Psyllid ID: psy5270


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
cccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccccHHHHccccccEEcccccccccccHHHHHccccHHHHHcccccHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEccccccccccHHHHcccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccEEEEccccccccccHHHcccccccEEEccccccccccHHHHHHHHccEEEccccccccccHHHHHHHcccEEEccccccccccccHHHHHHHcccEEEccccccccccHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccEEEccccccccccHHHHcHHHHHHHHcccEEEcccccccHccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccccccccEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MLYITRitlshnklkeippglanlVNLEILTLFNNQietlptslsslpklriLNLGmnrlsslprgfgafpVLEVLDLTynnlneqslpgnfFMLETLRALYlgdndfevlpaeignLKNLQIILETFLpdmmeknrghivgissmagivglpnlvpycASKFAVRGLMEALAEELREDARnskikftsifpfmvdtglcknpkikmnrlsslprgfgafpvleafsfttILDLtynnlneqslpgnfFMLETLRALYlgdndfevlpaeignlknlqimleprwvismgscangggyyhysysvvrgcdriipvdiyvpgcpptAEALMYGILQLQKKVKRMKILQSWYRR
mlyitritlshnklkeippgLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIEtlptslsslpKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVrglmealaeelredarNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANgggyyhysysvvrgCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
**YITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWY**
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQK**KRMKILQSWY**
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIILETFLPDMMEKNRGHIVGISSMAGIVGLPNLVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMVDTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q5E9C0277 Ras suppressor protein 1 yes N/A 0.329 0.418 0.704 1e-43
Q15404277 Ras suppressor protein 1 yes N/A 0.329 0.418 0.696 8e-43
Q01730277 Ras suppressor protein 1 yes N/A 0.335 0.425 0.677 4e-42
P42026216 NADH dehydrogenase [ubiqu no N/A 0.207 0.337 0.863 8e-34
Q0MQI0213 NADH dehydrogenase [ubiqu no N/A 0.207 0.342 0.835 2e-33
P0CB83213 NADH dehydrogenase [ubiqu no N/A 0.207 0.342 0.835 2e-33
P0CB84213 NADH dehydrogenase [ubiqu N/A N/A 0.207 0.342 0.835 2e-33
Q0MQH9213 NADH dehydrogenase [ubiqu N/A N/A 0.207 0.342 0.835 2e-33
O75251213 NADH dehydrogenase [ubiqu no N/A 0.207 0.342 0.835 2e-33
Q9DC70224 NADH dehydrogenase [ubiqu no N/A 0.207 0.325 0.835 3e-33
>sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 Back     alignment and function desciption
 Score =  177 bits (448), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 100/122 (81%)

Query: 3   YITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRLSS 62
           +IT++ LSHNKL  +PP +A L NLE+L  FNNQIE LPT +SSL KL+ LNLGMNRL++
Sbjct: 41  HITQLVLSHNKLTTVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNT 100

Query: 63  LPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQ 122
           LPRGFG+ P LEVLDLTYNNLNE SLPGNFF L TLRALYL DNDFE+LP +IG L  LQ
Sbjct: 101 LPRGFGSLPALEVLDLTYNNLNENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQ 160

Query: 123 II 124
           I+
Sbjct: 161 IL 162




Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
Bos taurus (taxid: 9913)
>sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 Back     alignment and function description
>sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=2 SV=3 Back     alignment and function description
>sp|P42026|NDUS7_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Bos taurus GN=NDUFS7 PE=1 SV=1 Back     alignment and function description
>sp|Q0MQI0|NDUS7_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pan troglodytes GN=NDUFS7 PE=2 SV=1 Back     alignment and function description
>sp|P0CB83|NDUS7_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo abelii GN=NDUFS7 PE=2 SV=1 Back     alignment and function description
>sp|P0CB84|NDUS7_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Pongo pygmaeus GN=NDUFS7 PE=2 SV=1 Back     alignment and function description
>sp|Q0MQH9|NDUS7_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS7 PE=2 SV=1 Back     alignment and function description
>sp|O75251|NDUS7_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens GN=NDUFS7 PE=1 SV=3 Back     alignment and function description
>sp|Q9DC70|NDUS7_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Mus musculus GN=Ndufs7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
321461540271 hypothetical protein DAPPUDRAFT_200985 [ 0.323 0.420 0.8 2e-50
91076586284 PREDICTED: similar to icarus CG9031-PA [ 0.338 0.419 0.8 1e-49
270002622270 hypothetical protein TcasGA2_TC004946 [T 0.338 0.440 0.8 1e-49
350405379 503 PREDICTED: ras suppressor protein 1-like 0.338 0.236 0.784 3e-49
193613134287 PREDICTED: ras suppressor protein 1-like 0.292 0.358 0.792 3e-49
239790406199 ACYPI003499 [Acyrthosiphon pisum] 0.292 0.517 0.792 4e-49
383862509283 PREDICTED: ras suppressor protein 1-like 0.323 0.402 0.792 5e-49
340726496294 PREDICTED: ras suppressor protein 1-like 0.323 0.387 0.784 6e-49
328778234290 PREDICTED: ras suppressor protein 1 [Api 0.323 0.393 0.784 6e-49
380024743283 PREDICTED: LOW QUALITY PROTEIN: ras supp 0.323 0.402 0.784 7e-49
>gi|321461540|gb|EFX72571.1| hypothetical protein DAPPUDRAFT_200985 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  206 bits (523), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%)

Query: 1   MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIETLPTSLSSLPKLRILNLGMNRL 60
           ML +TRITL+HN++  + P LANL NLEIL LFNNQ+E LPTSLSS+PKLRILNLGMN+L
Sbjct: 38  MLNLTRITLTHNRISVVTPALANLTNLEILNLFNNQVEELPTSLSSMPKLRILNLGMNKL 97

Query: 61  SSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKN 120
           S+LPRGFGAFPVLEVLDLTYNNLNE SLPGNFFM+ETLRALYLGDNDFE +P EIG+LKN
Sbjct: 98  SALPRGFGAFPVLEVLDLTYNNLNESSLPGNFFMIETLRALYLGDNDFERIPPEIGHLKN 157

Query: 121 LQIIL 125
           LQI++
Sbjct: 158 LQILV 162




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91076586|ref|XP_968109.1| PREDICTED: similar to icarus CG9031-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002622|gb|EEZ99069.1| hypothetical protein TcasGA2_TC004946 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350405379|ref|XP_003487417.1| PREDICTED: ras suppressor protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|193613134|ref|XP_001951023.1| PREDICTED: ras suppressor protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|239790406|dbj|BAH71767.1| ACYPI003499 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383862509|ref|XP_003706726.1| PREDICTED: ras suppressor protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340726496|ref|XP_003401593.1| PREDICTED: ras suppressor protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328778234|ref|XP_395612.3| PREDICTED: ras suppressor protein 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380024743|ref|XP_003696151.1| PREDICTED: LOW QUALITY PROTEIN: ras suppressor protein 1-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
FB|FBgn0028546283 ics "icarus" [Drosophila melan 0.352 0.438 0.693 2.3e-46
UNIPROTKB|E2R9R1277 RSU1 "Uncharacterized protein" 0.346 0.440 0.655 2.9e-44
UNIPROTKB|Q5E9C0277 RSU1 "Ras suppressor protein 1 0.346 0.440 0.655 2.9e-44
UNIPROTKB|Q15404277 RSU1 "Ras suppressor protein 1 0.346 0.440 0.647 1.2e-43
RGD|1591781247 Rsu1 "Ras suppressor protein 1 0.352 0.502 0.645 1.6e-43
UNIPROTKB|E1BS02277 RSU1 "Uncharacterized protein" 0.346 0.440 0.639 3.2e-43
UNIPROTKB|E1BWI3204 RSU1 "Uncharacterized protein" 0.346 0.598 0.639 3.2e-43
MGI|MGI:103040277 Rsu1 "Ras suppressor protein 1 0.352 0.447 0.629 8.5e-43
UNIPROTKB|Q09497268 rsu-1 "Protein RSU-1" [Caenorh 0.346 0.455 0.663 1.6e-40
FB|FBgn0030718221 CG9172 [Drosophila melanogaste 0.207 0.330 0.739 2.9e-25
FB|FBgn0028546 ics "icarus" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 438 (159.2 bits), Expect = 2.3e-46, Sum P(2) = 2.3e-46
 Identities = 86/124 (69%), Positives = 99/124 (79%)

Query:     1 MLYITRITLSHNKLKEIPPGLANLVNLEILTLFNNQIEXXXXXXXXXXKLRILNLGMNRL 60
             M  ITR+TLSHNK+  I PG+ANL+NLEIL L NNQ+           KLRILN+ +NRL
Sbjct:    49 MSNITRLTLSHNKISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRL 108

Query:    61 SSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKN 120
              +LPRGFGAFPVLEVLDL+YNNLNEQ LPGNFF +ETLRALYLGDNDFE +P E+G LKN
Sbjct:   109 INLPRGFGAFPVLEVLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKN 168

Query:   121 LQII 124
             LQI+
Sbjct:   169 LQIL 172


GO:0005083 "small GTPase regulator activity" evidence=ISS
GO:0046329 "negative regulation of JNK cascade" evidence=IGI
GO:0043508 "negative regulation of JUN kinase activity" evidence=IMP
GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0007229 "integrin-mediated signaling pathway" evidence=IGI
UNIPROTKB|E2R9R1 RSU1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9C0 RSU1 "Ras suppressor protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q15404 RSU1 "Ras suppressor protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1591781 Rsu1 "Ras suppressor protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS02 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWI3 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:103040 Rsu1 "Ras suppressor protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q09497 rsu-1 "Protein RSU-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0030718 CG9172 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q1LPW2NUOB_RALME1, ., 6, ., 9, 9, ., 50.83580.19030.4187yesN/A
A4G643NUOB_HERAR1, ., 6, ., 9, 9, ., 50.82080.19030.4240yesN/A
Q5P1E9NUOB_AROAE1, ., 6, ., 9, 9, ., 50.83580.19030.4240yesN/A
A9BNB3NUOB_DELAS1, ., 6, ., 9, 9, ., 50.82080.19030.4213yesN/A
Q0KCS9NUOB_CUPNH1, ., 6, ., 9, 9, ., 50.83580.19030.4187yesN/A
Q8XXQ2NUOB_RALSO1, ., 6, ., 9, 9, ., 50.82080.19030.4187yesN/A
B2U7R0NUOB_RALPJ1, ., 6, ., 9, 9, ., 50.82080.19030.4187yesN/A
A1K5A9NUOB1_AZOSB1, ., 6, ., 9, 9, ., 50.83580.19030.4240yesN/A
B3R3W8NUOB_CUPTR1, ., 6, ., 9, 9, ., 50.83580.19030.4187yesN/A
A1TLL7NUOB_ACIAC1, ., 6, ., 9, 9, ., 50.82080.19030.4213yesN/A
Q473U2NUOB_CUPPJ1, ., 6, ., 9, 9, ., 50.83580.19030.4187yesN/A
A1W4M3NUOB_ACISJ1, ., 6, ., 9, 9, ., 50.82080.19030.4213yesN/A
A5IHW2NUOB_LEGPC1, ., 6, ., 9, 9, ., 50.81150.19600.4367yesN/A
Q5E9C0RSU1_BOVINNo assigned EC number0.70490.32950.4187yesN/A
Q15404RSU1_HUMANNo assigned EC number0.69670.32950.4187yesN/A
Q5X1A8NUOB_LEGPA1, ., 6, ., 9, 9, ., 50.81150.19600.4367yesN/A
Q5WT21NUOB_LEGPL1, ., 6, ., 9, 9, ., 50.81150.19600.4367yesN/A
Q5ZRT9NUOB_LEGPH1, ., 6, ., 9, 9, ., 50.81150.19600.4367yesN/A
A6SY06NUOB_JANMA1, ., 6, ., 9, 9, ., 50.82080.19030.4240yesN/A
B9MEL5NUOB_ACIET1, ., 6, ., 9, 9, ., 50.82080.19030.4213yesN/A
Q01730RSU1_MOUSENo assigned EC number0.67740.33520.4259yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.6.99.5LOW CONFIDENCE prediction!
3rd Layer1.1.1LOW CONFIDENCE prediction!
3rd Layer1.6.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
PRK06411183 PRK06411, PRK06411, NADH dehydrogenase subunit B; 1e-45
COG0377194 COG0377, NuoB, NADH:ubiquinone oxidoreductase 20 k 2e-42
TIGR01957145 TIGR01957, nuoB_fam, NADH-quinone oxidoreductase, 1e-40
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 2e-25
PRK14818173 PRK14818, PRK14818, NADH dehydrogenase subunit B; 3e-25
PRK13292 788 PRK13292, PRK13292, trifunctional NADH dehydrogena 9e-25
PRK14819264 PRK14819, PRK14819, NADH dehydrogenase subunit B; 2e-23
PRK14815183 PRK14815, PRK14815, NADH dehydrogenase subunit B; 4e-23
PRK14813189 PRK14813, PRK14813, NADH dehydrogenase subunit B; 1e-22
PRK14816182 PRK14816, PRK14816, NADH dehydrogenase subunit B; 2e-22
PRK14820180 PRK14820, PRK14820, NADH dehydrogenase subunit B; 1e-21
COG3260148 COG3260, COG3260, Ni,Fe-hydrogenase III small subu 4e-21
PRK14817181 PRK14817, PRK14817, NADH dehydrogenase subunit B; 1e-20
PRK14814186 PRK14814, PRK14814, NADH dehydrogenase subunit B; 2e-20
CHL00023225 CHL00023, ndhK, NADH dehydrogenase subunit K 8e-20
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 2e-18
pfam01058122 pfam01058, Oxidored_q6, NADH ubiquinone oxidoreduc 3e-18
cd05233234 cd05233, SDR_c, classical (c) SDRs 8e-18
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 1e-17
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 8e-16
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 2e-15
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 3e-15
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 2e-14
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 9e-14
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 9e-14
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-13
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 1e-13
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 6e-13
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 2e-12
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-12
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Pro 2e-12
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 3e-12
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-12
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 5e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-12
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 1e-11
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 1e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 2e-11
COG1028251 COG1028, FabG, Dehydrogenases with different speci 2e-11
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 3e-11
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 6e-11
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 7e-11
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 9e-11
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 1e-10
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-10
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 3e-10
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 4e-10
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-10
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 4e-10
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 5e-10
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 7e-10
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 1e-09
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 1e-09
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 1e-09
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 2e-09
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 2e-09
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 2e-09
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 3e-09
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-09
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 5e-09
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 6e-09
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 8e-09
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 8e-09
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 9e-09
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 9e-09
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 2e-08
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 2e-08
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 2e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-08
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-08
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 8e-08
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 9e-08
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 1e-07
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 1e-07
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 2e-07
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 2e-07
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 2e-07
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-07
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 5e-07
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 5e-07
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 6e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-07
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 8e-07
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 9e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 1e-06
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 1e-06
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 2e-06
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 4e-06
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 5e-06
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 6e-06
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 1e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-05
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 1e-05
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 1e-05
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 2e-05
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Pro 2e-05
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 3e-05
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 3e-05
COG1941247 COG1941, FrhG, Coenzyme F420-reducing hydrogenase, 3e-05
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-05
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 3e-05
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 4e-05
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 6e-05
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 6e-05
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-05
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 9e-05
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 1e-04
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-04
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 1e-04
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-04
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 2e-04
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 2e-04
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 2e-04
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 2e-04
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-04
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 4e-04
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 4e-04
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 4e-04
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Pro 4e-04
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 4e-04
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 5e-04
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-04
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 7e-04
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 9e-04
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 9e-04
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 0.001
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 0.001
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 0.001
TIGR03294228 TIGR03294, FrhG, coenzyme F420 hydrogenase, subuni 0.001
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 0.001
cd11730206 cd11730, Tthb094_like_SDR_c, Tthb094 and related p 0.001
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 0.002
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 0.002
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 0.002
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 0.003
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 0.003
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 0.004
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 0.004
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 0.004
PLN032101153 PLN03210, PLN03210, Resistant to P 0.004
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 0.004
>gnl|CDD|235797 PRK06411, PRK06411, NADH dehydrogenase subunit B; Validated Back     alignment and domain information
 Score =  153 bits (389), Expect = 1e-45
 Identities = 49/73 (67%), Positives = 60/73 (82%)

Query: 280 MLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKK 339
           M EP+WVISMGSCAN GG YHYSYSVV+G DRI+PVD+YVPGCPP  EAL+YGIL+LQKK
Sbjct: 99  MPEPKWVISMGSCANSGGMYHYSYSVVQGVDRIVPVDVYVPGCPPRPEALLYGILKLQKK 158

Query: 340 VKRMKILQSWYRR 352
           +++ +  +    R
Sbjct: 159 IRQSERERKRGER 171


Length = 183

>gnl|CDD|223454 COG0377, NuoB, NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233656 TIGR01957, nuoB_fam, NADH-quinone oxidoreductase, B subunit Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|173279 PRK14818, PRK14818, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|183955 PRK13292, PRK13292, trifunctional NADH dehydrogenase I subunit B/C/D; Provisional Back     alignment and domain information
>gnl|CDD|237822 PRK14819, PRK14819, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|237821 PRK14815, PRK14815, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|173274 PRK14813, PRK14813, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|173277 PRK14816, PRK14816, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|184833 PRK14820, PRK14820, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|225799 COG3260, COG3260, Ni,Fe-hydrogenase III small subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|173278 PRK14817, PRK14817, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|173275 PRK14814, PRK14814, NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|214337 CHL00023, ndhK, NADH dehydrogenase subunit K Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|216271 pfam01058, Oxidored_q6, NADH ubiquinone oxidoreductase, 20 Kd subunit Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|224852 COG1941, FrhG, Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|132337 TIGR03294, FrhG, coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444|consensus 1255 99.93
KOG0472|consensus565 99.92
KOG0617|consensus264 99.91
KOG0444|consensus 1255 99.91
KOG0472|consensus 565 99.91
KOG4194|consensus 873 99.88
KOG4194|consensus 873 99.85
KOG1687|consensus168 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
KOG0618|consensus 1081 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG0532|consensus 722 99.72
KOG4237|consensus498 99.71
KOG0617|consensus264 99.7
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.7
KOG0618|consensus 1081 99.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.66
KOG0532|consensus 722 99.61
COG0377194 NuoB NADH:ubiquinone oxidoreductase 20 kD subunit 99.56
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.52
KOG4237|consensus498 99.51
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.43
PLN03150623 hypothetical protein; Provisional 99.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.38
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.36
PRK14818173 NADH dehydrogenase subunit B; Provisional 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
KOG1259|consensus490 99.24
PLN03150623 hypothetical protein; Provisional 99.2
PRK14813189 NADH dehydrogenase subunit B; Provisional 99.15
COG3260148 Ni,Fe-hydrogenase III small subunit [Energy produc 99.12
PRK06411183 NADH dehydrogenase subunit B; Validated 99.06
PRK14816182 NADH dehydrogenase subunit B; Provisional 99.04
PRK14815183 NADH dehydrogenase subunit B; Provisional 99.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.04
CHL00023225 ndhK NADH dehydrogenase subunit K 99.03
KOG0531|consensus414 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.97
TIGR01957145 nuoB_fam NADH-quinone oxidoreductase, B subunit. T 98.96
PRK14817181 NADH dehydrogenase subunit B; Provisional 98.96
KOG3207|consensus505 98.93
PRK14820180 NADH dehydrogenase subunit B; Provisional 98.91
KOG3207|consensus505 98.89
KOG1259|consensus490 98.89
KOG4579|consensus177 98.83
PRK14819264 NADH dehydrogenase subunit B; Provisional 98.83
PRK14814186 NADH dehydrogenase subunit B; Provisional 98.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.66
KOG4658|consensus889 98.66
KOG0531|consensus414 98.61
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.59
KOG1859|consensus 1096 98.54
KOG4579|consensus177 98.53
PRK13292 788 trifunctional NADH dehydrogenase I subunit B/C/D; 98.5
KOG1859|consensus 1096 98.45
KOG1909|consensus382 98.44
KOG4658|consensus889 98.4
KOG2982|consensus418 98.25
PRK15386426 type III secretion protein GogB; Provisional 97.95
KOG1644|consensus233 97.92
KOG1644|consensus233 97.59
PRK15386426 type III secretion protein GogB; Provisional 97.58
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 97.44
PF01058131 Oxidored_q6: NADH ubiquinone oxidoreductase, 20 Kd 97.41
KOG3665|consensus 699 97.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.3
KOG2982|consensus418 97.29
KOG3665|consensus 699 97.26
KOG0473|consensus326 97.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.12
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma sub 97.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.06
KOG1909|consensus382 96.92
KOG2120|consensus419 96.84
KOG2739|consensus260 96.79
KOG2739|consensus260 96.49
KOG0473|consensus326 96.46
KOG2120|consensus419 96.43
KOG1201|consensus300 96.38
KOG2123|consensus388 96.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.27
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.26
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.0
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.11
smart0037026 LRR Leucine-rich repeats, outliers. 95.11
COG0300265 DltE Short-chain dehydrogenases of various substra 94.99
KOG2123|consensus388 94.79
PRK10468 371 hydrogenase 2 small subunit; Provisional 94.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.59
smart0037026 LRR Leucine-rich repeats, outliers. 94.59
TIGR00391 365 hydA hydrogenase (NiFe) small subunit (hydA). Call 93.99
KOG1205|consensus282 93.59
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 92.88
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 90.9
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.34
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.3
KOG1014|consensus312 86.94
PRK08339263 short chain dehydrogenase; Provisional 86.4
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.84
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 83.35
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 82.77
KOG4169|consensus261 82.32
KOG4308|consensus478 81.55
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 81.54
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 80.19
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 80.01
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.95  E-value=1.2e-28  Score=257.55  Aligned_cols=303  Identities=24%  Similarity=0.339  Sum_probs=179.6

Q ss_pred             CCCccEEEeeCCcCc-ccCccccCCCCCCEEEccCCcCc-ccccccCCCCCCcEEEccCCCCC-ccccccCCCCCCCEEE
Q psy5270           1 MLYITRITLSHNKLK-EIPPGLANLVNLEILTLFNNQIE-TLPTSLSSLPKLRILNLGMNRLS-SLPRGFGAFPVLEVLD   77 (352)
Q Consensus         1 l~~L~~L~Ls~N~l~-~ip~~l~~l~~L~~L~L~~N~l~-~ip~~l~~L~~L~~L~L~~N~l~-~ip~~~~~l~~L~~L~   77 (352)
                      +++|++|++++|.++ .+|.+++++++|++|++++|.++ .+|..+.++++|+.|++++|.++ .+|..++.+++|+.|+
T Consensus       259 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~  338 (968)
T PLN00113        259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQ  338 (968)
T ss_pred             CCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEE
Confidence            456777888888777 67777777778888888888777 66777777777777777777777 5677777777777777


Q ss_pred             ccCCCCCCCCCCCccccCccCcEEEccCCccc-cchhhccCcccHHHHHHhc------chhhHhhc-CceEeecc-----
Q psy5270          78 LTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKNLQIILETF------LPDMMEKN-RGHIVGIS-----  144 (352)
Q Consensus        78 Ls~N~l~g~~~p~~~~~l~~L~~L~l~~N~l~-~ip~~~~nl~~L~~L~l~~------~p~~~~~~-~g~i~~is-----  144 (352)
                      +++|++++ .+|..++.+++|+.|++++|+++ .+|.+++.+.+++.++++.      .|...... ......+.     
T Consensus       339 L~~n~l~~-~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~  417 (968)
T PLN00113        339 LWSNKFSG-EIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS  417 (968)
T ss_pred             CcCCCCcC-cCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEee
Confidence            77777776 67777777777777777777776 5666666655555554432      11111100 00111110     


Q ss_pred             --ccccccCCCCccccccchhhhhhhhHHhHHHH-------------------------HHHHhcCCceeecccCccc-c
Q psy5270         145 --SMAGIVGLPNLVPYCASKFAVRGLMEALAEEL-------------------------REDARNSKIKFTSIFPFMV-D  196 (352)
Q Consensus       145 --s~~~l~~lp~l~~~~~s~~~l~~~~~~l~~~l-------------------------~~~~~~~~n~~~g~~P~~~-~  196 (352)
                        ....+..++.+.....+.+.+.+........+                         ...+++++|++++..|..+ .
T Consensus       418 ~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        418 GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             eECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhh
Confidence              01122333444334444443333221111100                         0123344444444444322 2


Q ss_pred             cCCccCcccccccCC-CcccCCCCCcccchhhhhhhhhhccccccccCCCchhhhhHHhHhhhCCCCcce-ecchhhhcc
Q psy5270         197 TGLCKNPKIKMNRLS-SLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNL  274 (352)
Q Consensus       197 ~~~l~~l~l~~n~l~-~ip~~~~~l~~L~~~~~L~~L~ls~N~l~g~~iP~~~~~l~~L~~L~Ls~N~l~-~iP~~l~~l  274 (352)
                      ...+..++++.|+++ .+|..++.+++|      +.|++++|.++| .+|..+..+++|++|||++|+++ .+|..++++
T Consensus       498 l~~L~~L~Ls~N~l~~~~p~~~~~l~~L------~~L~Ls~N~l~~-~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l  570 (968)
T PLN00113        498 LSELMQLKLSENKLSGEIPDELSSCKKL------VSLDLSHNQLSG-QIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNV  570 (968)
T ss_pred             hhccCEEECcCCcceeeCChHHcCccCC------CEEECCCCcccc-cCChhHhCcccCCEEECCCCcccccCChhHhcC
Confidence            334455555556555 555555555555      678888888887 78888888888888888888888 788888888


Q ss_pred             cccccccCCceeeeccccccCCcccccccccccCCCcc
Q psy5270         275 KNLQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRI  312 (352)
Q Consensus       275 ~~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  312 (352)
                      ++|+.+....+.. .+.++..+.+..+....+.|.+.+
T Consensus       571 ~~L~~l~ls~N~l-~~~~p~~~~~~~~~~~~~~~n~~l  607 (968)
T PLN00113        571 ESLVQVNISHNHL-HGSLPSTGAFLAINASAVAGNIDL  607 (968)
T ss_pred             cccCEEeccCCcc-eeeCCCcchhcccChhhhcCCccc
Confidence            8888775555443 233333333333334444444433



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG1687|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG0377 NuoB NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK14818 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK14813 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>COG3260 Ni,Fe-hydrogenase III small subunit [Energy production and conversion] Back     alignment and domain information
>PRK06411 NADH dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK14816 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>PRK14815 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>CHL00023 ndhK NADH dehydrogenase subunit K Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>TIGR01957 nuoB_fam NADH-quinone oxidoreductase, B subunit Back     alignment and domain information
>PRK14817 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PRK14820 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK14819 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>PRK14814 NADH dehydrogenase subunit B; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK13292 trifunctional NADH dehydrogenase I subunit B/C/D; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PF01058 Oxidored_q6: NADH ubiquinone oxidoreductase, 20 Kd subunit; InterPro: IPR006137 NADH:ubiquinone oxidoreductase (complex I) (1 Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PRK10468 hydrogenase 2 small subunit; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00391 hydA hydrogenase (NiFe) small subunit (hydA) Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
2fug_6181 Crystal Structure Of The Hydrophilic Domain Of Resp 1e-12
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 2e-08
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 8e-07
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 7e-05
1a27_A289 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 2e-04
1fdw_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 2e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-04
1iol_A327 Estrogenic 17-beta Hydroxysteroid Dehydrogenase Com 2e-04
1fds_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C 2e-04
1fdu_A327 Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 M 2e-04
1equ_A327 Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin 2e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 5e-04
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 7e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 7e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 7e-04
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 8e-04
>pdb|2FUG|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 181 Back     alignment and structure

Iteration: 1

Score = 70.5 bits (171), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Query: 280 MLEPRWVISMGSCANXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPTAEALMYGILQLQKK 339 M +P+WVISMG+CA+ D ++PVD+YVPGCPP EAL+Y ++QLQKK Sbjct: 99 MPDPKWVISMGACASSGGMFNNYAIVQNV-DSVVPVDVYVPGCPPRPEALIYAVMQLQKK 157 Query: 340 VK 341 V+ Sbjct: 158 VR 159
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 Back     alignment and structure
>pdb|1FDW|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221q Complexed With Estradiol Length = 327 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1IOL|A Chain A, Estrogenic 17-beta Hydroxysteroid Dehydrogenase Complexed 17-beta- Estradiol Length = 327 Back     alignment and structure
>pdb|1FDS|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Complexed With 17- Beta-Estradiol Length = 327 Back     alignment and structure
>pdb|1FDU|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 Mutant H221l Complexed With Estradiol And Nadp+ Length = 327 Back     alignment and structure
>pdb|1EQU|A Chain A, Type 1 17-Beta Hydroxysteroid Dehydrogenase Equilin Complexed With Nadp+ Length = 327 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
3i9v_6181 NADH-quinone oxidoreductase subunit 6; electron tr 1e-43
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-37
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 1e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 6e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 1e-22
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-05
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3tjr_A301 Short chain dehydrogenase; structural genomics, se 3e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-20
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 8e-04
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 1e-20
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 2e-20
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 2e-20
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-20
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 3e-19
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 5e-19
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 1e-18
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 3e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 1e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-04
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 6e-17
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 9e-17
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 1e-16
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 1e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 3e-16
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-15
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 3e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 4e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
3tsc_A277 Putative oxidoreductase; structural genomics, seat 7e-15
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 1e-14
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-14
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 2e-14
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 2e-14
1nff_A260 Putative oxidoreductase RV2002; directed evolution 3e-14
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 3e-14
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 4e-14
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 4e-14
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 5e-14
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 8e-14
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 1e-13
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-13
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 2e-13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 3e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 4e-13
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 4e-13
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 4e-13
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 4e-13
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 5e-13
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 5e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 6e-13
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 6e-13
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 6e-13
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 7e-13
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 7e-13
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 8e-13
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 9e-13
4dqx_A277 Probable oxidoreductase protein; structural genomi 1e-12
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 1e-12
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 1e-12
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 1e-12
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 1e-12
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 2e-12
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 2e-12
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 2e-12
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 3e-12
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 3e-12
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 3e-12
4e4y_A244 Short chain dehydrogenase family protein; structur 3e-12
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 4e-12
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 5e-12
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 5e-12
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 6e-12
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 6e-12
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 7e-12
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 1e-11
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 1e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-11
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-11
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 1e-11
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 2e-11
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 3e-11
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 4e-11
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 4e-11
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-11
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 6e-11
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 7e-11
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 8e-11
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 1e-10
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 1e-10
1xq1_A266 Putative tropinone reducatse; structural genomics, 1e-10
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 1e-10
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 2e-10
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-10
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-10
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 2e-10
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 2e-10
3tox_A280 Short chain dehydrogenase; structural genomics, PS 3e-10
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 3e-10
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 3e-10
3cxt_A291 Dehydrogenase with different specificities; rossma 6e-10
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 6e-10
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 7e-10
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 8e-10
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 1e-09
3imf_A257 Short chain dehydrogenase; structural genomics, in 1e-09
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 1e-09
3e03_A274 Short chain dehydrogenase; structural genomics, PS 2e-09
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 2e-09
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 2e-09
1spx_A278 Short-chain reductase family member (5L265); paral 2e-09
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 2e-09
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 2e-09
4eso_A255 Putative oxidoreductase; NADP, structural genomics 2e-09
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 2e-09
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 2e-09
1cc1_S283 Hydrogenase (small subunit); NI-Fe-Se hydrogenase, 2e-09
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 3e-09
1xkq_A280 Short-chain reductase family member (5D234); parra 3e-09
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 3e-09
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 3e-09
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 5e-09
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 5e-09
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 8e-09
1xhl_A297 Short-chain dehydrogenase/reductase family member 9e-09
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 9e-09
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 1e-08
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 1e-08
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 2e-08
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 2e-08
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 2e-08
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 3e-08
2wpn_A317 Periplasmic [nifese] hydrogenase, small subunit; m 4e-08
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 5e-08
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 5e-08
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 5e-08
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 9e-08
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 1e-07
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-07
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 2e-07
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 2e-07
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-07
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-07
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 3e-07
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-07
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 4e-07
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 4e-07
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 4e-07
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-07
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 5e-07
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 5e-07
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 9e-07
1wui_S267 Periplasmic [NIFE] hydrogenase small subunit; high 1e-06
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-06
1yq9_A264 Periplasmic [NIFE] hydrogenase small subunit; oxid 1e-06
1h2a_S317 Hydrogenase; SO ligand, hydrogen metabolism, Mg ce 1e-06
3rih_A293 Short chain dehydrogenase or reductase; structural 2e-06
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 2e-06
3ayx_B283 Membrane-bound hydrogenase small subunit; oxidored 3e-06
3edm_A259 Short chain dehydrogenase; structural genomics, ox 4e-06
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 5e-06
1yqw_A264 Periplasmic [NIFE] hydrogenase small subunit; NI-F 6e-06
3uqy_S 335 Hydrogenase-1 small chain; membrane-bound hydrogen 6e-06
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 6e-06
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 7e-06
3rgw_S 339 Membrane-bound hydrogenase (NIFE) small subunit H; 8e-06
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 9e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 1e-05
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 2e-05
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 2e-05
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 2e-05
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 3e-05
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 3e-05
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 3e-05
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 3e-05
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 4e-05
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 4e-05
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 5e-05
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 5e-05
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 5e-05
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 7e-05
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 7e-05
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-05
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 9e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-04
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 1e-04
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 1e-04
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 1e-04
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 1e-04
3myr_A269 Hydrogenase (NIFE) small subunit HYDA; [NIFE] hydr 2e-04
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 2e-04
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 2e-04
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-04
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 2e-04
3qlj_A322 Short chain dehydrogenase; structural genomics, se 3e-04
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 3e-04
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 3e-04
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 4e-04
>3i9v_6 NADH-quinone oxidoreductase subunit 6; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_6* 2fug_6* 3iam_6* 3ias_6* 3m9s_6* Length = 181 Back     alignment and structure
 Score =  147 bits (374), Expect = 1e-43
 Identities = 36/72 (50%), Positives = 54/72 (75%), Gaps = 1/72 (1%)

Query: 280 MLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKK 339
           M +P+WVISMG+CA+ GG ++ +Y++V+  D ++PVD+YVPGCPP  EAL+Y ++QLQKK
Sbjct: 99  MPDPKWVISMGACASSGGMFN-NYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKK 157

Query: 340 VKRMKILQSWYR 351
           V+     +   R
Sbjct: 158 VRGQAYNERGER 169


>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1cc1_S Hydrogenase (small subunit); NI-Fe-Se hydrogenase, oxidoreductase; 2.15A {Desulfomicrobium baculatum} SCOP: e.19.1.1 Length = 283 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>2wpn_A Periplasmic [nifese] hydrogenase, small subunit; metal-binding, oxidoreductase, oxygen tolerance; HET: FSX SBY PSW; 2.04A {Desulfovibrio vulgaris} Length = 317 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1wui_S Periplasmic [NIFE] hydrogenase small subunit; high resolution [NIFE]hydrogenase, oxidoreductase, NI-A state, unready state; HET: NFC; 1.04A {Desulfovibrio vulgaris str} SCOP: e.19.1.1 PDB: 1h2r_S 1ubj_S 1ubh_S 1ubl_S 1ubm_S 1ubo_S 1ubr_S 1ubt_S 1ubu_S 1wuh_S* 1ubk_S* 1wuj_S 1wuk_S 1wul_S 1e3d_A* Length = 267 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>1yq9_A Periplasmic [NIFE] hydrogenase small subunit; oxidoreductase; 2.35A {Desulfovibrio gigas} SCOP: e.19.1.1 PDB: 2frv_S 1frv_A Length = 264 Back     alignment and structure
>1h2a_S Hydrogenase; SO ligand, hydrogen metabolism, Mg center, MIR, MAD, oxidoreductase; 1.80A {Desulfovibrio vulgaris str} SCOP: e.19.1.1 Length = 317 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3ayx_B Membrane-bound hydrogenase small subunit; oxidoreductase, membrane-bound NI-Fe hydrogenase; 1.18A {Hydrogenovibrio marinus} PDB: 3ayy_B 3ayz_B Length = 283 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1yqw_A Periplasmic [NIFE] hydrogenase small subunit; NI-Fe hydrogenase unready state, oxidoreductase; 1.83A {Desulfovibrio fructosovorans} PDB: 3cur_A 3cus_A 3h3x_A 1yrq_A 1frf_S Length = 264 Back     alignment and structure
>3uqy_S Hydrogenase-1 small chain; membrane-bound hydrogenase, oxidoreductase; HET: LMT; 1.47A {Escherichia coli} PDB: 3usc_S* 3use_S* Length = 335 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3rgw_S Membrane-bound hydrogenase (NIFE) small subunit H; [NIFE] hydrogenase, high-resolution knallgasbacteria, proteobacteria; 1.50A {Ralstonia eutropha} Length = 339 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3myr_A Hydrogenase (NIFE) small subunit HYDA; [NIFE] hydrogenase, photosynthetic P sulfur bacterium, iron-sulfur cluster, NI-A state; HET: SF4; 2.10A {Allochromatium vinosum} Length = 269 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.74
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.67
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.5
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.46
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.31
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
3i9v_6181 NADH-quinone oxidoreductase subunit 6; electron tr 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.0
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.89
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.32
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.16
1wui_S267 Periplasmic [NIFE] hydrogenase small subunit; high 97.93
1yq9_A264 Periplasmic [NIFE] hydrogenase small subunit; oxid 97.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.92
1h2a_S317 Hydrogenase; SO ligand, hydrogen metabolism, Mg ce 97.84
2wpn_A317 Periplasmic [nifese] hydrogenase, small subunit; m 97.82
3rgw_S 339 Membrane-bound hydrogenase (NIFE) small subunit H; 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.72
3ayx_B283 Membrane-bound hydrogenase small subunit; oxidored 97.66
3myr_A269 Hydrogenase (NIFE) small subunit HYDA; [NIFE] hydr 97.65
3uqy_S 335 Hydrogenase-1 small chain; membrane-bound hydrogen 97.62
1yqw_A264 Periplasmic [NIFE] hydrogenase small subunit; NI-F 97.61
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.5
1cc1_S283 Hydrogenase (small subunit); NI-Fe-Se hydrogenase, 97.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.47
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.33
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.2
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 95.82
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 95.11
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 94.07
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 93.83
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 93.45
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 93.09
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 92.09
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 89.55
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 86.38
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 85.03
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 83.94
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 83.69
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 83.54
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 83.52
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 83.19
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 82.77
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 82.66
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 82.35
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 82.2
3tsc_A277 Putative oxidoreductase; structural genomics, seat 81.44
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 81.37
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 81.17
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 80.94
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 80.91
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 80.55
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 80.48
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 80.31
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 80.22
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.98  E-value=1e-32  Score=280.18  Aligned_cols=313  Identities=24%  Similarity=0.316  Sum_probs=195.0

Q ss_pred             CCccEEEeeCCcCc-ccCccccCCCCCCEEEccCCcCc-ccccccCCCCCCcEEEccCCCCC-ccccccCCCCCCCEEEc
Q psy5270           2 LYITRITLSHNKLK-EIPPGLANLVNLEILTLFNNQIE-TLPTSLSSLPKLRILNLGMNRLS-SLPRGFGAFPVLEVLDL   78 (352)
Q Consensus         2 ~~L~~L~Ls~N~l~-~ip~~l~~l~~L~~L~L~~N~l~-~ip~~l~~L~~L~~L~L~~N~l~-~ip~~~~~l~~L~~L~L   78 (352)
                      ++|++|++++|+++ .+|..++++++|++|++++|+++ .+|..++++++|+.|++++|+++ .+|..++.+++|+.|++
T Consensus       394 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  473 (768)
T 3rgz_A          394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLIL  473 (768)
T ss_dssp             CCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             CCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEe
Confidence            34666666666666 56666666666666666666666 55666666666666666666666 55666666666666666


Q ss_pred             cCCCCCCCCCCCccccCccCcEEEccCCccc-cchhhccCcccHHHHHHhcc------hhhHhh-cCceEeecccccccc
Q psy5270          79 TYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKNLQIILETFL------PDMMEK-NRGHIVGISSMAGIV  150 (352)
Q Consensus        79 s~N~l~g~~~p~~~~~l~~L~~L~l~~N~l~-~ip~~~~nl~~L~~L~l~~~------p~~~~~-~~g~i~~iss~~~l~  150 (352)
                      ++|+++| .+|..++++++|++|++++|+++ .+|.+++++++|++++++..      |..+.. ......+++.+...+
T Consensus       474 ~~N~l~~-~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g  552 (768)
T 3rgz_A          474 DFNDLTG-EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG  552 (768)
T ss_dssp             CSSCCCS-CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEES
T ss_pred             cCCcccC-cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCC
Confidence            6666665 56666666666666666666666 56666666666666655431      111111 111122222211111


Q ss_pred             CCCCcccccc-------ch--------h--------------hhhhhhHHhHHHHH--HHHhcCCceeecccCccc-ccC
Q psy5270         151 GLPNLVPYCA-------SK--------F--------------AVRGLMEALAEELR--EDARNSKIKFTSIFPFMV-DTG  198 (352)
Q Consensus       151 ~lp~l~~~~~-------s~--------~--------------~l~~~~~~l~~~l~--~~~~~~~n~~~g~~P~~~-~~~  198 (352)
                      .+|.......       ..        +              .+.+........+.  ....+..+.+.|.+|..+ ...
T Consensus       553 ~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~  632 (768)
T 3rgz_A          553 TIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNG  632 (768)
T ss_dssp             BCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSB
T ss_pred             cCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccc
Confidence            2221110000       00        0              00000000000000  011234467777776544 456


Q ss_pred             CccCcccccccCC-CcccCCCCCcccchhhhhhhhhhccccccccCCCchhhhhHHhHhhhCCCCcce-ecchhhhcccc
Q psy5270         199 LCKNPKIKMNRLS-SLPRGFGAFPVLEAFSFTTILDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKN  276 (352)
Q Consensus       199 ~l~~l~l~~n~l~-~ip~~~~~l~~L~~~~~L~~L~ls~N~l~g~~iP~~~~~l~~L~~L~Ls~N~l~-~iP~~l~~l~~  276 (352)
                      .++.+++++|+++ .+|.+++.++.|      +.|||++|+++| .||..|+++++|++|||++|+++ .||.+++++++
T Consensus       633 ~L~~LdLs~N~l~g~ip~~l~~l~~L------~~L~Ls~N~l~g-~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~  705 (768)
T 3rgz_A          633 SMMFLDMSYNMLSGYIPKEIGSMPYL------FILNLGHNDISG-SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTM  705 (768)
T ss_dssp             CCCEEECCSSCCBSCCCGGGGGCTTC------CEEECCSSCCCS-CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCC
T ss_pred             cccEEECcCCcccccCCHHHhccccC------CEEeCcCCccCC-CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCC
Confidence            7788999999999 999999999888      699999999999 89999999999999999999999 99999999999


Q ss_pred             cccccCCceeeeccccccCCcccccccccccCCCcccccceecCCCCCC
Q psy5270         277 LQIMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT  325 (352)
Q Consensus       277 L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gcpp~  325 (352)
                      |++++..++... |..+..+.+-.+....+.|++.++...  ++.|++.
T Consensus       706 L~~L~ls~N~l~-g~iP~~~~~~~~~~~~~~gN~~Lcg~~--l~~C~~~  751 (768)
T 3rgz_A          706 LTEIDLSNNNLS-GPIPEMGQFETFPPAKFLNNPGLCGYP--LPRCDPS  751 (768)
T ss_dssp             CSEEECCSSEEE-EECCSSSSGGGSCGGGGCSCTEEESTT--SCCCCSC
T ss_pred             CCEEECcCCccc-ccCCCchhhccCCHHHhcCCchhcCCC--CcCCCCC
Confidence            999977766553 445555555556666788888777322  3357643



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3i9v_6 NADH-quinone oxidoreductase subunit 6; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_6* 2fug_6* 3iam_6* 3ias_6* 3m9s_6* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1wui_S Periplasmic [NIFE] hydrogenase small subunit; high resolution [NIFE]hydrogenase, oxidoreductase, NI-A state, unready state; HET: NFC; 1.04A {Desulfovibrio vulgaris str} SCOP: e.19.1.1 PDB: 1h2r_S 1ubj_S 1ubh_S 1ubl_S 1ubm_S 1ubo_S 1ubr_S 1ubt_S 1ubu_S 1wuh_S* 1ubk_S* 1wuj_S 1wuk_S 1wul_S 1e3d_A* Back     alignment and structure
>1yq9_A Periplasmic [NIFE] hydrogenase small subunit; oxidoreductase; 2.35A {Desulfovibrio gigas} SCOP: e.19.1.1 PDB: 2frv_S 1frv_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1h2a_S Hydrogenase; SO ligand, hydrogen metabolism, Mg center, MIR, MAD, oxidoreductase; 1.80A {Desulfovibrio vulgaris str} SCOP: e.19.1.1 Back     alignment and structure
>2wpn_A Periplasmic [nifese] hydrogenase, small subunit; metal-binding, oxidoreductase, oxygen tolerance; HET: FSX SBY PSW; 2.04A {Desulfovibrio vulgaris} Back     alignment and structure
>3rgw_S Membrane-bound hydrogenase (NIFE) small subunit H; [NIFE] hydrogenase, high-resolution knallgasbacteria, proteobacteria; 1.50A {Ralstonia eutropha} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ayx_B Membrane-bound hydrogenase small subunit; oxidoreductase, membrane-bound NI-Fe hydrogenase; 1.18A {Hydrogenovibrio marinus} PDB: 3ayy_B 3ayz_B Back     alignment and structure
>3myr_A Hydrogenase (NIFE) small subunit HYDA; [NIFE] hydrogenase, photosynthetic P sulfur bacterium, iron-sulfur cluster, NI-A state; HET: SF4; 2.10A {Allochromatium vinosum} SCOP: e.19.1.0 Back     alignment and structure
>3uqy_S Hydrogenase-1 small chain; membrane-bound hydrogenase, oxidoreductase; HET: LMT; 1.47A {Escherichia coli} PDB: 3usc_S* 3use_S* Back     alignment and structure
>1yqw_A Periplasmic [NIFE] hydrogenase small subunit; NI-Fe hydrogenase unready state, oxidoreductase; 1.83A {Desulfovibrio fructosovorans} PDB: 3cur_A 3cus_A 3h3x_A 1yrq_A 1frf_S Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1cc1_S Hydrogenase (small subunit); NI-Fe-Se hydrogenase, oxidoreductase; 2.15A {Desulfomicrobium baculatum} SCOP: e.19.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d2fug61161 e.19.1.2 (6:15-175) NAD-quinone oxidoreductase cha 1e-27
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 1e-21
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 9e-17
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 8e-16
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 1e-15
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1e-15
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 5e-15
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 9e-15
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-14
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 1e-13
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-12
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-04
d1wuis1267 e.19.1.1 (S:1-267) Nickel-iron hydrogenase, small 7e-12
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 8e-12
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 2e-11
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-11
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 2e-11
d1cc1s_278 e.19.1.1 (S:) Nickel-iron hydrogenase, small subun 3e-11
d1yq9a1261 e.19.1.1 (A:4-264) Nickel-iron hydrogenase, small 3e-11
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 5e-11
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-10
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 2e-10
d1frfs_261 e.19.1.1 (S:) Nickel-iron hydrogenase, small subun 2e-10
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 2e-10
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 3e-10
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 7e-10
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 8e-10
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-09
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 5e-09
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 5e-09
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 6e-09
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-08
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-08
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 5e-08
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 6e-08
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 1e-07
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 1e-07
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 4e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-07
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 9e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-04
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-06
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 1e-06
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-06
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 2e-06
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 7e-06
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 8e-05
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 8e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 2e-04
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 3e-04
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-04
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 0.002
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 0.003
>d2fug61 e.19.1.2 (6:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]} Length = 161 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: HydA/Nqo6-like
superfamily: HydA/Nqo6-like
family: Nq06-like
domain: NAD-quinone oxidoreductase chain 6, Nqo6
species: Thermus thermophilus [TaxId: 274]
 Score =  104 bits (260), Expect = 1e-27
 Identities = 36/72 (50%), Positives = 54/72 (75%), Gaps = 1/72 (1%)

Query: 280 MLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKK 339
           M +P+WVISMG+CA+ GG ++ +Y++V+  D ++PVD+YVPGCPP  EAL+Y ++QLQKK
Sbjct: 85  MPDPKWVISMGACASSGGMFN-NYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKK 143

Query: 340 VKRMKILQSWYR 351
           V+     +   R
Sbjct: 144 VRGQAYNERGER 155


>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1wuis1 e.19.1.1 (S:1-267) Nickel-iron hydrogenase, small subunit {Desulfovibrio vulgaris [TaxId: 881]} Length = 267 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1cc1s_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfomicrobium baculatum [TaxId: 899]} Length = 278 Back     information, alignment and structure
>d1yq9a1 e.19.1.1 (A:4-264) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Length = 261 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1frfs_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio fructosovorans [TaxId: 878]} Length = 261 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d2fug61161 NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus 99.26
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.23
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.52
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.36
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.93
d1frfs_261 Nickel-iron hydrogenase, small subunit {Desulfovib 95.74
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.49
d1wuis1267 Nickel-iron hydrogenase, small subunit {Desulfovib 95.27
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 94.88
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.81
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 94.74
d1yq9a1261 Nickel-iron hydrogenase, small subunit {Desulfovib 94.65
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 94.64
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.6
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 94.55
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 94.47
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 94.28
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.25
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.23
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 94.17
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.07
d1cc1s_278 Nickel-iron hydrogenase, small subunit {Desulfomic 93.88
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.6
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 93.49
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.47
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.4
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.99
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.57
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 92.31
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.26
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 91.93
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.92
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 91.72
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 91.11
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 91.1
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 91.07
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.16
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.15
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.84
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 89.83
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.83
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 89.79
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 89.1
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 89.05
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 88.75
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 88.12
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.81
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 87.27
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 86.93
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 86.79
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 86.42
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 86.23
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 84.91
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=1.1e-29  Score=229.11  Aligned_cols=237  Identities=22%  Similarity=0.300  Sum_probs=187.6

Q ss_pred             CccEEEeeCCcCc---ccCccccCCCCCCEEEccC-CcCc-ccccccCCCCCCcEEEccCCCCCcc-ccccCCCCCCCEE
Q psy5270           3 YITRITLSHNKLK---EIPPGLANLVNLEILTLFN-NQIE-TLPTSLSSLPKLRILNLGMNRLSSL-PRGFGAFPVLEVL   76 (352)
Q Consensus         3 ~L~~L~Ls~N~l~---~ip~~l~~l~~L~~L~L~~-N~l~-~ip~~l~~L~~L~~L~L~~N~l~~i-p~~~~~l~~L~~L   76 (352)
                      +++.|||++|.++   +||++++++++|++|+|++ |+++ .+|+++++|++|++|+|++|+++.+ |..+..+.+|+.+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            6899999999997   5899999999999999996 8898 8999999999999999999999954 5668999999999


Q ss_pred             EccCCCCCCCCCCCccccCccCcEEEccCCccc-cchhhccCcccH-HHHHHhcchhhHhhcCceEeeccccccccCCCC
Q psy5270          77 DLTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKNL-QIILETFLPDMMEKNRGHIVGISSMAGIVGLPN  154 (352)
Q Consensus        77 ~Ls~N~l~g~~~p~~~~~l~~L~~L~l~~N~l~-~ip~~~~nl~~L-~~L~l~~~p~~~~~~~g~i~~iss~~~l~~lp~  154 (352)
                      ++++|.+.+ .+|.+++++++|+++++++|+++ .+|..++++.++ +.++.+.         ..+.+... ..+..+..
T Consensus       131 ~l~~N~~~~-~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~---------n~l~~~~~-~~~~~l~~  199 (313)
T d1ogqa_         131 DFSYNALSG-TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISR---------NRLTGKIP-PTFANLNL  199 (313)
T ss_dssp             ECCSSEEES-CCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCS---------SEEEEECC-GGGGGCCC
T ss_pred             ccccccccc-cCchhhccCcccceeecccccccccccccccccccccccccccc---------cccccccc-cccccccc
Confidence            999999998 89999999999999999999999 799998887765 2222111         11111100 00111110


Q ss_pred             ccccccchhhhhhhhHHhHHHHHHHHhcCCceeecccCccc-ccCCccCcccccccCCCcccCCCCCcccchhhhhhhhh
Q psy5270         155 LVPYCASKFAVRGLMEALAEELREDARNSKIKFTSIFPFMV-DTGLCKNPKIKMNRLSSLPRGFGAFPVLEAFSFTTILD  233 (352)
Q Consensus       155 l~~~~~s~~~l~~~~~~l~~~l~~~~~~~~n~~~g~~P~~~-~~~~l~~l~l~~n~l~~ip~~~~~l~~L~~~~~L~~L~  233 (352)
                      .                       .+..+.+.+.+.+|... ....++.+++++|.++..+..++.++.+      +.||
T Consensus       200 ~-----------------------~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L------~~L~  250 (313)
T d1ogqa_         200 A-----------------------FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNL------NGLD  250 (313)
T ss_dssp             S-----------------------EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTC------CEEE
T ss_pred             c-----------------------cccccccccccccccccccccccccccccccccccccccccccccc------cccc
Confidence            0                       12344566777776554 4456777888899888555567777777      7999


Q ss_pred             hccccccccCCCchhhhhHHhHhhhCCCCcce-ecchhhhccccccccc
Q psy5270         234 LTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKNLQIML  281 (352)
Q Consensus       234 ls~N~l~g~~iP~~~~~l~~L~~L~Ls~N~l~-~iP~~l~~l~~L~~l~  281 (352)
                      |++|+++| .+|++|+++++|++|||++|+|+ .||+ ++++++|+.+.
T Consensus       251 Ls~N~l~g-~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~  297 (313)
T d1ogqa_         251 LRNNRIYG-TLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSA  297 (313)
T ss_dssp             CCSSCCEE-CCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGG
T ss_pred             CccCeecc-cCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHH
Confidence            99999999 89999999999999999999999 8984 68888888764



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fug61 e.19.1.2 (6:15-175) NAD-quinone oxidoreductase chain 6, Nqo6 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1frfs_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio fructosovorans [TaxId: 878]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1wuis1 e.19.1.1 (S:1-267) Nickel-iron hydrogenase, small subunit {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yq9a1 e.19.1.1 (A:4-264) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1cc1s_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfomicrobium baculatum [TaxId: 899]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure