Psyllid ID: psy5205
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 113 | ||||||
| 194757108 | 740 | GF11321 [Drosophila ananassae] gi|190622 | 1.0 | 0.152 | 0.668 | 3e-49 | |
| 386768486 | 740 | CG3499, isoform C [Drosophila melanogast | 1.0 | 0.152 | 0.662 | 8e-49 | |
| 24658770 | 736 | CG3499, isoform B [Drosophila melanogast | 1.0 | 0.153 | 0.662 | 9e-49 | |
| 195346897 | 739 | GM15603 [Drosophila sechellia] gi|194135 | 1.0 | 0.152 | 0.662 | 9e-49 | |
| 194884696 | 737 | GG20087 [Drosophila erecta] gi|190659501 | 1.0 | 0.153 | 0.662 | 9e-49 | |
| 442624487 | 739 | CG3499, isoform D [Drosophila melanogast | 1.0 | 0.152 | 0.662 | 9e-49 | |
| 195488933 | 735 | GE11626 [Drosophila yakuba] gi|194178624 | 1.0 | 0.153 | 0.662 | 1e-48 | |
| 198461041 | 745 | GA17483 [Drosophila pseudoobscura pseudo | 1.0 | 0.151 | 0.662 | 1e-48 | |
| 195170272 | 744 | GL10197 [Drosophila persimilis] gi|19411 | 1.0 | 0.151 | 0.662 | 1e-48 | |
| 195585855 | 603 | GD25099 [Drosophila simulans] gi|1941947 | 1.0 | 0.187 | 0.662 | 1e-48 |
| >gi|194757108|ref|XP_001960807.1| GF11321 [Drosophila ananassae] gi|190622105|gb|EDV37629.1| GF11321 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Score = 198 bits (504), Expect = 3e-49, Method: Compositional matrix adjust.
Identities = 101/151 (66%), Positives = 108/151 (71%), Gaps = 38/151 (25%)
Query: 1 VDPEEINITFKDVRGVDEAKQELKEIVEFLKNPEKFSTLGGKLPKGVLL----------- 49
VDPEEIN+TF+DV+G DEAKQELKE+VEFLKNPEKFS LGGKLPKGVLL
Sbjct: 294 VDPEEINVTFEDVKGCDEAKQELKEVVEFLKNPEKFSNLGGKLPKGVLLVGPPGTGKTLL 353
Query: 50 ---------------------------GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRT 82
GARRVRDLFKAAK R PCV+FIDEIDSVGAKRT
Sbjct: 354 ARAVAGEAKVPFFHAAGPEFDEVLVGQGARRVRDLFKAAKARAPCVIFIDEIDSVGAKRT 413
Query: 83 NSVLHPYANQTINQLLAEMDGFHQNEGVVVL 113
NSVLHPYANQTINQLL+EMDGFHQN GV+VL
Sbjct: 414 NSVLHPYANQTINQLLSEMDGFHQNAGVIVL 444
|
Source: Drosophila ananassae Species: Drosophila ananassae Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|386768486|ref|NP_001246473.1| CG3499, isoform C [Drosophila melanogaster] gi|328751836|gb|AEB39673.1| MIP17311p [Drosophila melanogaster] gi|383302656|gb|AFH08226.1| CG3499, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|24658770|ref|NP_726263.1| CG3499, isoform B [Drosophila melanogaster] gi|15291271|gb|AAK92904.1| GH14313p [Drosophila melanogaster] gi|23240115|gb|AAM71132.2| CG3499, isoform B [Drosophila melanogaster] gi|220945266|gb|ACL85176.1| CG3499-PB [synthetic construct] gi|220954998|gb|ACL90042.1| CG3499-PB [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195346897|ref|XP_002039991.1| GM15603 [Drosophila sechellia] gi|194135340|gb|EDW56856.1| GM15603 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194884696|ref|XP_001976314.1| GG20087 [Drosophila erecta] gi|190659501|gb|EDV56714.1| GG20087 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|442624487|ref|NP_001261142.1| CG3499, isoform D [Drosophila melanogaster] gi|440214588|gb|AGB93673.1| CG3499, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195488933|ref|XP_002092523.1| GE11626 [Drosophila yakuba] gi|194178624|gb|EDW92235.1| GE11626 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|198461041|ref|XP_001361892.2| GA17483 [Drosophila pseudoobscura pseudoobscura] gi|198137214|gb|EAL26471.2| GA17483 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195170272|ref|XP_002025937.1| GL10197 [Drosophila persimilis] gi|194110801|gb|EDW32844.1| GL10197 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195585855|ref|XP_002082694.1| GD25099 [Drosophila simulans] gi|194194703|gb|EDX08279.1| GD25099 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 113 | ||||||
| FB|FBgn0034792 | 736 | CG3499 [Drosophila melanogaste | 0.557 | 0.085 | 0.904 | 1.7e-40 | |
| WB|WBGene00010842 | 723 | ymel-1 [Caenorhabditis elegans | 0.557 | 0.087 | 0.714 | 6.9e-32 | |
| UNIPROTKB|J9NRR9 | 694 | YME1L1 "Uncharacterized protei | 0.557 | 0.090 | 0.650 | 1.1e-29 | |
| MGI|MGI:1351651 | 715 | Yme1l1 "YME1-like 1 (S. cerevi | 0.557 | 0.088 | 0.650 | 1.2e-29 | |
| UNIPROTKB|G3V886 | 715 | Yme1l1 "YME1-like 1 (S. cerevi | 0.557 | 0.088 | 0.650 | 1.2e-29 | |
| UNIPROTKB|A6QR12 | 717 | YME1L1 "Uncharacterized protei | 0.557 | 0.087 | 0.650 | 1.2e-29 | |
| UNIPROTKB|F1PRV6 | 748 | YME1L1 "Uncharacterized protei | 0.557 | 0.084 | 0.650 | 1.4e-29 | |
| UNIPROTKB|F1RVK1 | 768 | YME1L1 "Uncharacterized protei | 0.557 | 0.082 | 0.650 | 1.6e-29 | |
| UNIPROTKB|Q96TA2 | 773 | YME1L1 "ATP-dependent zinc met | 0.557 | 0.081 | 0.650 | 1.6e-29 | |
| UNIPROTKB|F1NTK8 | 712 | YME1L1 "Uncharacterized protei | 0.557 | 0.088 | 0.666 | 2e-29 |
| FB|FBgn0034792 CG3499 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 298 (110.0 bits), Expect = 1.7e-40, Sum P(2) = 1.7e-40
Identities = 57/63 (90%), Positives = 60/63 (95%)
Query: 51 ARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLHPYANQTINQLLAEMDGFHQNEGV 110
ARRVRDLFKAAK R PCV+FIDEIDSVGAKRTNSVLHPYANQTINQLL+EMDGFHQN GV
Sbjct: 378 ARRVRDLFKAAKARAPCVIFIDEIDSVGAKRTNSVLHPYANQTINQLLSEMDGFHQNAGV 437
Query: 111 VVL 113
+VL
Sbjct: 438 IVL 440
|
|
| WB|WBGene00010842 ymel-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NRR9 YME1L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1351651 Yme1l1 "YME1-like 1 (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V886 Yme1l1 "YME1-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QR12 YME1L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRV6 YME1L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RVK1 YME1L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96TA2 YME1L1 "ATP-dependent zinc metalloprotease YME1L1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NTK8 YME1L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 113 | |||
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 2e-45 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 2e-39 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 4e-38 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 8e-31 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 3e-29 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 9e-28 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 3e-22 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 2e-20 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 6e-20 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 4e-19 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 1e-17 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 3e-16 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 2e-15 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 1e-13 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 6e-06 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 2e-04 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 0.002 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 0.003 |
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
Score = 152 bits (386), Expect = 2e-45
Identities = 68/150 (45%), Positives = 84/150 (56%), Gaps = 40/150 (26%)
Query: 4 EEINITFKDVRGVDEAKQELKEIVEFLKNPEKFSTLGGKLPKGVLL-------------- 49
E+ +TFKDV G+DEAK+EL EIV+FLKNP KF+ LG K+PKGVLL
Sbjct: 48 EKPKVTFKDVAGIDEAKEELMEIVDFLKNPSKFTKLGAKIPKGVLLVGPPGTGKTLLAKA 107
Query: 50 ------------------------GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSV 85
GA RVRDLF+ AK PC++FIDEID+VG +R +
Sbjct: 108 VAGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIIFIDEIDAVGRQRGAGL 167
Query: 86 LHPY--ANQTINQLLAEMDGFHQNEGVVVL 113
QT+NQLL EMDGF N GV+V+
Sbjct: 168 GGGNDEREQTLNQLLVEMDGFGTNTGVIVI 197
|
HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 495 |
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 113 | |||
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.98 | |
| KOG0730|consensus | 693 | 99.98 | ||
| KOG0733|consensus | 802 | 99.97 | ||
| KOG0736|consensus | 953 | 99.97 | ||
| KOG0734|consensus | 752 | 99.96 | ||
| KOG0733|consensus | 802 | 99.95 | ||
| KOG0727|consensus | 408 | 99.95 | ||
| KOG0739|consensus | 439 | 99.93 | ||
| KOG0735|consensus | 952 | 99.93 | ||
| KOG0726|consensus | 440 | 99.93 | ||
| KOG0738|consensus | 491 | 99.92 | ||
| KOG0731|consensus | 774 | 99.92 | ||
| KOG0652|consensus | 424 | 99.91 | ||
| KOG0728|consensus | 404 | 99.91 | ||
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.9 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.9 | |
| KOG0729|consensus | 435 | 99.9 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.88 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.88 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.88 | |
| KOG0737|consensus | 386 | 99.87 | ||
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.86 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.84 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.83 | |
| KOG0732|consensus | 1080 | 99.81 | ||
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.81 | |
| KOG0651|consensus | 388 | 99.8 | ||
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.78 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.76 | |
| KOG0730|consensus | 693 | 99.75 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.75 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.75 | |
| KOG0741|consensus | 744 | 99.73 | ||
| KOG0740|consensus | 428 | 99.72 | ||
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.71 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.65 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.17 | |
| KOG0744|consensus | 423 | 99.0 | ||
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.99 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.9 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 98.88 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 98.69 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 98.45 | |
| KOG0743|consensus | 457 | 98.38 | ||
| KOG0742|consensus | 630 | 98.33 | ||
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.86 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.73 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.42 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.4 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.36 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.32 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.3 | |
| KOG0735|consensus | 952 | 97.24 | ||
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.98 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 96.95 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.72 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.38 | |
| KOG0736|consensus | 953 | 95.75 | ||
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 95.54 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 95.41 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.29 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.23 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 95.14 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.06 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 94.99 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 94.95 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 94.91 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 94.85 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 94.68 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 94.67 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.66 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 94.58 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 94.56 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 94.53 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 94.5 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 94.41 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.35 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 94.32 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 94.22 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 93.94 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 93.84 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.83 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 93.61 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 93.58 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 93.53 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 93.45 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 93.33 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.32 | |
| KOG0989|consensus | 346 | 93.29 | ||
| KOG2004|consensus | 906 | 93.26 | ||
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 93.2 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 93.17 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 93.14 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.8 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 92.63 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 91.9 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 91.88 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 91.88 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 91.69 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 91.65 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 91.65 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 91.49 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 91.47 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 91.12 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 90.55 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 90.29 | |
| KOG0745|consensus | 564 | 90.12 | ||
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 90.05 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 90.02 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 89.98 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 89.95 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 89.92 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 89.58 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 89.56 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 89.03 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 88.59 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 88.44 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 88.11 | |
| KOG0741|consensus | 744 | 87.96 | ||
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 87.95 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 87.09 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 87.06 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 86.81 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 86.58 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 86.31 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 85.8 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 85.3 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 84.52 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 84.43 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 84.19 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 83.59 | |
| KOG0732|consensus | 1080 | 83.24 | ||
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 82.98 | |
| KOG2170|consensus | 344 | 82.72 | ||
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 82.56 | |
| PF04465 | 1035 | DUF499: Protein of unknown function (DUF499); Inte | 82.48 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 81.93 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 80.69 | |
| PF10923 | 416 | DUF2791: P-loop Domain of unknown function (DUF279 | 80.66 | |
| KOG0990|consensus | 360 | 80.42 |
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.98 E-value=1.9e-32 Score=200.46 Aligned_cols=110 Identities=48% Similarity=0.820 Sum_probs=103.2
Q ss_pred CCCCCCCCcccccHHHHHHHHHHHHH-hcChhhHhhcCCCCCceeec---------------------------------
Q psy5205 4 EEINITFKDVRGVDEAKQELKEIVEF-LKNPEKFSTLGGKLPKGVLL--------------------------------- 49 (113)
Q Consensus 4 ~~~~~~~~di~G~~~~k~~l~~~i~~-~~~~~~~~~~g~~~~~giLl--------------------------------- 49 (113)
+.|+++|+||||+++++++|++.+++ ++||++|.+.|+.||+||||
T Consensus 144 e~PdvtY~dIGGL~~Qi~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvvgSElVq 223 (406)
T COG1222 144 EKPDVTYEDIGGLDEQIQEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQ 223 (406)
T ss_pred cCCCCChhhccCHHHHHHHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEeccHHHHH
Confidence 57999999999999999999999999 99999999999999999999
Q ss_pred -----hHHHHHHHHHHHHhCCCeEEEEccccccccccCCC--CCCchhHHHHHHHHHHhcCCCCCCceEEc
Q psy5205 50 -----GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNS--VLHPYANQTINQLLAEMDGFHQNEGVVVL 113 (113)
Q Consensus 50 -----~e~~l~~~F~~A~~~~p~ilfiDEiD~l~~~R~~~--~~~~~~~~i~~~lL~~ld~~~~~~~v~vi 113 (113)
+++.+|++|+.|++++||||||||||+++++|.++ +++.+..|.+-+||+|||||...++|-||
T Consensus 224 KYiGEGaRlVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI 294 (406)
T COG1222 224 KYIGEGARLVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVI 294 (406)
T ss_pred HHhccchHHHHHHHHHHhhcCCeEEEEechhhhhcccccCCCCchHHHHHHHHHHHHhccCCCCCCCeEEE
Confidence 78999999999999999999999999999999754 44578899999999999999999888876
|
|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2170|consensus | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04465 DUF499: Protein of unknown function (DUF499); InterPro: IPR007555 This is a family of uncharacterised hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >KOG0990|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 113 | ||||
| 2ce7_A | 476 | Edta Treated Length = 476 | 2e-19 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 2e-19 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 6e-19 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 2e-17 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 1e-15 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-15 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-15 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 1e-15 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 1e-15 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 7e-11 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 8e-09 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-07 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-07 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 2e-07 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 7e-07 | ||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 9e-07 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 9e-07 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-06 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-06 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 3e-06 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 1e-04 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 1e-04 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 1e-04 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 1e-04 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 4e-04 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 5e-04 |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
|
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 113 | |||
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 5e-48 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 1e-46 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 4e-46 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 7e-46 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 1e-45 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 4e-45 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 2e-44 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 1e-32 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 1e-28 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 2e-28 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-27 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 6e-22 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 3e-25 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 1e-23 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 3e-23 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 6e-23 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 8e-23 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 9e-23 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 4e-21 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 2e-20 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 1e-12 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 5e-12 |
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
Score = 153 bits (388), Expect = 5e-48
Identities = 60/150 (40%), Positives = 83/150 (55%), Gaps = 43/150 (28%)
Query: 6 INITFKDVRGVDEAKQELKEIVEFLKNPEKFSTLGGKLPKGVLL---------------- 49
+ ++FKDV G+ EAK E++E V++LK+PE+F LG K+PKG LL
Sbjct: 1 MGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAKAVA 60
Query: 50 ----------------------GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVLH 87
GA RVR LFK A+ R PC+V+IDEID+VG KR+ + +
Sbjct: 61 TEAQVPFLAMAGAEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTT-MS 119
Query: 88 PYAN----QTINQLLAEMDGFHQNEGVVVL 113
++N QT+NQLL EMDG + V+VL
Sbjct: 120 GFSNTEEEQTLNQLLVEMDGMGTTDHVIVL 149
|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 113 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.96 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.95 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.95 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.95 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.95 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.95 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.93 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.92 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.81 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.78 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.78 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.77 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.74 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.73 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.7 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.7 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.7 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.67 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.67 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.65 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.62 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.59 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.58 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.58 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.58 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.58 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.54 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.49 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 99.29 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.2 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.15 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.72 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 98.3 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.25 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 98.22 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.02 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.55 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.49 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.47 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.43 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.32 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.24 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.2 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.06 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 97.02 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.73 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 96.63 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.35 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 95.82 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.66 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.66 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.62 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.52 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 95.02 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 94.98 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.92 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.53 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.47 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.33 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 93.85 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 93.84 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 93.74 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 93.47 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 93.39 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 93.25 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 93.06 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 92.2 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 92.02 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 91.97 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 91.95 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 90.82 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 90.71 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 90.55 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 88.81 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 88.18 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.35 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 86.86 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.66 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 86.14 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 86.04 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 85.03 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 84.06 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 83.85 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 82.57 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 80.77 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.96 E-value=1e-29 Score=190.06 Aligned_cols=110 Identities=36% Similarity=0.703 Sum_probs=101.6
Q ss_pred CCCCCCCCcccccHHHHHHHHHHHHH-hcChhhHhhcCCCCCceeec---------------------------------
Q psy5205 4 EEINITFKDVRGVDEAKQELKEIVEF-LKNPEKFSTLGGKLPKGVLL--------------------------------- 49 (113)
Q Consensus 4 ~~~~~~~~di~G~~~~k~~l~~~i~~-~~~~~~~~~~g~~~~~giLl--------------------------------- 49 (113)
+.|+++|+||||++++|++|++.+.+ +++|+.|.++|++||+|+||
T Consensus 141 ~~p~v~~~dIgGl~~~k~~l~e~v~~Pl~~pe~f~~~gi~~prGvLL~GPPGTGKTllAkAiA~e~~~~f~~v~~s~l~s 220 (405)
T 4b4t_J 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQ 220 (405)
T ss_dssp CSCSCCGGGSCSCHHHHHHHHHHTHHHHHCHHHHHHHTCCCCCCEEEESCSSSSHHHHHHHHHHHHTCEEEEEEGGGGSC
T ss_pred CCCCCCHHHhCCHHHHHHHHHHHHHHHHhCHHHHHhCCCCCCCceEEeCCCCCCHHHHHHHHHHhhCCCceEEEhHHhhc
Confidence 56899999999999999999999999 99999999999999999999
Q ss_pred -----hHHHHHHHHHHHHhCCCeEEEEccccccccccCCCCC--CchhHHHHHHHHHHhcCCCCCCceEEc
Q psy5205 50 -----GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSVL--HPYANQTINQLLAEMDGFHQNEGVVVL 113 (113)
Q Consensus 50 -----~e~~l~~~F~~A~~~~p~ilfiDEiD~l~~~R~~~~~--~~~~~~i~~~lL~~ld~~~~~~~v~vi 113 (113)
++++++++|+.|++++||||||||+|+++++|+.+++ +....+++++||++|||+.+..+|+||
T Consensus 221 k~vGese~~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~~~V~vI 291 (405)
T 4b4t_J 221 KYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKII 291 (405)
T ss_dssp SSTTHHHHHHHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCCCCEEEE
T ss_pred cccchHHHHHHHHHHHHHHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCCCCeEEE
Confidence 7999999999999999999999999999999975443 346678999999999999998888875
|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 113 | ||||
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 8e-40 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 9e-38 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 7e-27 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 2e-18 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 2e-18 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 9e-05 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 2e-04 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 4e-04 | |
| d1sxja2 | 253 | c.37.1.20 (A:295-547) Replication factor C1 {Baker | 0.004 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Score = 130 bits (329), Expect = 8e-40
Identities = 61/153 (39%), Positives = 83/153 (54%), Gaps = 40/153 (26%)
Query: 1 VDPEEINITFKDVRGVDEAKQELKEIVEFLKNPEKFSTLGGKLPKGVLL----------- 49
+ ++I TF DV G DEAK+E+ E+VE+L+ P +F LGGK+PKGVL+
Sbjct: 2 LTEDQIKTTFADVAGCDEAKEEVAELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLL 61
Query: 50 ---------------------------GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKR- 81
GA RVRD+F+ AK PC++FIDEID+VG +R
Sbjct: 62 AKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRG 121
Query: 82 -TNSVLHPYANQTINQLLAEMDGFHQNEGVVVL 113
H QT+NQ+L EMDGF NEG++V+
Sbjct: 122 AGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVI 154
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 113 | |||
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.94 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.94 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.9 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.88 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.64 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.31 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.3 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.24 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.24 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.97 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.42 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.2 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.56 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.45 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.33 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.78 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.37 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.29 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.23 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.62 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 89.41 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.4 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 88.01 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 87.91 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 85.21 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 82.39 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 81.81 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 81.21 |
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Thermus thermophilus [TaxId: 274]
Probab=99.94 E-value=6.3e-27 Score=163.73 Aligned_cols=111 Identities=60% Similarity=0.993 Sum_probs=96.7
Q ss_pred CCCCCCCCCcccccHHHHHHHHHHHHHhcChhhHhhcCCCCCceeec---------------------------------
Q psy5205 3 PEEINITFKDVRGVDEAKQELKEIVEFLKNPEKFSTLGGKLPKGVLL--------------------------------- 49 (113)
Q Consensus 3 ~~~~~~~~~di~G~~~~k~~l~~~i~~~~~~~~~~~~g~~~~~giLl--------------------------------- 49 (113)
.+.|+++|+||+|++++|++|++++..+++++.|.++|.++|+|+||
T Consensus 1 ~~~p~~~~~di~G~~~~k~~l~~~i~~l~~~~~~~~~g~~~~~giLl~GppGtGKT~la~aia~~~~~~~~~i~~~~l~~ 80 (247)
T d1ixza_ 1 TEAPKVTFKDVAGAEEAKEELKEIVEFLKNPSRFHEMGARIPKGVLLVGPPGVGKTHLARAVAGEARVPFITASGSDFVE 80 (247)
T ss_dssp CCCCSCCGGGCCSCHHHHHHHHHHHHHHHCHHHHHHTTCCCCSEEEEECCTTSSHHHHHHHHHHHTTCCEEEEEHHHHHH
T ss_pred CCCCCCcHHHHccHHHHHHHHHHHHHHHHCHHHHHHcCCCCCceEEEecCCCCChhHHHHHHHHHcCCCEEEEEhHHhhh
Confidence 37899999999999999999999998899999999999999999999
Q ss_pred -----hHHHHHHHHHHHHhCCCeEEEEccccccccccCCCC--CCchhHHHHHHHHHHhcCCCCCCceEEc
Q psy5205 50 -----GARRVRDLFKAAKDRTPCVVFIDEIDSVGAKRTNSV--LHPYANQTINQLLAEMDGFHQNEGVVVL 113 (113)
Q Consensus 50 -----~e~~l~~~F~~A~~~~p~ilfiDEiD~l~~~R~~~~--~~~~~~~i~~~lL~~ld~~~~~~~v~vi 113 (113)
++++++++|+.|+.++||||||||+|+++++|++.. .+....+++++||++||++..+.+|+||
T Consensus 81 ~~~g~~~~~l~~~f~~a~~~~p~Ii~iDeid~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~vivi 151 (247)
T d1ixza_ 81 MFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTAIVVM 151 (247)
T ss_dssp SCTTHHHHHHHHHHHHHTTSSSEEEEEETHHHHHC---------CHHHHHHHHHHHHHHHTCCTTCCEEEE
T ss_pred ccccHHHHHHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEEE
Confidence 678999999999999999999999999999997543 2456678999999999999888888875
|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|