Psyllid ID: psy5252


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANREIAGEDNPASNEDR
cEEEcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHEEHEEEcccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccccccHHHHHHHccccHHHHHHHHHHEEccHcHHHHHHHHHHHHHHHccHHHHHEEccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
mvgigeasystiaptiISDLFVKDLRSQMLAFFYFAIpigsglgyivGSTAFsvmgawpwslrvtPVLGACAVLLILFFmedpergeaegrvteerTSFGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHafgdagspYLIGLLSEMFRHSLQLGASTLVAnamlpsslapslpfsssnstslplvssldetahrsdeflahksdeflaHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARAnreiagednpasnedr
mvgigeasystiaptIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFmedpergeaegrvteertsfgEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANreiagednpasnedr
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMlpsslapslpfsssnstslplvsslDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANREIAGEDNPASNEDR
*******SYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFME*****************FGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANA******************************************EFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQD********************
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFME******************GEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARA****************
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFMEDPER*************FGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLA***************VSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANREIA***********
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFMEDPER***********TSFGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANRE*************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKNHRETWIFLNLNWSIVADMTLYVVLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSDEFLAHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANREIAGEDNPASNEDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query285 2.2.26 [Sep-21-2011]
Q9GQQ0 605 Protein spinster OS=Droso yes N/A 0.382 0.180 0.636 5e-34
Q91VM4549 Protein spinster homolog yes N/A 0.950 0.493 0.334 1e-32
B0JZE1513 Protein spinster homolog yes N/A 0.926 0.514 0.336 2e-32
Q7ZU13506 Protein spinster homolog yes N/A 0.382 0.215 0.585 8e-31
Q8IVW8549 Protein spinster homolog yes N/A 0.498 0.258 0.486 8e-28
A2SWM2504 Protein spinster homolog no N/A 0.407 0.230 0.524 5e-27
Q5XGK0526 Protein spinster homolog N/A N/A 0.442 0.239 0.530 2e-26
A8WGF7526 Protein spinster homolog no N/A 0.442 0.239 0.523 1e-25
A2CER7498 Protein spinster homolog no N/A 0.4 0.228 0.521 4e-25
Q08DX7528 Protein spinster homolog no N/A 0.442 0.238 0.519 2e-24
>sp|Q9GQQ0|SPIN_DROME Protein spinster OS=Drosophila melanogaster GN=spin PE=1 SV=1 Back     alignment and function desciption
 Score =  145 bits (365), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 70/110 (63%), Positives = 85/110 (77%), Gaps = 1/110 (0%)

Query: 1   MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPW 60
           +VGIGEASYSTIAPTIISDLFV D+RS+MLA FYFAIP+GSGLGYIVGS    +   W W
Sbjct: 212 LVGIGEASYSTIAPTIISDLFVHDMRSKMLALFYFAIPVGSGLGYIVGSKTAHLANDWRW 271

Query: 61  SLRVTPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKNH 110
           +LRVTP+LG  AV LIL  ++DP RG +EG    E T++ +DI+AL +N 
Sbjct: 272 ALRVTPILGIVAVFLIL-LIKDPVRGHSEGSHNLEATTYKQDIKALVRNR 320




Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage. Involved in TGF-beta-mediated synaptic growth regulation both pre- and postsynaptically via its function in endosomal storage regulation. Also required during oogenesis by regulating yolk spheres storage.
Drosophila melanogaster (taxid: 7227)
>sp|Q91VM4|SPNS2_MOUSE Protein spinster homolog 2 OS=Mus musculus GN=Spns2 PE=2 SV=2 Back     alignment and function description
>sp|B0JZE1|SPNS2_XENTR Protein spinster homolog 2 OS=Xenopus tropicalis GN=spns2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZU13|SPNS1_DANRE Protein spinster homolog 1 OS=Danio rerio GN=spns1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IVW8|SPNS2_HUMAN Protein spinster homolog 2 OS=Homo sapiens GN=SPNS2 PE=1 SV=2 Back     alignment and function description
>sp|A2SWM2|SPNS2_DANRE Protein spinster homolog 2 OS=Danio rerio GN=spns2 PE=1 SV=2 Back     alignment and function description
>sp|Q5XGK0|SPNS1_XENLA Protein spinster homolog 1 OS=Xenopus laevis GN=spns1 PE=2 SV=1 Back     alignment and function description
>sp|A8WGF7|SPNS1_XENTR Protein spinster homolog 1 OS=Xenopus tropicalis GN=spns1 PE=2 SV=2 Back     alignment and function description
>sp|A2CER7|SPNS3_DANRE Protein spinster homolog 3 OS=Danio rerio GN=spns3 PE=2 SV=1 Back     alignment and function description
>sp|Q08DX7|SPNS1_BOVIN Protein spinster homolog 1 OS=Bos taurus GN=SPNS1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
260799756376 hypothetical protein BRAFLDRAFT_124438 [ 0.943 0.715 0.387 4e-39
291233769368 PREDICTED: spinster homolog 1-like [Sacc 0.971 0.752 0.364 3e-38
193641068 533 PREDICTED: protein spinster-like [Acyrth 0.273 0.146 0.678 1e-37
242006195 445 conserved hypothetical protein [Pediculu 0.235 0.150 0.694 1e-36
410051087 529 PREDICTED: protein spinster homolog 2 [P 0.603 0.325 0.427 5e-35
158295702 618 AGAP006346-PB [Anopheles gambiae str. PE 0.382 0.176 0.645 4e-34
158295704 618 AGAP006346-PC [Anopheles gambiae str. PE 0.382 0.176 0.645 6e-34
158295700 637 AGAP006346-PA [Anopheles gambiae str. PE 0.382 0.171 0.645 6e-34
91084527 490 PREDICTED: similar to spinster CG8428-PC 0.203 0.118 0.636 6e-34
340712355 518 PREDICTED: LOW QUALITY PROTEIN: protein 0.249 0.137 0.645 6e-34
>gi|260799756|ref|XP_002594850.1| hypothetical protein BRAFLDRAFT_124438 [Branchiostoma floridae] gi|229280087|gb|EEN50861.1| hypothetical protein BRAFLDRAFT_124438 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 120/310 (38%), Positives = 172/310 (55%), Gaps = 41/310 (13%)

Query: 1   MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPW 60
           MVGIGEASYSTIAPTII+D+F KD R+ ML FFYFA P+GSGLG+IVG+    ++GAW W
Sbjct: 51  MVGIGEASYSTIAPTIIADMFTKDRRTTMLTFFYFATPVGSGLGFIVGTNVAKLLGAWQW 110

Query: 61  SLRVTPVLGACAVLLILFFMEDPERGEAEG---RVTEERTSFGEDIRALCKNHRE-TWIF 116
           +LRVTP+LG  AV+LIL F+ +P RGEA+G   R+T   TSF  D++ LC+   +   IF
Sbjct: 111 ALRVTPILGVVAVILILLFVPNPPRGEADGGNARLTN--TSFLTDLKQLCRKQADIALIF 168

Query: 117 LNLN-----------------WSI---VADMTLYVVLPLRRSTAEAFQILISHAFGDAGS 156
             +                  W      AD  +  +  L  +    F +L+S    +   
Sbjct: 169 GGITCAAGVIGTVAGAEWGKRWKKSNPTADPLVCAIGMLGCTPFLYFALLLSRT--NIIV 226

Query: 157 PYLIGLLSEMFRHSLQLGASTLVANAMLPSSLAPSLPFSSSNSTSLPLVSSLDETAHRSD 216
            Y++ L+ E+F   L L   TLVA+ +    L   +P   S + ++ +V         S 
Sbjct: 227 TYVLVLIGEIF---LCLN-WTLVADIV----LYVVIPTRRSTAEAVQIVICHLLGDAGSP 278

Query: 217 EFLAHKSDEFLAHKSDEFL----ALQYALFITSFIEVLGGIFFLLGSLYIVQDRARANRE 272
             +   SD  +A   D ++    +L+YAL I +F+ V+GG FFL  + +IV DRARA+R 
Sbjct: 279 YLIGIVSDA-IASGHDNYIIKYQSLKYALLINTFVCVIGGAFFLGCAFFIVGDRARADRI 337

Query: 273 IAGEDNPASN 282
             GE++  S+
Sbjct: 338 TRGEESEHSD 347




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|291233769|ref|XP_002736826.1| PREDICTED: spinster homolog 1-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|193641068|ref|XP_001945783.1| PREDICTED: protein spinster-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242006195|ref|XP_002423939.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212507209|gb|EEB11201.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|410051087|ref|XP_003315348.2| PREDICTED: protein spinster homolog 2 [Pan troglodytes] Back     alignment and taxonomy information
>gi|158295702|ref|XP_001688849.1| AGAP006346-PB [Anopheles gambiae str. PEST] gi|157016163|gb|EDO63855.1| AGAP006346-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295704|ref|XP_316366.4| AGAP006346-PC [Anopheles gambiae str. PEST] gi|157016164|gb|EAA44203.4| AGAP006346-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295700|ref|XP_001688848.1| AGAP006346-PA [Anopheles gambiae str. PEST] gi|157016162|gb|EDO63854.1| AGAP006346-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91084527|ref|XP_972584.1| PREDICTED: similar to spinster CG8428-PC [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340712355|ref|XP_003394727.1| PREDICTED: LOW QUALITY PROTEIN: protein spinster-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query285
FB|FBgn0086676 605 spin "spinster" [Drosophila me 0.378 0.178 0.642 1.2e-61
ZFIN|ZDB-GENE-020228-1506 spns1 "spinster homolog 1 (Dro 0.442 0.249 0.530 2.6e-57
MGI|MGI:1920908528 Spns1 "spinster homolog 1" [Mu 0.442 0.238 0.519 2e-56
RGD|1305613528 Spns1 "spinster homolog 1 (Dro 0.442 0.238 0.511 3.4e-56
UNIPROTKB|E2RBY9561 SPNS1 "Uncharacterized protein 0.442 0.224 0.526 1.1e-55
UNIPROTKB|Q9H2V7528 SPNS1 "Protein spinster homolo 0.438 0.236 0.515 1.4e-55
UNIPROTKB|F1RFH5528 SPNS1 "Uncharacterized protein 0.442 0.238 0.519 3.4e-55
UNIPROTKB|H3BMF4573 SPNS1 "Spinster, isoform CRA_a 0.438 0.218 0.515 4.4e-55
UNIPROTKB|Q08DX7528 SPNS1 "Protein spinster homolo 0.442 0.238 0.519 2.2e-54
ZFIN|ZDB-GENE-060531-7500 spns3 "spinster homolog 3 (Dro 0.417 0.238 0.508 1.6e-53
FB|FBgn0086676 spin "spinster" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 352 (129.0 bits), Expect = 1.2e-61, Sum P(2) = 1.2e-61
 Identities = 70/109 (64%), Positives = 85/109 (77%)

Query:     1 MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPW 60
             +VGIGEASYSTIAPTIISDLFV D+RS+MLA FYFAIP+GSGLGYIVGS    +   W W
Sbjct:   212 LVGIGEASYSTIAPTIISDLFVHDMRSKMLALFYFAIPVGSGLGYIVGSKTAHLANDWRW 271

Query:    61 SLRVTPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKN 109
             +LRVTP+LG  AV LIL  ++DP RG +EG    E T++ +DI+AL +N
Sbjct:   272 ALRVTPILGIVAVFLILL-IKDPVRGHSEGSHNLEATTYKQDIKALVRN 319


GO:0007422 "peripheral nervous system development" evidence=NAS
GO:0005886 "plasma membrane" evidence=NAS
GO:0045924 "regulation of female receptivity" evidence=IMP
GO:0043067 "regulation of programmed cell death" evidence=IMP
GO:0035193 "larval central nervous system remodeling" evidence=IMP
GO:0045477 "regulation of nurse cell apoptotic process" evidence=IMP
GO:0012501 "programmed cell death" evidence=NAS
GO:0007619 "courtship behavior" evidence=NAS
GO:0008582 "regulation of synaptic growth at neuromuscular junction" evidence=IMP
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0006897 "endocytosis" evidence=IMP
GO:0008333 "endosome to lysosome transport" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0048477 "oogenesis" evidence=IMP
GO:0048488 "synaptic vesicle endocytosis" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IMP
GO:0009267 "cellular response to starvation" evidence=IMP
GO:0007040 "lysosome organization" evidence=IMP
GO:0010001 "glial cell differentiation" evidence=IMP
GO:0008347 "glial cell migration" evidence=IMP
GO:0031982 "vesicle" evidence=IDA
GO:0090099 "negative regulation of decapentaplegic signaling pathway" evidence=IGI
ZFIN|ZDB-GENE-020228-1 spns1 "spinster homolog 1 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1920908 Spns1 "spinster homolog 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305613 Spns1 "spinster homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBY9 SPNS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2V7 SPNS1 "Protein spinster homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFH5 SPNS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H3BMF4 SPNS1 "Spinster, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DX7 SPNS1 "Protein spinster homolog 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060531-7 spns3 "spinster homolog 3 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query285
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 3e-07
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-07
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
 Score = 50.5 bits (121), Expect = 3e-07
 Identities = 39/202 (19%), Positives = 68/202 (33%), Gaps = 8/202 (3%)

Query: 1   MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPW 60
           + G+G  +    A  +I+D F  + R + L        +G+ LG ++G    + +  W  
Sbjct: 94  LQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGG-LLASLFGWRA 152

Query: 61  SLRV-TPVLGACAVLLILFFMEDPERGEAEGRVTEERTSFGEDIRALCKNHRETWIFLNL 119
           +  +   +    AVL  L     P   +      E         + L ++     +   L
Sbjct: 153 AFLILAILALLAAVLAALLLPRPPPESKRPKPAEEAPAPLVPAWKLLLRDPVLWLLLALL 212

Query: 120 NWSIVADMTLYVVLPLRR-----STAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLG 174
            +       L   LPL +     S   A  +L       A    L+G LS+      +L 
Sbjct: 213 LFGFAF-FALLTYLPLYQEVLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLL 271

Query: 175 ASTLVANAMLPSSLAPSLPFSS 196
            + L+           SL  SS
Sbjct: 272 LALLLLILAALGLALLSLTESS 293


Length = 346

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 285
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.91
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.83
PRK11663434 regulatory protein UhpC; Provisional 99.83
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.83
KOG1330|consensus493 99.82
TIGR00893399 2A0114 d-galactonate transporter. 99.81
KOG2532|consensus466 99.8
PRK03545390 putative arabinose transporter; Provisional 99.8
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.79
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.78
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.78
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.77
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.76
PRK09952438 shikimate transporter; Provisional 99.76
PRK11010491 ampG muropeptide transporter; Validated 99.76
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.76
PRK10642490 proline/glycine betaine transporter; Provisional 99.75
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.75
PRK10489417 enterobactin exporter EntS; Provisional 99.75
PRK12307426 putative sialic acid transporter; Provisional 99.74
PLN00028476 nitrate transmembrane transporter; Provisional 99.74
PRK15075434 citrate-proton symporter; Provisional 99.73
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.73
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.72
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.72
PRK03893496 putative sialic acid transporter; Provisional 99.71
TIGR00897402 2A0118 polyol permease family. This family of prot 99.71
PRK03699394 putative transporter; Provisional 99.7
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.7
PRK11902402 ampG muropeptide transporter; Reviewed 99.69
PRK09705393 cynX putative cyanate transporter; Provisional 99.69
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.69
TIGR00900365 2A0121 H+ Antiporter protein. 99.69
KOG2533|consensus495 99.68
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.68
PRK09874408 drug efflux system protein MdtG; Provisional 99.68
PRK10091382 MFS transport protein AraJ; Provisional 99.68
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.67
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.67
PRK15011393 sugar efflux transporter B; Provisional 99.66
PRK11646400 multidrug resistance protein MdtH; Provisional 99.66
PRK05122399 major facilitator superfamily transporter; Provisi 99.65
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.65
PRK12382392 putative transporter; Provisional 99.65
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.64
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.64
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.63
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.63
TIGR00891405 2A0112 putative sialic acid transporter. 99.62
PRK11195393 lysophospholipid transporter LplT; Provisional 99.61
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.6
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.6
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.6
PRK10504471 putative transporter; Provisional 99.59
PRK09528420 lacY galactoside permease; Reviewed 99.58
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.58
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.56
PRK15403413 multidrug efflux system protein MdtM; Provisional 99.55
PRK10054395 putative transporter; Provisional 99.55
KOG3764|consensus464 99.55
PRK03633381 putative MFS family transporter protein; Provision 99.55
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.54
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.53
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.53
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.53
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.53
PRK10133438 L-fucose transporter; Provisional 99.53
TIGR00898505 2A0119 cation transport protein. 99.52
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.52
TIGR00895398 2A0115 benzoate transport. 99.51
TIGR00805 633 oat sodium-independent organic anion transporter. 99.51
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.5
PRK11043401 putative transporter; Provisional 99.48
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.48
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.47
TIGR00901356 2A0125 AmpG-related permease. 99.47
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.47
PRK11652394 emrD multidrug resistance protein D; Provisional 99.45
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.44
KOG2504|consensus509 99.42
TIGR00896355 CynX cyanate transporter. This family of proteins 99.42
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.4
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.37
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.36
COG0738422 FucP Fucose permease [Carbohydrate transport and m 99.35
PRK09669444 putative symporter YagG; Provisional 99.28
PRK10207489 dipeptide/tripeptide permease B; Provisional 99.27
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.26
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.25
KOG0252|consensus538 99.19
PRK10429473 melibiose:sodium symporter; Provisional 99.19
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.15
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.13
TIGR00788468 fbt folate/biopterin transporter. The only functio 99.12
KOG3626|consensus 735 99.1
KOG0569|consensus485 99.03
PF13347428 MFS_2: MFS/sugar transport protein 99.02
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.02
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 99.01
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.96
KOG2563|consensus480 98.95
PRK11462460 putative transporter; Provisional 98.92
PRK09848448 glucuronide transporter; Provisional 98.85
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 98.76
KOG0253|consensus528 98.76
COG2211467 MelB Na+/melibiose symporter and related transport 98.75
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.7
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.59
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.59
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.56
COG2270438 Permeases of the major facilitator superfamily [Ge 98.55
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.54
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.37
KOG4686|consensus459 98.37
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.34
PRK05122399 major facilitator superfamily transporter; Provisi 98.31
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.28
KOG2615|consensus451 98.26
PRK10489417 enterobactin exporter EntS; Provisional 98.21
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.16
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.15
PRK12382392 putative transporter; Provisional 98.12
PRK10054 395 putative transporter; Provisional 98.09
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.08
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 98.08
PRK09874408 drug efflux system protein MdtG; Provisional 98.06
PTZ00207 591 hypothetical protein; Provisional 98.03
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.95
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.94
TIGR00891 405 2A0112 putative sialic acid transporter. 97.94
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.93
TIGR00900 365 2A0121 H+ Antiporter protein. 97.92
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.9
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.89
TIGR00895 398 2A0115 benzoate transport. 97.89
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.88
PRK09705393 cynX putative cyanate transporter; Provisional 97.88
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.87
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.87
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 97.87
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 97.86
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.85
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.84
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.84
KOG0254|consensus513 97.84
KOG0255|consensus521 97.82
PRK09528420 lacY galactoside permease; Reviewed 97.82
KOG2325|consensus488 97.81
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 97.78
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.77
PRK10642490 proline/glycine betaine transporter; Provisional 97.77
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.76
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.75
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.74
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 97.74
PLN00028 476 nitrate transmembrane transporter; Provisional 97.72
PRK03633381 putative MFS family transporter protein; Provision 97.7
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.68
PRK11663434 regulatory protein UhpC; Provisional 97.68
PRK03545390 putative arabinose transporter; Provisional 97.67
PRK10091 382 MFS transport protein AraJ; Provisional 97.67
PRK11043 401 putative transporter; Provisional 97.66
TIGR00893399 2A0114 d-galactonate transporter. 97.65
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.62
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.6
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.58
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.58
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.57
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.56
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.56
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.55
KOG1330|consensus 493 97.54
PRK15011393 sugar efflux transporter B; Provisional 97.52
PRK11010491 ampG muropeptide transporter; Validated 97.49
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.48
KOG2816|consensus463 97.47
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.46
KOG2615|consensus 451 97.46
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.45
PRK11646400 multidrug resistance protein MdtH; Provisional 97.43
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.42
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.42
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.41
PRK03893496 putative sialic acid transporter; Provisional 97.4
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.22
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.18
PRK09952438 shikimate transporter; Provisional 97.18
TIGR00805 633 oat sodium-independent organic anion transporter. 97.14
TIGR00898505 2A0119 cation transport protein. 97.13
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.12
PRK12307426 putative sialic acid transporter; Provisional 97.09
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 97.08
TIGR00902382 2A0127 phenyl proprionate permease family protein. 97.04
PF00854372 PTR2: POT family; InterPro: IPR000109 This entry r 97.02
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.99
TIGR00897402 2A0118 polyol permease family. This family of prot 96.98
PRK10504471 putative transporter; Provisional 96.9
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.9
TIGR00901 356 2A0125 AmpG-related permease. 96.87
TIGR00788468 fbt folate/biopterin transporter. The only functio 96.87
COG2270438 Permeases of the major facilitator superfamily [Ge 96.86
KOG0255|consensus 521 96.8
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.8
KOG3762|consensus618 96.79
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.68
PRK15402406 multidrug efflux system translocase MdfA; Provisio 96.59
KOG2532|consensus 466 96.53
COG3202509 ATP/ADP translocase [Energy production and convers 96.48
PRK03699394 putative transporter; Provisional 96.44
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.44
KOG4686|consensus459 96.42
PRK15075434 citrate-proton symporter; Provisional 96.36
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 96.35
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 96.25
COG2807395 CynX Cyanate permease [Inorganic ion transport and 96.25
PRK11902402 ampG muropeptide transporter; Reviewed 96.14
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.11
KOG3762|consensus618 96.07
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 96.0
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 95.83
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 95.82
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 95.72
KOG2504|consensus509 95.71
PRK10406432 alpha-ketoglutarate transporter; Provisional 95.7
KOG3098|consensus461 95.67
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 95.59
KOG0569|consensus485 95.42
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 95.18
KOG0254|consensus 513 95.17
PRK11195393 lysophospholipid transporter LplT; Provisional 95.17
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 94.91
TIGR00896355 CynX cyanate transporter. This family of proteins 94.91
TIGR01272310 gluP glucose/galactose transporter. Disruption of 94.47
PRK09848448 glucuronide transporter; Provisional 94.35
PRK09669444 putative symporter YagG; Provisional 94.35
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 94.22
KOG3764|consensus 464 94.0
COG0477338 ProP Permeases of the major facilitator superfamil 93.73
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 93.31
KOG2533|consensus 495 92.69
PF07672267 MFS_Mycoplasma: Mycoplasma MFS transporter; InterP 92.21
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 91.63
KOG2816|consensus 463 91.62
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 91.53
KOG0252|consensus538 90.89
PRK10429473 melibiose:sodium symporter; Provisional 89.93
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 89.88
PRK10133438 L-fucose transporter; Provisional 89.3
PF1283277 MFS_1_like: MFS_1 like family 89.18
KOG2325|consensus488 89.17
PTZ00207591 hypothetical protein; Provisional 88.3
KOG0253|consensus528 88.12
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 86.87
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 86.57
KOG3810|consensus433 86.16
PF13347428 MFS_2: MFS/sugar transport protein 86.14
COG2211 467 MelB Na+/melibiose symporter and related transport 83.9
PRK11462460 putative transporter; Provisional 80.56
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=99.91  E-value=6.9e-25  Score=183.67  Aligned_cols=254  Identities=14%  Similarity=0.099  Sum_probs=188.8

Q ss_pred             CcccccccccchhHHHHhhcccCCchhHHHHHHHHHHhhHHHHHHHHH--HHhhhccCCchHHHHHhhHHHHHHHHHHHH
Q psy5252           1 MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVG--STAFSVMGAWPWSLRVTPVLGACAVLLILF   78 (285)
Q Consensus         1 l~G~g~~~~~~~~~~~i~~~~~~~~rg~~~gi~~~~~~iG~~~g~~l~--~~l~~~~g~wr~~f~i~~~~~~~~~~l~~~   78 (285)
                      +.|..+|..+|++...+++|+|++|||+..++++++.|+|..+.+++.  +++..+++ ||..|++.++++++..++.++
T Consensus       126 lng~fQg~Gwpp~~~~i~~Wfsr~eRG~~~siWn~shNiGGal~~~~~~la~~~~~~~-w~~~f~~pgiiaiival~~~~  204 (448)
T COG2271         126 LNGWFQGMGWPPCARTITHWFSRKERGTWWSIWNTSHNIGGALAPLVALLAFFAFHGG-WRAAFYFPGIIAIIVALILLF  204 (448)
T ss_pred             HHHHHhcCCCcHHHHHHHHHcCccccCceEEEehhhhhcccchHHHHHHHHHHHhccc-hhHHHHHHHHHHHHHHHHHHH
Confidence            468889999999999999999999999999999999999999999999  88988875 999999999999999999999


Q ss_pred             hccCCcCccc------------cCcccccc---ccHHH-HHHHHhhhhhhHHH-----------HHHHHHHHHHHHHHHh
Q psy5252          79 FMEDPERGEA------------EGRVTEER---TSFGE-DIRALCKNHRETWI-----------FLNLNWSIVADMTLYV  131 (285)
Q Consensus        79 ~~~~~~~~~~------------~~~~~~~~---~~~~~-~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~  131 (285)
                      ..+|+|++..            +..+++++   .+.++ -++.+++||..|++           +....|.|.|.....+
T Consensus       205 ~~rd~Pqs~GLP~ie~~~~d~~e~~~~~~~~~~ls~~~i~~~YVL~Nk~iW~la~a~vfvYivR~gi~dW~p~YL~e~k~  284 (448)
T COG2271         205 LLRDRPQSEGLPPIEEYRGDPLEIYEEEKENEGLTAWQIFVKYVLKNKLIWLLALANVFVYVVRYGINDWGPLYLSEVKG  284 (448)
T ss_pred             HhCCCccccCCCCHHHhhcCchhhhhhhccCCCccHHHHHHHHHHcChHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhcC
Confidence            9998775321            11011111   22233 35778899988872           2356789999888888


Q ss_pred             cCCCCcchhHHHHHHHhhhccccchhhhhHHHhHHhhhhhcccc--eeee------eec-ccccc---cccccccccccc
Q psy5252         132 VLPLRRSTAEAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGA--STLV------ANA-MLPSS---LAPSLPFSSSNS  199 (285)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~g~~~g~~~~G~l~d~~~~~~~~~~--~~~~------~~~-~~~~~---~~~~~~~~~~~~  199 (285)
                      .+....+...++.-     .+++.|++++|++|||+.+.++...  .+.+      +.+ ..+..   +....++..+..
T Consensus       285 ~s~~~a~~a~~lfE-----~agl~G~Ll~GwlSDklfkgrR~p~~~i~~~~i~~~~~~~w~~~~~~~~l~~~~l~~iGf~  359 (448)
T COG2271         285 FSLVKANWAISLFE-----VAGLPGTLLAGWLSDKLFKGRRGPMALIFMLLITASLVLYWLAPNGSYLLDAILLFIIGFL  359 (448)
T ss_pred             CCHHHHHHHHHHHH-----HHhhHHHHHHHHHHHHhcccccchHHHHHHHHHHHHHHHHHcCCCccHHHHHHHHHHHHHH
Confidence            88888888877776     7888899999999999875543333  2211      111 11111   223333334456


Q ss_pred             CCcch---hhhhccccCCcch-----------hh-hccccchhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHhh
Q psy5252         200 TSLPL---VSSLDETAHRSDE-----------FL-AHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGSL  260 (285)
Q Consensus       200 ~~~~~---~~~~~~~~p~~~r-----------~l-~~~~~p~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  260 (285)
                      ..+|+   .....|.+|++..           ++ |...+....|++.|.+||...|++..+..+++.+++..+..
T Consensus       360 IyGPqmLiGl~a~e~~pK~AaGtA~Gf~Glf~Yl~Ga~~a~~~~g~i~d~~gW~g~Fi~~~~~a~l~~lll~~~~~  435 (448)
T COG2271         360 IYGPQMLIGLAAAEFVPKKAAGTATGFVGLFAYLIGAALAGLPLGYIADTWGWDGGFIVLSIAALLAILLLLPVWN  435 (448)
T ss_pred             HhhHHHHHHHHHhccccHhhccchhchhhhHHHHhhHHhcCCcceeeEecCCCcchHHHHHHHHHHHHHHHHHHHh
Confidence            66776   3445699999886           14 66788888889999999999999888888888777666543



>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF07672 MFS_Mycoplasma: Mycoplasma MFS transporter; InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS) Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.85
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.79
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.7
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.62
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.5
2cfq_A417 Lactose permease; transport, transport mechanism, 99.49
2xut_A 524 Proton/peptide symporter family protein; transport 99.28
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.08
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 97.91
2cfq_A417 Lactose permease; transport, transport mechanism, 97.82
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 97.76
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 97.62
2xut_A524 Proton/peptide symporter family protein; transport 97.61
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 97.31
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.85  E-value=2.9e-22  Score=175.94  Aligned_cols=258  Identities=10%  Similarity=0.107  Sum_probs=163.8

Q ss_pred             CcccccccccchhHHHHhhcccCCchhHHHHHHHHHHhhHHHHHHHHHHHhhhccCCchHHHHHhhHHHHHHHHHHHHhc
Q psy5252           1 MVGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFM   80 (285)
Q Consensus         1 l~G~g~~~~~~~~~~~i~~~~~~~~rg~~~gi~~~~~~iG~~~g~~l~~~l~~~~g~wr~~f~i~~~~~~~~~~l~~~~~   80 (285)
                      ++|++.+...+...++++|++|+|+|++++++.+.+.++|.++++.+++.+.+..++||+.|++.+++.++..++..+++
T Consensus       128 l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l~~~~g~w~~~f~~~~~~~~~~~~~~~~~~  207 (451)
T 1pw4_A          128 LCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMM  207 (451)
T ss_dssp             HHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHhhhccchHHHHHHHHCCchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHHHHhhc
Confidence            36888999999999999999999999999999999999999999999999888763399999999988888777777778


Q ss_pred             cCCcCccccCccc---c-----------ccccHHHH-HHHHhhhhhhHHHHHH--HH----HHHHHHHHHHhcCCCCcch
Q psy5252          81 EDPERGEAEGRVT---E-----------ERTSFGED-IRALCKNHRETWIFLN--LN----WSIVADMTLYVVLPLRRST  139 (285)
Q Consensus        81 ~~~~~~~~~~~~~---~-----------~~~~~~~~-~~~~~~~~~~~~~~~~--~~----~~~~~~~~~~~~~~~~~~~  139 (285)
                      ||++++....+.+   +           ++.+.++. .+..+++|.++.....  ..    .........+..+....+.
T Consensus       208 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  287 (451)
T 1pw4_A          208 RDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFAL  287 (451)
T ss_dssp             CCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCH
T ss_pred             cCCHhhcCCCChhhhcccccccchhhhhcccccccchHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCH
Confidence            8765432211100   0           01111221 4566777776652211  11    1111111122222112222


Q ss_pred             hHHHHHHHhhhccccchhhhhHHHhHHh--hhhhcccceeee---eec---cc-c--cc-c-ccc-cccccc-ccCCcch
Q psy5252         140 AEAFQILISHAFGDAGSPYLIGLLSEMF--RHSLQLGASTLV---ANA---ML-P--SS-L-APS-LPFSSS-NSTSLPL  204 (285)
Q Consensus       140 ~~~~~~~~~~~~g~~~g~~~~G~l~d~~--~~~~~~~~~~~~---~~~---~~-~--~~-~-~~~-~~~~~~-~~~~~~~  204 (285)
                      ...........++.+++.++.|+++||+  ++|+........   ++.   .. +  .. . ... .....+ .......
T Consensus       288 ~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~  367 (451)
T 1pw4_A          288 DKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLI  367 (451)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhHHHHHHHHHHHHHHHHHHhcccCHHHHHHHHHHHHHHHhchHHHH
Confidence            2222223333466777888999999999  877654432211   111   11 1  11 1 111 111111 2223334


Q ss_pred             hhhhccccCCcch-----------hh-hccccchhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHH
Q psy5252         205 VSSLDETAHRSDE-----------FL-AHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLG  258 (285)
Q Consensus       205 ~~~~~~~~p~~~r-----------~l-~~~~~p~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  258 (285)
                      .+.+.|.+|++.|           .+ +..++|.+.|.+.|+.|++..+++.+++.+++.++....
T Consensus       368 ~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~g~l~~~~g~~~~~~~~~~~~~~~~~~~~~~  433 (451)
T 1pw4_A          368 GLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVV  433 (451)
T ss_dssp             HHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHHH
Confidence            5788899999987           16 788999999999999999999988888777777666543



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query285
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.83
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.41
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.39
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.03
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.83  E-value=4e-21  Score=165.95  Aligned_cols=258  Identities=10%  Similarity=0.063  Sum_probs=162.1

Q ss_pred             cccccccccchhHHHHhhcccCCchhHHHHHHHHHHhhHHHHHHHHHHHhhhccCCchHHHHHhhHHHHHHHHHHHHhcc
Q psy5252           2 VGIGEASYSTIAPTIISDLFVKDLRSQMLAFFYFAIPIGSGLGYIVGSTAFSVMGAWPWSLRVTPVLGACAVLLILFFME   81 (285)
Q Consensus         2 ~G~g~~~~~~~~~~~i~~~~~~~~rg~~~gi~~~~~~iG~~~g~~l~~~l~~~~g~wr~~f~i~~~~~~~~~~l~~~~~~   81 (285)
                      +|++.+...+...++++|++|+++|++++++++.+.++|..+++.+++.+....++||+.|++.+++.++..++.+.+.+
T Consensus       126 ~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~  205 (447)
T d1pw4a_         126 CGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVALFAFAMMR  205 (447)
T ss_dssp             HHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHHHHHHhcc
Confidence            57888889999999999999999999999999999999999999999988877656999999999988888888888887


Q ss_pred             CCcCccccCcc---------------ccccccHHHHHHHHhhhhhhHHHHH--HHH----HHHHHHHHHHhcCCCCcchh
Q psy5252          82 DPERGEAEGRV---------------TEERTSFGEDIRALCKNHRETWIFL--NLN----WSIVADMTLYVVLPLRRSTA  140 (285)
Q Consensus        82 ~~~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~~~~--~~~----~~~~~~~~~~~~~~~~~~~~  140 (285)
                      ++++.......               +++........+..++++.++....  ...    +........+..+....+..
T Consensus       206 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  285 (447)
T d1pw4a_         206 DTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLKEVKHFALD  285 (447)
T ss_dssp             CSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHBTTBSCCCHH
T ss_pred             cchhhcccchhhhhhhhcccchhhccccccchhhHHHHHHHcCchHHHHHHHhhhhhhhhhcchhhhhhhcccccccccc
Confidence            76543221100               0011112233455666666654221  111    11111122233232233333


Q ss_pred             HHHHHHHhhhccccchhhhhHHHhHHhhhhhcccceee-----e---eeccc--ccc--c-cccc-ccccc-ccCCcchh
Q psy5252         141 EAFQILISHAFGDAGSPYLIGLLSEMFRHSLQLGASTL-----V---ANAML--PSS--L-APSL-PFSSS-NSTSLPLV  205 (285)
Q Consensus       141 ~~~~~~~~~~~g~~~g~~~~G~l~d~~~~~~~~~~~~~-----~---~~~~~--~~~--~-~~~~-~~~~~-~~~~~~~~  205 (285)
                      ..........++.+++.++.|+++||++++........     .   ..+..  ...  + ...+ ....+ .+......
T Consensus       286 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~  365 (447)
T d1pw4a_         286 KSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAGNPTVDMICMIVIGFLIYGPVMLIG  365 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSCCTTCHHHHHHHHHHHHHHHTHHHHHHH
T ss_pred             hhhhhhhcchhhhhhhhhhhhhhhhhccccccccccchhHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHH
Confidence            23233333345667778899999999988754433110     0   01111  111  1 1111 11111 22333456


Q ss_pred             hhhccccCCcchh-----------h-hccccchhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHh
Q psy5252         206 SSLDETAHRSDEF-----------L-AHKSDEFLAHKSDEFLALQYALFITSFIEVLGGIFFLLGS  259 (285)
Q Consensus       206 ~~~~~~~p~~~r~-----------l-~~~~~p~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  259 (285)
                      ....|.+|++.|.           + +...+|.+.|.+.|+.|++..++....+.+++.+++....
T Consensus       366 ~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~  431 (447)
T d1pw4a_         366 LHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFGWDGGFMVMIGGSILAVILLIVVM  431 (447)
T ss_dssp             HHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHHHHHH
Confidence            7788999999882           2 2356889999999999999988877777777666655443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure