Psyllid ID: psy5228
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| 415938744 | 204 | ATP-dependent Clp protease, proteolytic | 0.991 | 0.553 | 0.831 | 1e-49 | |
| 409406436 | 208 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.543 | 0.831 | 1e-49 | |
| 300311895 | 208 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.543 | 0.831 | 2e-49 | |
| 398833401 | 208 | ATP-dependent Clp protease, proteolytic | 0.991 | 0.543 | 0.831 | 2e-49 | |
| 134094958 | 209 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.540 | 0.805 | 6e-49 | |
| 152980689 | 210 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.538 | 0.814 | 8e-49 | |
| 340787626 | 208 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.543 | 0.796 | 3e-48 | |
| 399018228 | 208 | ATP-dependent Clp protease, proteolytic | 0.991 | 0.543 | 0.805 | 6e-48 | |
| 393776900 | 217 | ClpP protein [Ralstonia sp. PBA] gi|3927 | 0.991 | 0.520 | 0.787 | 3e-47 | |
| 17546430 | 217 | ATP-dependent Clp protease proteolytic s | 0.991 | 0.520 | 0.778 | 8e-47 |
| >gi|415938744|ref|ZP_11555478.1| ATP-dependent Clp protease, proteolytic subunit [Herbaspirillum frisingense GSF30] gi|407759378|gb|EKF69073.1| ATP-dependent Clp protease, proteolytic subunit [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
Score = 199 bits (507), Expect = 1e-49, Method: Compositional matrix adjust.
Identities = 94/113 (83%), Positives = 104/113 (92%)
Query: 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 60
MQFIKP VSTLC GLAASMGAFLLA+G KGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA
Sbjct: 91 MQFIKPQVSTLCTGLAASMGAFLLAAGAKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 150
Query: 61 REILYLRQRLNEILSEKTGHSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQR 113
REILYLR+RLN IL++KTG SV++IS+DTDRDNFMSA A+EY LIDK+L +R
Sbjct: 151 REILYLRERLNSILADKTGRSVEQISKDTDRDNFMSADAAVEYGLIDKVLTER 203
|
Source: Herbaspirillum frisingense GSF30 Species: Herbaspirillum frisingense Genus: Herbaspirillum Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|409406436|ref|ZP_11254898.1| ATP-dependent Clp protease proteolytic subunit [Herbaspirillum sp. GW103] gi|386434985|gb|EIJ47810.1| ATP-dependent Clp protease proteolytic subunit [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|300311895|ref|YP_003775987.1| ATP-dependent Clp protease proteolytic subunit [Herbaspirillum seropedicae SmR1] gi|124483356|emb|CAM32551.1| ATP-dependent Clp protease (proteolytic subunit) protein [Herbaspirillum seropedicae] gi|300074680|gb|ADJ64079.1| ATP-dependent Clp protease (proteolytic subunit) protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
| >gi|398833401|ref|ZP_10591533.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Herbaspirillum sp. YR522] gi|398221568|gb|EJN07975.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|134094958|ref|YP_001100033.1| ATP-dependent Clp protease proteolytic subunit [Herminiimonas arsenicoxydans] gi|133738861|emb|CAL61908.1| ATP-dependent Clp protease proteolytic subunit (Endopeptidase Clp) [Herminiimonas arsenicoxydans] | Back alignment and taxonomy information |
|---|
| >gi|152980689|ref|YP_001353221.1| ATP-dependent Clp protease proteolytic subunit [Janthinobacterium sp. Marseille] gi|226706516|sp|A6SY74.1|CLPP_JANMA RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|151280766|gb|ABR89176.1| protease subunit of ATP-dependent Clp proteases [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
| >gi|340787626|ref|YP_004753091.1| ATP-dependent Clp protease proteolytic subunit [Collimonas fungivorans Ter331] gi|340552893|gb|AEK62268.1| ATP-dependent Clp protease proteolytic subunit [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|399018228|ref|ZP_10720412.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Herbaspirillum sp. CF444] gi|398101864|gb|EJL92064.1| ATP-dependent Clp protease, proteolytic subunit ClpP [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
| >gi|393776900|ref|ZP_10365194.1| ClpP protein [Ralstonia sp. PBA] gi|392716257|gb|EIZ03837.1| ClpP protein [Ralstonia sp. PBA] | Back alignment and taxonomy information |
|---|
| >gi|17546430|ref|NP_519832.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia solanacearum GMI1000] gi|83745913|ref|ZP_00942970.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia solanacearum UW551] gi|207743049|ref|YP_002259441.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum IPO1609] gi|300691404|ref|YP_003752399.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum PSI07] gi|300703972|ref|YP_003745574.1| proteolytic subunit of clpa-clpp ATP-dependent serine protease [Ralstonia solanacearum CFBP2957] gi|386333413|ref|YP_006029583.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum Po82] gi|421888083|ref|ZP_16319197.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum K60-1] gi|421898197|ref|ZP_16328564.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum MolK2] gi|22653696|sp|Q8XYP7.1|CLPP_RALSO RecName: Full=ATP-dependent Clp protease proteolytic subunit; AltName: Full=Endopeptidase Clp gi|17428728|emb|CAD15413.1| probable atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp). transmembrane protein [Ralstonia solanacearum GMI1000] gi|83727603|gb|EAP74724.1| ATP-dependent Clp protease proteolytic subunit [Ralstonia solanacearum UW551] gi|206589403|emb|CAQ36365.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum MolK2] gi|206594446|emb|CAQ61373.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum IPO1609] gi|299066731|emb|CBJ37925.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum CMR15] gi|299071635|emb|CBJ42959.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum CFBP2957] gi|299078464|emb|CBJ51116.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum PSI07] gi|334195862|gb|AEG69047.1| atp-atp-dependent clp protease proteolytic subunit (endopeptidase clp) protein [Ralstonia solanacearum Po82] gi|344167643|emb|CCA79883.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [blood disease bacterium R229] gi|344174667|emb|CCA86475.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia syzygii R24] gi|378966546|emb|CCF95945.1| proteolytic subunit of clpA-clpP ATP-dependent serine protease [Ralstonia solanacearum K60-1] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 114 | ||||||
| TIGR_CMR|CPS_3785 | 220 | CPS_3785 "ATP-dependent Clp pr | 0.991 | 0.513 | 0.663 | 7.8e-39 | |
| TIGR_CMR|BA_5380 | 193 | BA_5380 "ATP-dependent Clp pro | 0.991 | 0.585 | 0.672 | 4.3e-38 | |
| TIGR_CMR|SO_1794 | 202 | SO_1794 "ATP-dependent Clp pro | 0.991 | 0.559 | 0.672 | 6.3e-37 | |
| TIGR_CMR|VC_1922 | 200 | VC_1922 "ATP-dependent Clp pro | 0.991 | 0.565 | 0.663 | 8e-37 | |
| UNIPROTKB|P63786 | 195 | clpP "ATP-dependent Clp protea | 0.964 | 0.564 | 0.654 | 3.5e-36 | |
| UNIPROTKB|P0A6G7 | 207 | clpP [Escherichia coli K-12 (t | 0.991 | 0.545 | 0.654 | 7.2e-36 | |
| TIGR_CMR|CHY_0325 | 195 | CHY_0325 "ATP-dependent Clp pr | 1.0 | 0.584 | 0.666 | 7.2e-36 | |
| TIGR_CMR|CJE_0185 | 194 | CJE_0185 "ATP-dependent Clp pr | 0.982 | 0.577 | 0.669 | 4e-35 | |
| TAIR|locus:2196120 | 298 | CLPP5 "nuclear encoded CLP pro | 0.964 | 0.369 | 0.672 | 8.3e-35 | |
| TIGR_CMR|GSU_1792 | 199 | GSU_1792 "ATP-dependent Clp pr | 0.982 | 0.562 | 0.625 | 1.8e-32 |
| TIGR_CMR|CPS_3785 CPS_3785 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Score = 415 (151.1 bits), Expect = 7.8e-39, P = 7.8e-39
Identities = 75/113 (66%), Positives = 99/113 (87%)
Query: 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 60
M+FIKPN+ST+CIG AASMGAFLL+ G KGKR+ LPN+R+MIHQPLGG QGQASD EI A
Sbjct: 105 MKFIKPNISTVCIGQAASMGAFLLSGGEKGKRYCLPNARVMIHQPLGGFQGQASDFEIHA 164
Query: 61 REILYLRQRLNEILSEKTGHSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQR 113
+EIL+++ +LN++++E TG ++ K+SQDTDRDNF+SA+ A+EY L+D IL+QR
Sbjct: 165 KEILFIKDKLNKLMAEHTGQTLDKVSQDTDRDNFLSAEAAVEYGLVDSILEQR 217
|
|
| TIGR_CMR|BA_5380 BA_5380 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1794 SO_1794 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1922 VC_1922 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63786 clpP "ATP-dependent Clp protease proteolytic subunit" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6G7 clpP [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0325 CHY_0325 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0185 CJE_0185 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196120 CLPP5 "nuclear encoded CLP protease 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1792 GSU_1792 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 114 | |||
| PRK00277 | 200 | PRK00277, clpP, ATP-dependent Clp protease proteol | 3e-78 | |
| pfam00574 | 182 | pfam00574, CLP_protease, Clp protease | 9e-68 | |
| cd07017 | 171 | cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) | 5e-66 | |
| TIGR00493 | 192 | TIGR00493, clpP, ATP-dependent Clp endopeptidase, | 1e-64 | |
| COG0740 | 200 | COG0740, ClpP, Protease subunit of ATP-dependent C | 2e-63 | |
| PRK12553 | 207 | PRK12553, PRK12553, ATP-dependent Clp protease pro | 3e-59 | |
| PRK12551 | 196 | PRK12551, PRK12551, ATP-dependent Clp protease pro | 2e-58 | |
| CHL00028 | 200 | CHL00028, clpP, ATP-dependent Clp protease proteol | 1e-51 | |
| PRK12552 | 222 | PRK12552, PRK12552, ATP-dependent Clp protease-lik | 2e-47 | |
| PRK14514 | 221 | PRK14514, PRK14514, ATP-dependent Clp protease pro | 2e-47 | |
| cd07013 | 162 | cd07013, S14_ClpP, Caseinolytic protease (ClpP) is | 3e-44 | |
| PRK14512 | 197 | PRK14512, PRK14512, ATP-dependent Clp protease pro | 7e-38 | |
| PRK14513 | 201 | PRK14513, PRK14513, ATP-dependent Clp protease pro | 8e-37 | |
| cd00394 | 161 | cd00394, Clp_protease_like, Caseinolytic protease | 1e-25 | |
| cd07016 | 160 | cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) | 6e-16 |
| >gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
Score = 228 bits (584), Expect = 3e-78
Identities = 86/114 (75%), Positives = 101/114 (88%)
Query: 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 60
MQFIKP+VST+CIG AASMGAFLLA+G KGKRF+LPNSRIMIHQPLGG QGQA+DIEI A
Sbjct: 85 MQFIKPDVSTICIGQAASMGAFLLAAGAKGKRFALPNSRIMIHQPLGGFQGQATDIEIHA 144
Query: 61 REILYLRQRLNEILSEKTGHSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQRK 114
REIL L++RLNEIL+E TG ++KI +DTDRDNFMSA+ A EY LID++L +RK
Sbjct: 145 REILKLKKRLNEILAEHTGQPLEKIEKDTDRDNFMSAEEAKEYGLIDEVLTKRK 198
|
Length = 200 |
| >gnl|CDD|201316 pfam00574, CLP_protease, Clp protease | Back alignment and domain information |
|---|
| >gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 100.0 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 100.0 | |
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 100.0 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 100.0 | |
| KOG0840|consensus | 275 | 100.0 | ||
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 100.0 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 100.0 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 100.0 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 100.0 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 100.0 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 100.0 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.94 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 99.91 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 99.9 | |
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 99.79 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 99.77 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 99.64 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 99.43 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 99.42 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 99.38 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 99.33 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 99.17 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 99.17 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 99.01 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 98.58 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 98.57 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 98.54 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 98.41 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 98.4 | |
| PRK10949 | 618 | protease 4; Provisional | 98.36 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 98.35 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 98.35 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 98.32 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 98.32 | |
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 98.31 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 98.29 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 98.29 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 98.28 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 98.26 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 98.26 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 98.24 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 98.24 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 98.24 | |
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 98.23 | |
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 98.22 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 98.21 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 98.21 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 98.2 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 98.19 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 98.19 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 98.19 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 98.19 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 98.19 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 98.19 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 98.18 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 98.18 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 98.17 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 98.17 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 98.16 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 98.16 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 98.16 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 98.15 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 98.15 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 98.15 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 98.15 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 98.15 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 98.15 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 98.14 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 98.14 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 98.14 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 98.13 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 98.13 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 98.13 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 98.12 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 98.12 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 98.12 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 98.11 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 98.1 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 98.1 | |
| PLN02921 | 327 | naphthoate synthase | 98.1 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 98.09 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 98.08 | |
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 98.08 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 98.07 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 98.06 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 98.05 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 98.05 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 98.05 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 98.05 | |
| KOG1680|consensus | 290 | 98.04 | ||
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 98.03 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 98.01 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 98.01 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 97.99 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 97.99 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 97.97 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 97.97 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 97.94 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 97.91 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 97.88 | |
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 97.83 | |
| PLN03230 | 431 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.82 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 97.8 | |
| PRK12319 | 256 | acetyl-CoA carboxylase subunit alpha; Provisional | 97.75 | |
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 97.74 | |
| PRK05724 | 319 | acetyl-CoA carboxylase carboxyltransferase subunit | 97.69 | |
| TIGR00513 | 316 | accA acetyl-CoA carboxylase, carboxyl transferase, | 97.65 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 97.65 | |
| CHL00198 | 322 | accA acetyl-CoA carboxylase carboxyltransferase al | 97.62 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 97.6 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 97.58 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 97.54 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 97.52 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 97.45 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 97.45 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 97.44 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 97.44 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 97.38 | |
| PRK10949 | 618 | protease 4; Provisional | 97.35 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 97.28 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 97.18 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.06 | |
| TIGR03134 | 238 | malonate_gamma malonate decarboxylase, gamma subun | 96.98 | |
| COG0825 | 317 | AccA Acetyl-CoA carboxylase alpha subunit [Lipid m | 96.64 | |
| KOG1681|consensus | 292 | 96.55 | ||
| COG3904 | 245 | Predicted periplasmic protein [Function unknown] | 96.43 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 95.34 | |
| KOG1682|consensus | 287 | 95.23 | ||
| COG0447 | 282 | MenB Dihydroxynaphthoic acid synthase [Coenzyme me | 95.16 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 94.27 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 93.61 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 92.3 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 91.2 | |
| KOG1679|consensus | 291 | 89.32 | ||
| KOG0016|consensus | 266 | 85.06 |
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-44 Score=261.38 Aligned_cols=113 Identities=67% Similarity=1.051 Sum_probs=111.3
Q ss_pred CcccCCCeEEEEehhhhhHHHHHHhcCCCCcEEecCCceeeeecCCccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCC
Q psy5228 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQAREILYLRQRLNEILSEKTGH 80 (114)
Q Consensus 1 m~~~~~~V~t~~~G~aaS~as~i~~ag~~~~R~~~p~s~~miH~p~~~~~G~~~~l~~~~~~l~~~~~~~~~~ya~~tg~ 80 (114)
|+|+|+||+|+|+|+|||||++|++||++|+|+++|||++|||||+++..|+++|++++++++.+.++++.++|+++||+
T Consensus 81 m~~ik~~V~ti~~G~AaSmgs~l~~aG~~g~r~~lPnsrimIHqP~gg~~G~a~Di~i~A~ei~~~~~~l~~i~a~~TGq 160 (200)
T COG0740 81 MQFIKPPVSTICMGQAASMGSVLLMAGDKGKRFALPNARIMIHQPSGGAQGQASDIEIHAREILKIKERLNRIYAEHTGQ 160 (200)
T ss_pred HHhcCCCeEEEEecHHHhHHHHHHhcCCCCCceeCCCceEEEecCCccCccCHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHhhhcCCceecHHHHHHcCcceeecccC
Q psy5228 81 SVKKISQDTDRDNFMSAKMAMEYCLIDKILKQR 113 (114)
Q Consensus 81 s~~~i~~~m~~~~~lta~eA~~~GliD~Ii~~~ 113 (114)
+.++|.++|+||+||||+||++|||||+|++.+
T Consensus 161 ~~e~i~~d~drd~~msa~eA~~yGLiD~V~~~~ 193 (200)
T COG0740 161 TLEKIEKDTDRDTWMSAEEAKEYGLIDKVIESR 193 (200)
T ss_pred CHHHHHHhhcccccCCHHHHHHcCCcceecccc
Confidence 999999999999999999999999999999875
|
|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >KOG0840|consensus | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1680|consensus | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit | Back alignment and domain information |
|---|
| >COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1681|consensus | Back alignment and domain information |
|---|
| >COG3904 Predicted periplasmic protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >KOG1682|consensus | Back alignment and domain information |
|---|
| >COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >KOG1679|consensus | Back alignment and domain information |
|---|
| >KOG0016|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 114 | ||||
| 3tt6_A | 196 | Structure Of Clpp From Bacillus Subtilis In Compres | 3e-43 | ||
| 3tt7_A | 197 | Structure Of Clpp From Bacillus Subtilis In Complex | 3e-43 | ||
| 3ktg_A | 199 | Structure Of Clpp From Bacillus Subtilis In Monocli | 4e-43 | ||
| 3kti_A | 199 | Structure Of Clpp In Complex With Adep1 Length = 19 | 4e-43 | ||
| 3st9_A | 197 | Crystal Structure Of Clpp In Heptameric Form From S | 3e-41 | ||
| 1tyf_A | 193 | The Structure Of Clpp At 2.3 Angstrom Resolution Su | 3e-41 | ||
| 3qwd_A | 203 | Crystal Structure Of Clpp From Staphylococcus Aureu | 3e-41 | ||
| 1yg8_A | 193 | The Structure Of A V6a Variant Of Clpp. Length = 19 | 3e-41 | ||
| 3mt6_R | 207 | Structure Of Clpp From Escherichia Coli In Complex | 3e-41 | ||
| 3v5i_A | 203 | The Crystal Structure Of The Mutant Clpp S98a (Stap | 6e-41 | ||
| 3hln_A | 193 | Crystal Structure Of Clpp A153c Mutant With Inter-H | 1e-40 | ||
| 2zl0_A | 196 | Crystal Structure Of H.Pylori Clpp Length = 196 | 2e-40 | ||
| 2zl3_A | 196 | Crystal Structure Of H.Pylori Clpp S99a Length = 19 | 4e-40 | ||
| 3p2l_A | 201 | Crystal Structure Of Atp-Dependent Clp Protease Sub | 9e-37 | ||
| 2f6i_A | 215 | Crystal Structure Of The Clpp Protease Catalytic Do | 9e-29 | ||
| 1tg6_A | 277 | Crystallography And Mutagenesis Point To An Essenti | 2e-28 | ||
| 2ce3_A | 200 | Crystal Structure Of The Atp-Dependent Clp Protease | 9e-27 | ||
| 2c8t_A | 206 | The 3.0 A Resolution Structure Of Caseinolytic Clp | 9e-27 | ||
| 2cby_A | 208 | Crystal Structure Of The Atp-Dependent Clp Protease | 1e-26 | ||
| 3q7h_A | 195 | Structure Of The Clpp Subunit Of The Atp-Dependent | 2e-25 | ||
| 1y7o_A | 218 | The Structure Of Streptococcus Pneumoniae A153p Clp | 6e-20 | ||
| 4hnk_A | 219 | Crystal Structure Of An Enzyme Length = 219 | 5e-15 | ||
| 4gm2_A | 205 | The Crystal Structure Of A Peptidase From Plasmodiu | 6e-15 |
| >pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 | Back alignment and structure |
|
| >pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 | Back alignment and structure |
| >pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 | Back alignment and structure |
| >pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 | Back alignment and structure |
| >pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 | Back alignment and structure |
| >pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 | Back alignment and structure |
| >pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 | Back alignment and structure |
| >pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 | Back alignment and structure |
| >pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 | Back alignment and structure |
| >pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 | Back alignment and structure |
| >pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 | Back alignment and structure |
| >pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 | Back alignment and structure |
| >pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 | Back alignment and structure |
| >pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 | Back alignment and structure |
| >pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 | Back alignment and structure |
| >pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 | Back alignment and structure |
| >pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 | Back alignment and structure |
| >pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 | Back alignment and structure |
| >pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 | Back alignment and structure |
| >pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 | Back alignment and structure |
| >pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 | Back alignment and structure |
| >pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 | Back alignment and structure |
| >pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 114 | |||
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 2e-78 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 6e-78 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 1e-77 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 1e-77 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 1e-77 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 3e-75 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 1e-74 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 2e-19 |
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 | Back alignment and structure |
|---|
Score = 228 bits (584), Expect = 2e-78
Identities = 57/114 (50%), Positives = 79/114 (69%)
Query: 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 60
+IK ++ T+ GL ASM + +LASG KGKR SLPN RIMIHQPLG A G DIEIQ
Sbjct: 92 FNYIKSDIQTISFGLVASMASVILASGKKGKRKSLPNCRIMIHQPLGNAFGHPQDIEIQT 151
Query: 61 REILYLRQRLNEILSEKTGHSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQRK 114
+EILYL++ L LS T +V+ I +D+DRD +M+A A +Y +ID++++ +
Sbjct: 152 KEILYLKKLLYHYLSSFTNQTVETIEKDSDRDYYMNALEAKQYGIIDEVIETKL 205
|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 100.0 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 100.0 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 100.0 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 100.0 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 100.0 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 100.0 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 99.97 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 99.97 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 99.86 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.57 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 99.43 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.29 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 98.35 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 98.33 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 98.32 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 98.32 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 98.3 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 98.29 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 98.29 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 98.27 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 98.27 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 98.27 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 98.26 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 98.26 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 98.25 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 98.25 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 98.25 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 98.25 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 98.24 | |
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 98.24 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 98.24 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 98.23 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 98.23 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 98.23 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 98.22 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 98.22 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 98.21 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 98.21 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 98.21 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 98.2 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 98.2 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 98.2 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 98.19 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 98.19 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 98.19 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 98.19 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 98.19 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 98.19 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 98.17 | |
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 98.17 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 98.16 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 98.16 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 98.16 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 98.15 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 98.15 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 98.13 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 98.13 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 98.13 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 98.13 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 98.13 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 98.12 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 98.12 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 98.11 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 98.1 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 98.09 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 98.08 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 98.07 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 98.07 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 98.07 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 98.05 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 98.05 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 98.04 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 98.02 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 98.01 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 98.0 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 98.0 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 97.97 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 97.96 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 97.96 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 97.95 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 97.94 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 97.94 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 97.91 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 97.89 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 97.85 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 97.75 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 97.72 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 97.72 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 97.71 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 97.54 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 97.48 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 97.09 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 96.89 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 96.82 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 96.61 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 96.34 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 96.06 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 95.14 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 95.12 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 95.07 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 94.18 | |
| 2f9i_B | 285 | Acetyl-coenzyme A carboxylase carboxyl transferase | 90.53 | |
| 2x24_A | 793 | Acetyl-COA carboxylase; fatty acid biosynthesis, l | 81.66 |
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
Probab=100.00 E-value=7.7e-43 Score=253.16 Aligned_cols=113 Identities=36% Similarity=0.590 Sum_probs=109.9
Q ss_pred CcccCCCeEEEEehhhhhHHHHHHhcCCCCcEEecCCceeeeecCCccC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHhC
Q psy5228 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGA-QGQASDIEIQAREILYLRQRLNEILSEKTG 79 (114)
Q Consensus 1 m~~~~~~V~t~~~G~aaS~as~i~~ag~~~~R~~~p~s~~miH~p~~~~-~G~~~~l~~~~~~l~~~~~~~~~~ya~~tg 79 (114)
|+++++||+|+|+|+|+|||++|+++|++|+|++.|||++|||||+++. .|+++|+++++++|+++++.+.++|+++||
T Consensus 92 m~~~~~~V~t~~~G~AaS~as~il~aG~~gkR~~lP~a~iMIHqP~~~~~~G~a~di~i~a~el~~~~~~i~~iya~~TG 171 (205)
T 4gm2_A 92 INYISSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTE 171 (205)
T ss_dssp HHHSSSCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEEECCCCCCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred HHhcCCCEEEEEEeeehhHHHHHHhcCCCCCEEecCCCEEEEecCcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence 6789999999999999999999999999999999999999999999998 999999999999999999999999999999
Q ss_pred CCHHHHHhhhcCCceecHHHHHHcCcceeecccC
Q psy5228 80 HSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQR 113 (114)
Q Consensus 80 ~s~~~i~~~m~~~~~lta~eA~~~GliD~Ii~~~ 113 (114)
++.|+|.++|++|+||||+||++|||||+|++++
T Consensus 172 ~~~e~I~~~m~rd~~msa~EA~eyGlID~V~~~e 205 (205)
T 4gm2_A 172 KDTNVISNVLERDKYFNADEAVDFKLIDHILEKE 205 (205)
T ss_dssp CCHHHHHHHTTSCEEEEHHHHHHTTSCSEECCC-
T ss_pred CCHHHHHHHhcCCcccCHHHHHHcCCccEeecCC
Confidence 9999999999999999999999999999999864
|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
| >2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 114 | ||||
| d1yg6a1 | 183 | c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es | 1e-49 | |
| d1tg6a1 | 193 | c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum | 5e-42 | |
| d2cbya1 | 179 | c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My | 3e-34 | |
| d2f6ia1 | 190 | c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P | 2e-31 | |
| d1y7oa1 | 192 | c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str | 1e-27 |
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Clp protease, ClpP subunit domain: Clp protease, ClpP subunit species: Escherichia coli [TaxId: 562]
Score = 153 bits (388), Expect = 1e-49
Identities = 74/113 (65%), Positives = 94/113 (83%)
Query: 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQA 60
MQFIKP+VST+C+G AASMGAFLL +G KGKRF LPNSR+MIHQPLGG QGQA+DIEI A
Sbjct: 70 MQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHA 129
Query: 61 REILYLRQRLNEILSEKTGHSVKKISQDTDRDNFMSAKMAMEYCLIDKILKQR 113
REIL ++ R+NE+++ TG S+++I +DT+RD F+SA A+EY L+D IL R
Sbjct: 130 REILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHR 182
|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 114 | |||
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 100.0 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 100.0 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 100.0 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 100.0 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 100.0 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 98.45 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 98.39 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 98.34 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 98.33 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 98.27 | |
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 98.21 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 98.18 | |
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 98.18 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 98.16 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 98.14 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 98.1 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 97.96 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 97.87 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 97.83 | |
| d2f9ya1 | 316 | Acetyl-coenzyme A carboxylase carboxyl transferase | 97.35 | |
| d1vrga2 | 264 | Propionyl-CoA carboxylase complex B subunit, PccB | 96.21 | |
| d1on3a2 | 264 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 95.93 | |
| d1pixa3 | 299 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 95.37 | |
| d1xnya2 | 263 | Propionyl-CoA carboxylase complex B subunit, PccB | 93.59 | |
| d2a7sa2 | 271 | Propionyl-CoA carboxylase complex B subunit, PccB | 91.04 |
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Clp protease, ClpP subunit domain: Clp protease, ClpP subunit species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
Probab=100.00 E-value=9.9e-42 Score=243.65 Aligned_cols=114 Identities=51% Similarity=0.798 Sum_probs=111.8
Q ss_pred CcccCCCeEEEEehhhhhHHHHHHhcCCCCcEEecCCceeeeecCCccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCC
Q psy5228 1 MQFIKPNVSTLCIGLAASMGAFLLASGTKGKRFSLPNSRIMIHQPLGGAQGQASDIEIQAREILYLRQRLNEILSEKTGH 80 (114)
Q Consensus 1 m~~~~~~V~t~~~G~aaS~as~i~~ag~~~~R~~~p~s~~miH~p~~~~~G~~~~l~~~~~~l~~~~~~~~~~ya~~tg~ 80 (114)
|+++++||+|+|.|.|+|||++|++||++|+|++.|||++|||||++++.|++.|++.++++++++++.+.++|+++||+
T Consensus 80 i~~~~~~V~tv~~G~aaS~a~~il~aG~~g~R~~~pns~~miHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg~ 159 (193)
T d1tg6a1 80 MQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQ 159 (193)
T ss_dssp HHHSCSCEEEEEEEEEETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred HHhhcCceEEEEccchHHHHHHHhhcCccCccccCcccHHHhcCCccCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence 57899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHhhhcCCceecHHHHHHcCcceeecccCC
Q psy5228 81 SVKKISQDTDRDNFMSAKMAMEYCLIDKILKQRK 114 (114)
Q Consensus 81 s~~~i~~~m~~~~~lta~eA~~~GliD~Ii~~~~ 114 (114)
+.++|+++|++|+||||+||++|||||+|++++|
T Consensus 160 ~~~~i~~~~~rD~~lta~EAl~yGliD~Ii~~~p 193 (193)
T d1tg6a1 160 SLQVIESAMERDRYMSPMEAQEFGILDKVLVHPP 193 (193)
T ss_dssp CHHHHHHHHSSCEEECHHHHHHHTSCSEECSSCC
T ss_pred CHHHHHHHhccCccCCHHHHHHcCCCCEEccCCC
Confidence 9999999999999999999999999999999876
|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|