL AEILELAGNAA DNKK+RI PR+L LAI+NDEEL KLL  VTIAQGGV
Sbjct: 68  PVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGV 127

Query: 122 LPHIEPVLLTKKTNE 136
           LP+I+ VLL KKT  
Sbjct: 128 LPNIQAVLLPKKTES 142
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 100.0
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 100.0
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 100.0
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 100.0
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 100.0
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 100.0
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 100.0
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 99.96
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 99.95
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 99.95
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 99.95
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 99.95
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 99.94
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.91
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.89
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.83
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.66
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.66
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.51
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.51
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.5
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.47
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.07
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.0
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 98.76
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 98.64
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.49
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.44
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 98.15
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 98.14
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 98.13
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 98.05
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.91
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 97.63
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 97.23
1taf_B70 TFIID TBP associated factor 62; transcription init 97.14
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.12
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 96.85
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 96.71
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 96.39
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 96.31
1taf_A68 TFIID TBP associated factor 42; transcription init 96.1
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 96.04
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 95.93
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 95.83
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 95.69
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 95.56
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 95.2
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 95.19
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 95.13
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 95.11
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 94.62
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 94.43
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 94.41
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 94.16
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 94.11
3r45_A156 Histone H3-like centromeric protein A; histone fol 93.87
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 93.87
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 93.15
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 93.08
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 91.88
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 91.3
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 91.12
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 90.08
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 89.45
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.66
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 86.94
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 80.09
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
Probab=100.00  E-value=4.3e-43  Score=277.36  Aligned_cols=124  Identities=51%  Similarity=0.707  Sum_probs=99.7

Q ss_pred             cCCCCccccCCccccccCCCCcccccccChhhHHHHHhhCCcc-ccccCCchhHHHHHHHHHHHHHHHHHhhhhcccCCc
Q psy5184          12 ASGGKDLGSKLKSNAARRTRSAKANIVFPVSRIQRYLKRGNYS-ERIGIGASVFLAATLEYLVAEILELAGNAASDNKKS   90 (209)
Q Consensus        12 ~~~~~~~~~~~k~~~~~~s~s~RagL~FPV~ri~r~Lk~~~~~-~ris~~A~VyLaAvLEYL~aEILelAgn~A~~~kk~   90 (209)
                      |+||+.+...++.+++.+|+|+||||||||+||+|||++++|+ +||+++|||||+||||||++||||+|+|+|++++++
T Consensus         1 m~~~~~~~~~~~~~~~~~srS~ragLqfPV~ri~R~Lk~~~~a~~RV~~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~k   80 (128)
T 1f66_C            1 MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK   80 (128)
T ss_dssp             ----------------CCCHHHHHTCSSCHHHHHHHHHHTSCSSCEECTTHHHHHHHHHHHHHHHHHHHHHHHHHTTTCS
T ss_pred             CCCCCCCCCCCCcCCCCcCccccCCccCChHHHHHHHHHcccchhhccccHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            4566666666667778899999999999999999999999987 599999999999999999999999999999999999


Q ss_pred             ccchhhhHHHhhccHHHHhhhcCceecCCCCCCccccccccccccc
Q psy5184          91 RITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKKTNE  136 (209)
Q Consensus        91 rItP~hLq~AV~nD~EL~~ll~~~~ia~ggv~P~i~~~lL~~~~~~  136 (209)
                      +|+|+||++||+||+|||.||+ +||++|||+|+||+++|++++.+
T Consensus        81 rItprhi~lAI~nDeEL~~Ll~-~tia~ggv~P~i~~~l~~k~~~~  125 (128)
T 1f66_C           81 RITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGQQ  125 (128)
T ss_dssp             EECHHHHHHHHHHSHHHHHHCC-SEETTCCCCCCCCGGGC------
T ss_pred             eEcHHHHHHHHhccHHHhhhhc-ceecCCccCCCCCHHhcCccccc
Confidence            9999999999999999999995 59999999999999999987654
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 1e-50
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 6e-21
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 6e-50
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 2e-20
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 6e-43
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 4e-17
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 1e-33
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 1e-17
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 2e-16
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 8e-09
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-06
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: macro-H2A.1, histone domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  157 bits (398), Expect = 1e-50
 Identities = 68/106 (64%), Positives = 86/106 (81%)

Query: 28  RRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDN 87
           + +RSAKA ++FPV R+ RY+K+G+   RIG+GA V++AA LEYL AEILELA NAA DN
Sbjct: 1   KTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDN 60

Query: 88  KKSRITPRYLMLAIKNDEELAKLLCGVTIAQGGVLPHIEPVLLTKK 133
           KK R+TPR+++LA+ NDEEL +LL GVTIA GGVLP+I P LL KK
Sbjct: 61  KKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK 106
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 100.0
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 100.0
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 99.97
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 99.97
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 99.95
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.94
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.65
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.5
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.27
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.02
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.98
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.49
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 98.45
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 98.36
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 98.03
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 97.79
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 97.63
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 96.78
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 96.66
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 96.59
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 96.15
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 95.68
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 95.33
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 94.46
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 94.43
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 89.45
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 85.96
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 81.59
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 80.25
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=1.8e-44  Score=274.36  Aligned_cols=106  Identities=67%  Similarity=1.019  Sum_probs=103.5

Q ss_pred             ccCCCCcccccccChhhHHHHHhhCCccccccCCchhHHHHHHHHHHHHHHHHHhhhhcccCCcccchhhhHHHhhccHH
Q psy5184          27 ARRTRSAKANIVFPVSRIQRYLKRGNYSERIGIGASVFLAATLEYLVAEILELAGNAASDNKKSRITPRYLMLAIKNDEE  106 (209)
Q Consensus        27 ~~~s~s~RagL~FPV~ri~r~Lk~~~~~~ris~~A~VyLaAvLEYL~aEILelAgn~A~~~kk~rItP~hLq~AV~nD~E  106 (209)
                      |.+|||+|||||||||||+|+|++++|++||+++|||||+||||||++||||||||+|++++++||+|+||++||+||+|
T Consensus         1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDee   80 (106)
T d1tzya_           1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE   80 (106)
T ss_dssp             CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHH
T ss_pred             CCccccccCCccCChHHHHHHHHcCccccccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHH
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcCceecCCCCCCccccccccc
Q psy5184         107 LAKLLCGVTIAQGGVLPHIEPVLLTK  132 (209)
Q Consensus       107 L~~ll~~~~ia~ggv~P~i~~~lL~~  132 (209)
                      |+++|+++||++|||+|+||+++|++
T Consensus        81 L~~L~~~vtI~~GGv~P~Ih~~Llpk  106 (106)
T d1tzya_          81 LNKLLGKVTIAQGGVLPNIQAVLLPK  106 (106)
T ss_dssp             HHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred             HHHHHcCCeecCCCccCccCHhhcCC
Confidence            99999999999999999999999975
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure