Psyllid ID: psy531


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNNK
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEccEEEEEEEccccccccccEEEEEEHHHHHccc
ccccccccccccccEEEEEEEEEEEEEEEEEcccccccccEEEEEEEccEEEEEccccccccccccEEEEEEcEEEEccc
MGMWLNLAFLETNLHHISLQVLLIITLVHfkgvspdisnAVHITALLGESvvfncgvdfpgdtpvpyVLQWEKKIVKNNK
MGMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNNK
MGMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNNK
**MWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV****
**MW*NLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK******
MGMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNNK
***WLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q967D7 1531 Protein turtle OS=Drosoph no N/A 0.462 0.024 0.729 9e-12
>sp|Q967D7|TUTL_DROME Protein turtle OS=Drosophila melanogaster GN=tutl PE=2 SV=2 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 27/37 (72%), Positives = 33/37 (89%)

Query: 39  NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI 75
           +AVHITA+LGE V+FNC V+FP D PVPYVLQW+KK+
Sbjct: 134 DAVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKV 170




Essential protein that plays a role in the establishment of coordinated motor control.
Drosophila melanogaster (taxid: 7227)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
170032303 1482 turtle protein_ [Culex quinquefasciatus] 0.712 0.038 0.666 2e-13
312374066 323 hypothetical protein AND_16509 [Anophele 0.5 0.123 0.825 1e-12
357618966 1094 hypothetical protein KGM_15726 [Danaus p 0.5 0.036 0.8 4e-12
158297293 1478 AGAP007928-PA [Anopheles gambiae str. PE 0.462 0.025 0.837 5e-12
157113626 1300 turtle protein, isoform [Aedes aegypti] 0.462 0.028 0.810 8e-12
340728223 1027 PREDICTED: protein turtle-like [Bombus t 0.625 0.048 0.648 2e-11
383861456 1386 PREDICTED: LOW QUALITY PROTEIN: protein 0.462 0.026 0.810 2e-11
194758581 1534 GF15018 [Drosophila ananassae] gi|190615 0.725 0.037 0.5 4e-11
32280056366 hypothetical protein SINV_00466 [Solenop 0.512 0.621 0.756 9e-11
195401062 1552 GJ16222 [Drosophila virilis] gi|19415600 0.462 0.023 0.756 3e-10
>gi|170032303|ref|XP_001844021.1| turtle protein_ [Culex quinquefasciatus] gi|167872307|gb|EDS35690.1| turtle protein [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/57 (66%), Positives = 42/57 (73%)

Query: 18  SLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK 74
           S  +LL ITL       P   +AVHITA+LGESVVFNC V+FPGD PVPYVLQWEKK
Sbjct: 230 SFVLLLCITLCTSSISPPAPQDAVHITAILGESVVFNCHVEFPGDHPVPYVLQWEKK 286




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312374066|gb|EFR21713.1| hypothetical protein AND_16509 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|357618966|gb|EHJ71750.1| hypothetical protein KGM_15726 [Danaus plexippus] Back     alignment and taxonomy information
>gi|158297293|ref|XP_317553.4| AGAP007928-PA [Anopheles gambiae str. PEST] gi|157015125|gb|EAA12846.4| AGAP007928-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157113626|ref|XP_001652029.1| turtle protein, isoform [Aedes aegypti] gi|108877675|gb|EAT41900.1| AAEL006522-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|340728223|ref|XP_003402427.1| PREDICTED: protein turtle-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383861456|ref|XP_003706202.1| PREDICTED: LOW QUALITY PROTEIN: protein turtle-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|194758581|ref|XP_001961540.1| GF15018 [Drosophila ananassae] gi|190615237|gb|EDV30761.1| GF15018 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|322800563|gb|EFZ21549.1| hypothetical protein SINV_00466 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195401062|ref|XP_002059133.1| GJ16222 [Drosophila virilis] gi|194156007|gb|EDW71191.1| GJ16222 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
FB|FBgn0010473 1531 tutl "turtle" [Drosophila mela 0.462 0.024 0.729 3.2e-10
FB|FBgn0028482 719 CG16857 [Drosophila melanogast 0.687 0.076 0.403 1.7e-05
FB|FBgn0010473 tutl "turtle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 160 (61.4 bits), Expect = 3.2e-10, P = 3.2e-10
 Identities = 27/37 (72%), Positives = 33/37 (89%)

Query:    39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI 75
             +AVHITA+LGE V+FNC V+FP D PVPYVLQW+KK+
Sbjct:   134 DAVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKV 170




GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0007629 "flight behavior" evidence=IMP
GO:0030537 "larval behavior" evidence=IMP
GO:0007422 "peripheral nervous system development" evidence=NAS
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0008039 "synaptic target recognition" evidence=IMP
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
GO:0070593 "dendrite self-avoidance" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0007414 "axonal defasciculation" evidence=IMP
GO:0016199 "axon midline choice point recognition" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
FB|FBgn0028482 CG16857 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 97.71
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 97.69
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 97.59
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 97.49
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.44
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 97.4
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.35
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 97.31
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 97.27
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.23
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 97.23
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 97.19
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 97.14
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 97.08
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 97.05
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 97.02
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 96.97
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 96.95
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 96.93
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 96.92
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 96.88
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 96.88
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 96.88
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 96.88
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 96.85
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 96.76
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 96.71
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 96.65
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 96.62
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 96.57
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 96.54
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 96.52
smart0041086 IG_like Immunoglobulin like. IG domains that canno 96.48
smart0040986 IG Immunoglobulin. 96.48
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 96.42
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 96.41
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 96.4
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 96.37
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 96.27
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 96.25
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 96.19
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 96.18
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 96.15
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 96.12
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 96.05
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 96.03
PF0004764 ig: Immunoglobulin domain The Prosite family only 96.01
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 95.98
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 95.97
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 95.97
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 95.88
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 95.87
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 95.87
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 95.83
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 95.8
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 95.77
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 95.74
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 95.52
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 95.47
PHA02826 227 IL-1 receptor-like protein; Provisional 95.45
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 95.44
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 95.36
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 95.12
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 94.99
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 94.95
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 94.93
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 94.85
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 94.75
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 94.74
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 94.62
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 94.59
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 94.55
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 94.42
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 94.36
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 94.35
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 94.29
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 94.19
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 94.18
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 94.16
PHA02785326 IL-beta-binding protein; Provisional 94.1
PHA03376 221 BARF1; Provisional 94.08
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 94.05
smart0040863 IGc2 Immunoglobulin C-2 Type. 94.02
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 93.86
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 93.86
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 93.65
PHA02982 251 hypothetical protein; Provisional 93.55
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 93.5
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 93.5
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 93.39
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 93.27
PHA02826227 IL-1 receptor-like protein; Provisional 93.23
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 93.18
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 93.12
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 92.68
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 92.47
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 92.39
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 92.38
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 92.17
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 92.12
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 92.05
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 91.42
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 91.41
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 91.16
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 91.1
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 90.95
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 90.95
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 90.93
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 90.84
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 90.65
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 90.65
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 90.63
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 90.59
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 90.46
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 90.35
PHA02785 326 IL-beta-binding protein; Provisional 90.31
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 90.09
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 90.08
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 89.89
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 89.88
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 89.85
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 89.84
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 89.42
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 89.39
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 89.06
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 88.82
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 88.78
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 88.42
smart0040681 IGv Immunoglobulin V-Type. 88.38
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 88.36
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 88.15
PHA02987 189 Ig domain OX-2-like protein; Provisional 87.81
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 87.42
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 87.07
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 86.96
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 85.23
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 83.86
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 83.07
PRK00059 336 prsA peptidylprolyl isomerase; Provisional 82.54
PF0568847 DUF824: Salmonella repeat of unknown function (DUF 82.19
KOG4221|consensus 1381 82.12
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 81.97
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 81.59
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 80.36
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
Probab=97.71  E-value=7.5e-05  Score=44.32  Aligned_cols=36  Identities=22%  Similarity=0.532  Sum_probs=30.5

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|..++...|+.|.|.|.+.   |.|.| .++|.|+|..
T Consensus         6 ~~p~~~~v~~G~~~~l~C~~~---g~P~p-~i~W~k~g~~   41 (100)
T cd07693           6 EHPSDLIVSKGDPATLNCKAE---GRPTP-TIQWLKNGQP   41 (100)
T ss_pred             ecCceeEEcCCCeEEEEeeCC---cCCCC-EEEEEECCEE
Confidence            567889999999999999886   56777 5899999865



Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res

>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PF05688 DUF824: Salmonella repeat of unknown function (DUF824); InterPro: IPR008542 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1dr9_A 201 B7-1 (CD80), T lymphocyte activation antigen; IG s 3e-04
3u83_A 331 Poliovirus receptor-related protein 1; nectin-1, h 3e-04
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
 Score = 36.1 bits (83), Expect = 3e-04
 Identities = 7/33 (21%), Positives = 15/33 (45%)

Query: 41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEK 73
          +H+T  + E    +CG +   +      + W+K
Sbjct: 2  IHVTKEVKEVATLSCGHNVSVEELAQTRIYWQK 34


>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
4frw_A 218 Poliovirus receptor-related protein 4; immunoglobu 97.94
4gos_A125 V-SET domain-containing T-cell activation inhibit; 97.93
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 97.86
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 97.86
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 97.79
4fmk_A 225 Poliovirus receptor-related protein 2; immunoglobu 97.79
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 97.69
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 97.67
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 97.67
3sob_L 237 Antibody light chain; beta propeller, protein bind 97.67
1xt5_A135 Variable region-containing chitin-binding protein 97.66
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 97.64
4fa8_A 203 Secreted protein BARF1; immunoglobulin-like domain 97.61
4f80_A 226 Butyrophilin subfamily 3 member A1; B7 superfamily 97.61
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 97.61
2j6e_L 234 IGM, FAB light chain; autoimmune complex human IGM 97.59
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 97.58
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 97.57
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 97.57
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 97.56
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 97.54
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 97.54
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 97.52
2zg1_A 214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 97.52
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 97.51
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 97.51
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 97.5
1waa_A93 Titin; metal binding protein, calmodulin-binding, 97.5
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 97.49
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 97.48
3noi_A120 Natural cytotoxicity triggering receptor 3; immune 97.46
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 97.45
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 97.43
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 97.42
2v9t_A117 Roundabout homolog 1; structural protein-receptor 97.42
3bkj_L 252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 97.4
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 97.39
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 97.39
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 97.38
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 97.38
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 97.37
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 97.37
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 97.36
1jbj_A 186 CD3 epsilon and gamma ectodomain fragment complex; 97.35
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 97.35
4fqp_A 313 Poliovirus receptor; immunoglobulin-like domain, I 97.35
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 97.33
1nko_A132 Sialic acid binding IG-like lectin 7; immunoglobul 97.33
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 97.32
3bqu_C 233 3H6 FAB light chain; beta sheet, immune system; 3. 97.32
1qfo_A119 Protein (sialoadhesin); immunoglobulin superfamily 97.31
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 97.3
3eow_R 221 Poliovirus receptor; immunoglobulin super family, 97.3
2yz1_A120 Tyrosine-protein phosphatase non-receptor type sub 97.29
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 97.27
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 97.27
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 97.27
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 97.26
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 97.23
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 97.22
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 97.22
3sbw_C 222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 97.21
2gki_A 291 Nuclease; anti-DNA antibody, catalytic antibody, i 97.2
1qok_A 282 MFE-23 recombinant antibody fragment; immunoglobul 97.19
3mj6_A 268 Junctional adhesion molecule-like; immunoglobulin 97.18
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 97.17
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 97.16
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 97.16
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 97.16
2pnd_A119 V-SET and immunoglobulin domain containing 4; comp 97.14
3jz7_A 214 MCAR, CAR, coxsackievirus and adenovirus receptor 97.13
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 97.13
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 97.12
1gl4_B98 Basement membrane-specific heparan sulfate proteog 97.1
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 97.1
4fom_A 308 Poliovirus receptor-related protein 3; immunoglobu 97.1
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 97.1
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 97.09
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 97.08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 97.08
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 97.08
2fbo_J 250 V1V2;, variable region-containing chitin-binding p 97.07
2ens_A96 Advanced glycosylation END product-specific recept 97.07
1rhf_A 182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 97.07
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 97.06
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 97.05
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 97.03
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 97.03
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 97.02
2va4_A 192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 97.01
2q87_A110 CMRF35-H antigen; all-beta, immunoglobulin, IG-sup 97.01
2z35_A112 T-cell receptor alpha-chain; immune receptor, immu 96.99
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 96.99
3bia_X116 T-cell immunoglobulin and mucin domain- containing 96.98
1fo0_A116 Protein (BM3.3 T cell receptor alpha-chain); class 96.97
2yd1_A 212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 96.95
1hng_A 176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 96.95
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 96.95
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 96.95
1bec_A 238 14.3.D T cell antigen receptor; T cell receptor; 1 96.95
1tvd_A116 T cell receptor, ES204 V delta; immunoreceptor, TC 96.93
1zox_A113 CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I 96.92
3d9a_L 213 Light chain of hyhel10 antibody fragment (FAB); ly 96.91
1lk3_L 210 9D7 light chain; antigen-antibody complex, immune 96.91
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 96.89
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 96.87
2pet_A 231 Lutheran blood group glycoprotein; immunoglobulin 96.85
2if7_A 193 SLAM family member 6; NTB-A, homophilic receptor, 96.85
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 96.84
2c5d_C 195 AXL oncogene, tyrosine-protein kinase receptor UFO 96.84
2qhl_A111 Novel immune-type receptor 10; immunoglobulin vari 96.83
2atp_B115 T-cell surface glycoprotein CD8 beta chain; CD8AB, 96.82
2rik_A 284 Titin; I-SET IG fold, poly-IG linear array, struct 96.82
2j8h_A 197 Titin, connectin; cardiomyopathy, nuclear protein, 96.81
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 96.8
1i3g_L111 Antibody FV fragment; antibiotic; 2.44A {Mus muscu 96.79
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 96.79
3q5y_A 240 TCR N15 beta; IG, T cell receptor, antigen peptide 96.78
2iep_A 192 Muscle-specific kinase receptor; beta-sandwich, si 96.77
2yd6_A 212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 96.76
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 96.76
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 96.75
1sq2_N113 Novel antigen receptor; immunoglobulin fold, prote 96.74
1dr9_A 201 B7-1 (CD80), T lymphocyte activation antigen; IG s 96.73
3mtr_A 215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 96.73
2vr9_A 217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 96.73
2coq_A108 NEW antigen receptor variable domain; IG VNAR, nat 96.72
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 96.71
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 96.71
3rjd_A 262 High affinity immunoglobulin gamma FC receptor I; 96.7
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 96.7
3pl6_D 268 MBP peptide / T-cell receptor beta chain chimera; 96.7
1ypz_E 207 T cell receptor delta, beta-2-microglobulin; H2-T2 96.7
3lcy_A 197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 96.69
2a38_A 194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 96.69
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 96.67
3bj9_1116 Immunoglobulin IOTA chain, immunoglobulin lambda- 96.67
1fo0_B112 Protein (BM3.3 T cell receptor beta-chain); class 96.67
3qib_D 270 2B4 beta chain; IG domain, immune system; HET: NAG 96.67
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 96.65
3nfj_J 245 T cell receptor beta chain; immunoglobulin family, 96.65
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 96.65
1j05_L111 T84.66 antibody, anti-CEA MAB T84.66, light chain; 96.65
3mj8_L 213 Stimulatory hamster antibody HL4E10 FAB light CHA; 96.64
4ffy_L126 DENV1-E111 single chain variable fragment (light; 96.64
2wbj_D 279 OB TCR; transmembrane, immune response, T cell rec 96.63
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 96.63
3bp6_A117 Programmed cell death protein 1; PD-1, PD-L2, comp 96.63
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 96.61
3u1s_H 267 FAB PGT145 heavy chain; IGG, broadly neutralizing 96.61
3sob_H 256 Antibody heavy chain, low-density lipoprotein rece 96.61
3tv3_L 211 PGT128 light chain, IG lambda-2 chain C regions; F 96.6
1fnl_A 175 Low affinity immunoglobulin gamma FC region recept 96.6
1eeq_A114 Kappa-4 immunoglobulin (light chain); protein stab 96.58
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 96.57
3u83_A 331 Poliovirus receptor-related protein 1; nectin-1, h 96.56
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 96.55
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 96.55
2or7_A115 T-cell immunoglobulin and mucin domain- containing 96.55
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 96.55
1oga_E 252 TRBC1, T-cell receptor beta chain C region; immune 96.54
1nfd_E 212 H57 FAB; complex (immunoreceptor-immunoglobulin), 96.54
1dqt_A117 CTLA4, cytotoxic T lymphocyte associated antigen 4 96.52
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 96.52
1ccz_A 171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 96.52
1u9k_A114 Triggering receptor expressed on myeloid cells 1; 96.5
1f97_A 212 Junction adhesion molecule; immunoglobulin superfa 96.5
3auv_A 276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 96.48
1svz_A 247 Immunoglobulin;, single-chain FV fragment 1696; an 96.48
3grw_A 241 Fibroblast growth factor receptor 3; FGFR3, protei 96.48
2ny1_B 184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 96.47
2v9r_A 212 Roundabout homolog 1; proto-oncogene, differentiat 96.47
3s97_C 201 Contactin-1; carbonic anhdyrase like immunoglobuli 96.45
3s35_X122 Vascular endothelial growth factor receptor 2; ant 96.45
3s96_B 218 3B5H10 FAB light chain; huntingtin, immune system; 96.44
3to4_D 253 NKT vbeta2 (mouse variable domain, human constant; 96.44
2v5t_A 189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 96.43
3khq_A133 B-cell antigen receptor complex-associated protei 96.42
3r06_A 213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 96.42
2i24_N121 NEW antigen receptor PBLA8; immunoglobulin fold, i 96.42
3esu_F 250 Antibody 14B7* light chain and antibody 14B7* heav 96.41
3pv7_A 248 B7-H6, IG-like domain-containing protein DKFZP686O 96.41
3k0w_A 218 Mucosa-associated lymphoid tissue lymphoma translo 96.41
1epf_A 191 NCAM, protein (neural cell adhesion molecule); imm 96.4
1f2q_A 176 High affinity immunoglobulin epsilon receptor ALP 96.4
3nl4_L 213 Antigen binding fragment, immunoglobulin IGG - LI; 96.4
2oi9_C121 V beta, T cell receptor beta chain; TCR, MHC, immu 96.39
1hxm_B 242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 96.38
3kg5_A134 B-cell antigen receptor complex-associated protei 96.37
3oai_A507 Maltose-binding periplasmic protein, myelin prote; 96.37
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 95.36
1dlf_L113 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 96.35
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 96.35
4i0k_A 222 CD276 antigen; immunoglobulin domain, glycoprotein 96.33
2yc1_B146 Single chain antibody fragment 9004G; immune syste 96.33
2gjj_A 264 A21 single-chain antibody fragment against ERBB2; 96.32
1nbq_A 209 JAM, junctional adhesion molecule 1, PAM-1; reovir 96.31
3rrq_A129 Protein PD-1, programmed cell death protein 1; pro 96.29
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 96.28
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 96.27
1hkf_A122 NKP44, NK cell activating receptor; natural cytoto 96.27
3bik_B134 Programmed cell death protein 1; CO-stimulation, r 96.27
2wng_A 327 Tyrosine-protein phosphatase non-receptor type sub 96.26
4dzb_B 246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 96.25
3ojm_B 231 Fibroblast growth factor receptor 2; beta trefoil 96.25
3tf7_C 256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 96.25
2nms_A124 CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 96.24
1mju_H 227 Immunoglobulin MS6-12; catalytic antibody, ester h 96.24
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 96.24
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 96.22
2ol3_A142 BM3.3 T-cell receptor alpha-chain; T cell receptor 96.2
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 96.2
2wzp_D123 Camelid VHH5; baseplate, viral protein; 2.60A {Lam 96.2
3sgj_C 204 Human FCG3A receptor; receptor complex, FC recepto 96.17
1x9q_A 268 SCFV, 4M5.3 anti-fluorescein single chain antibody 96.17
4ei6_B 245 Vbeta16 XV19 type II natural killer T cell recept 96.17
3ry4_A 170 Low affinity immunoglobulin gamma FC region recep; 96.16
1q0x_L 212 FAB 9B1, light chain; anti-morphine antibody, FAB 96.15
3r8b_B125 G5-8, enterotoxin type B; immunoglobulin-like, OB- 96.13
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 96.13
2otu_A115 FV light chain variable domain; antibody FV polygl 96.13
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 96.12
2frg_P106 TREM-like transcript-1; immunoglobulin-like, beta- 96.12
2p1y_A 238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 96.12
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 96.11
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 96.1
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 96.1
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 96.09
1oaq_L120 Light chain; antibody, allergy, IGE, conformationa 96.09
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 96.07
3o4o_C 339 Interleukin-1 receptor type 2; cytokine-receptor c 96.07
3dmm_D 150 T-cell surface glycoprotein CD8 beta chain; T cell 96.05
1hxm_A 229 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 96.04
1moe_A 240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 96.03
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 96.01
1op3_H 225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 95.99
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 95.97
1hnf_A 182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 95.96
2fbo_J250 V1V2;, variable region-containing chitin-binding p 95.96
1sy6_A 204 T-cell surface glycoprotein CD3 gamma/epsilon chai 95.92
2xzc_L 216 FAB A.17 light chain; immune system; HET: XOP; 1.3 95.9
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 95.89
2yc1_A117 Single chain antibody fragment 9004G; immune syste 95.85
3nl4_H 215 Antigen binding fragment,immunoglobulin IGG - HEA; 95.85
2xt1_B121 Camelid VHH 9; viral protein-immune system complex 95.84
3bdb_A137 Novel immune-type receptor 11; immunoglobulin vari 95.84
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 95.82
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 95.81
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 95.81
2hp4_A114 T-cell surface glycoprotein CD8 alpha chain; CO-re 95.81
2v44_A 189 NCAM2, neural cell adhesion molecule 2; phosphoryl 95.8
2c1o_A 254 IGK-C protein; FAB fragment, enantioselective, fin 95.78
1c1e_H 219 Catalytic antibody 1E9 (heavy chain); diels-alder, 95.77
3bp6_B 202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 95.76
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 95.76
1nqb_A 256 Single-chain antibody fragment; multivalent antibo 95.76
1c5d_H 215 Monoclonal antibody against the main immunogenic t 95.74
3b9v_A120 Heavy chain variable domain; antibody engineering, 95.74
3u6r_L143 Antibody 1:7 (light chain); IG-like domain, neutra 95.74
3m8o_H 221 Immunoglobulin A1 heavy chain; immunoglobulin fold 95.74
1pz5_B 220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 95.73
1kxv_C121 Camelid VHH domain CAB10; beta 8 alpha 8, beta bar 95.72
1nkr_A 201 P58-CL42 KIR; inhibitory receptor, natural killer 95.72
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 95.71
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 95.69
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 95.69
3ux9_B 256 SCFV antibody; five helices, long loop connecting 95.69
2dru_A 180 Chimera of CD48 antigen and T-cell surface antige; 95.69
2pkd_A111 SLAM family member 5; signaling lymphocyte activat 95.68
1ypz_F 230 T-cell receptor gamma chain, beta-2-microglobulin; 95.66
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 95.66
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 95.65
1yc7_A124 Anti-VSG immunoglobulin heavy chain variable domai 95.65
2p45_B123 Antibody CAB-RN05; seMet phasing, camelid single-d 95.64
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 95.64
1sjv_A114 R9; camelids antibody, domain swapping, heavy chai 95.64
2vol_A 207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 95.64
3juy_B 256 3B3 single chain variant HIV-1 antibody; envelope 95.63
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 95.63
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 95.61
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 95.6
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 95.58
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 95.57
3osk_A130 Cytotoxic T-lymphocyte protein 4; beta sandwich, h 95.57
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 95.56
1j05_H121 T84.66 antibody, anti-CEA MAB T84.66, heavy chain; 95.56
2fbj_H 220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 95.55
3d9a_H 210 Heavy chain of hyhel10 antibody fragment (FAB); ly 95.54
2h32_A126 Immunoglobulin IOTA chain; beta sheets, V and C-ty 95.54
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 95.52
1dee_B 223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 95.48
3omz_A 259 Human vdelta1 gamma delta T cell receptor delta1A; 95.48
3tv3_H 239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 95.46
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 95.44
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 95.44
1p4b_L135 Antibody variable light chain; FV antibody, antige 95.44
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 95.44
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 95.44
2ak4_D 211 SB27 T cell receptor alpha chain; bulged epitopes, 95.42
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 95.41
1xed_A117 Polymeric-immunoglobulin receptor; IG-like fold, i 95.41
2d3v_A 196 Leukocyte immunoglobulin-like receptor subfamily A 95.41
1a2y_B116 IGG1-kappa D1.3 FV (heavy chain); complex (immunog 95.4
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 95.39
1nez_G128 T-cell surface glycoprotein CD8 alpha chain; immun 95.38
1oga_D 215 T-cell receptor alpha chain V region, beta-2-micro 95.37
1xiw_D122 Immunoglobulin heavy chain variable region; CD3-ep 95.37
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 95.37
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 95.35
1q9r_B 222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 95.35
1rjc_A137 1D2L19, camelid heavy chain antibody; beta sandwic 95.34
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 95.33
2znx_A 242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 95.32
2xqy_G 261 A13-D6.3 monoclonal antibody, envelope glycoprotei 95.3
1mfa_H120 IGG1-lambda Se155-4 FAB (heavy chain); immunoglobu 95.3
1n4x_H120 Immunoglobulin heavy chain variable region; immune 95.29
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 95.29
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 95.27
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 95.27
2bnu_A 203 TCR alpha chain, T-cell receptor alpha chain C reg 95.25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 95.24
2gi7_A 184 GPVI protein; IG-like domains, blood clotting, cel 95.19
2x1q_A127 Gelsolin nanobody; contractIle protein; 1.06A {Lam 95.19
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 95.19
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 95.18
3t0v_A123 Immunoglobulin variable lambda domain; immunoglobu 95.17
1dn0_B 232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 95.17
3mj6_A 268 Junctional adhesion molecule-like; immunoglobulin 95.15
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 95.15
2ghw_B 247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 95.15
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 95.14
3b5h_A 184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 95.14
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 95.13
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 95.13
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 95.12
3dmm_C 166 T-cell surface glycoprotein CD8 alpha chain; T cel 95.12
1ry7_B 334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 95.12
1vca_A 202 VCAM-D1,2, human vascular cell adhesion molecule-1 95.09
1za6_B 344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 95.07
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 95.06
3uzq_A 253 Anti-dengue MAB 4E11; dengue antibody neutralizati 95.06
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 95.05
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 95.05
2wim_A 291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 95.02
1uct_A 218 Immunoglobulin alpha FC receptor; beta stands, imm 95.02
2rgs_A 218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 95.02
1i3u_A127 Antibody VHH LAMA domain; VHH fragment, immune sys 94.97
1dlf_H124 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 94.96
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 94.96
1oll_A 188 NK receptor; immune system/receptor, NK cell trigg 94.96
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 94.96
1i1r_A 303 GP130, interleukin-6 receptor beta chain; cytokine 94.95
2x1w_L 213 Vascular endothelial growth factor receptor 2; hor 94.95
1lp9_E 194 T-cell receptor alpha chain; immunoregulatory comp 94.94
1f3r_B 257 FV antibody fragment; IG-fold, immuno complex, ant 94.93
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 94.93
3liz_H 253 4C3 monoclonal antibody heavy chain; hydrolase-imm 94.92
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 94.91
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 94.9
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 94.9
1nqb_A256 Single-chain antibody fragment; multivalent antibo 94.88
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 94.83
3fku_X 280 Neutralizing antibody F10; influenza, hemagglutini 94.82
1ugn_A 198 LIR1, leukocyte immunoglobulin-like receptor 1; im 94.79
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 94.79
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 94.79
2y23_A 312 Myomesin; structural protein, sarcomere, M-BAND, i 94.78
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 94.77
1kxt_B127 Immunoglobulin VHH fragment; alpha 8 beta 8, beta 94.77
3qjh_A 205 5C.C7 alpha chain; immunoglobulin domain, T cell r 94.76
3r4d_A 208 CEA-related cell adhesion molecule 1, isoform 1/2; 94.76
2wv3_A 190 Neuroplastin; igcam, membrane, glycoprotein, cell 94.75
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 94.75
2w59_A 231 IGY FCU3-4; immunoglobulin, avian, immune system; 94.7
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 94.69
3p2t_A 196 Leukocyte immunoglobulin-like receptor subfamily 4 94.69
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 94.68
3n9g_H 230 FAB fragment of MAB CR4354, heavy chain; human neu 94.68
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 94.67
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 94.67
3umt_A256 SCFV heavy chain and light chain; stability engine 94.66
3cx5_J127 Heavy chain (VH) of FV-fragment; complex III, elec 94.63
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 94.62
2o26_X 290 MAST/stem cell growth factor receptor; stem cell f 94.6
3u6r_H 149 Antibody 1:7 (heavy chain); IG-like domain, neutra 94.59
3mjg_X289 Beta-type platelet-derived growth factor receptor; 94.58
3gkz_A 257 Anti-methamphetamine single chain FV; therapeutic 94.56
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 94.56
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 94.55
1i1c_A 239 IGG2A, IG gamma-2A chain C region; FC, immune syst 94.55
1n26_A 325 IL-6 receptor alpha chain; transmembrane, glycopro 94.52
3r0m_A143 Llama VHH A12; IG domain, immune system; 1.50A {La 94.5
3bae_H 228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 94.49
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 94.48
1l6x_A 207 Immunoglobulin gamma-1 heavy chain constant regio; 94.47
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 94.45
2nw2_A 200 ELS4 TCR alpha chain; T cell receptor, immune syst 94.44
3bn9_D 257 E2 FAB heavy chain; antibody-protease complex, pro 94.43
3mlr_H 226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 94.43
3rgv_A 200 YAE62 TCR A chain; TCR, MHC, MHC class I, immune s 94.41
1smo_A119 Triggering receptor expressed on myeloid cells 1; 94.38
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 94.37
1kgc_D 206 T-cell receptor alpha chain; LC13 clone, immune sy 94.32
1mqk_H127 Antibody 7E2 FV fragment, heavy chain; membrane pr 94.3
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 94.23
1jtp_A 148 Single-domain antibody; immunoglobulin, heavy chai 94.22
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 94.21
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 94.2
1zvh_A134 Immunoglobulin heavy chain antibody variable domai 94.17
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 94.12
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 94.11
1ymm_D 207 T cell receptor alpha chain; protein-protein compl 94.08
3iy0_H120 FAB 14, heavy domain; cryoem, neutralizing antibod 94.07
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 94.06
1zvo_C 512 Myeloma immunoglobulin D delta; immunoglobulin fol 94.03
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 94.03
3oq3_B 329 IFN-alpha/beta binding protein C12R; mousepox viru 94.01
4ei6_A 208 Valpha1 XV19 type II natural killer T cell recept 93.99
2q86_A 229 Valpha14 TCR; INKT cells, TCR, glycolipid recognit 93.98
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 93.98
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 93.93
3mbe_C 229 I-AG7; T cell receptor, histocompatability antigen 93.9
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 93.89
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 93.88
1q8m_A127 Triggering receptor expressed on myeloid cells 1; 93.85
3u2s_H 248 PG9 heavy chain; greek KEY, immunoglobulin, immune 93.78
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 93.76
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 93.76
3gsn_A 199 RA14 TCR alpha chain (TRAV24, TRAJ49); HLA, human 93.76
3mjg_X 289 Beta-type platelet-derived growth factor receptor; 93.75
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 93.75
3c6l_A 185 TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus 92.81
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 93.71
2eys_A 210 NKT15; natural killer T cell receptor, immune syst 93.69
1zvy_A136 Immunoglobulin heavy chain antibody variable DOMA; 93.67
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 93.63
2d7t_H139 Anti polyhydroxybutyrate antibody FV, heavy chain; 93.59
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 93.57
3umt_A 256 SCFV heavy chain and light chain; stability engine 93.56
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 93.51
3iu4_H 263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 93.5
1b6u_A 257 KIR2DL3, P58 killer cell inhibitory receptor; natu 93.48
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 93.48
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 93.46
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 93.43
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 93.38
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 93.35
3k81_A127 Single strand antibody VHH domain; krepa6, single 93.33
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 93.32
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 93.3
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 93.29
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 93.29
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 93.25
3v0a_C152 Llama antibody F12; botulinum neurotoxin, toxin, n 93.21
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 93.17
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 93.16
2d9q_B 313 Granulocyte colony-stimulating factor receptor; cy 93.16
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 93.13
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 93.08
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 93.0
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 92.95
3qhz_H 232 Human monoclonal antibody DEL2D1, FAB heavy chain; 92.93
2oz4_A 265 Intercellular adhesion molecule 1; IGSF domain, st 92.91
3k74_B115 Nanobody; immunoglobulin, antibiotic resista metho 92.91
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 92.91
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 92.84
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 92.83
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 92.81
3nn8_A122 Engineered SCFV, heavy chain; beta barrel, antibod 92.79
2wng_A 327 Tyrosine-protein phosphatase non-receptor type sub 92.77
3tjh_C 226 42F3 alpha; IG MHC, antigen recognition, TCR-PMHC, 92.74
1p6f_A 242 NKP46, natural cytotoxicity triggering receptor 1; 92.72
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 92.71
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 92.69
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 92.68
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 92.65
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 92.6
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 92.52
1wwb_X103 Protein (brain derived neurotrophic factor recepto 92.49
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 92.41
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 92.35
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 92.32
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 92.3
3lh2_H137 FV 4E10 heavy chain; epitope-scaffold, immune syst 92.3
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 92.29
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 92.22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 92.14
3eak_A137 NBBCII10-FGLA; antibody, nanobody, humanization, V 92.05
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 92.05
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 92.01
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 91.97
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 91.89
2r15_A 212 Myomesin-1; sarcomeric protein, IG-like domains, h 91.89
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 91.77
3rjd_A 262 High affinity immunoglobulin gamma FC receptor I; 91.76
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 91.61
3jts_B119 Beta-2-microglobulin; alpha helix, beta sheet, bet 91.58
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 91.46
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 91.45
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 91.44
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
Probab=97.94  E-value=9.1e-06  Score=49.98  Aligned_cols=42  Identities=12%  Similarity=0.186  Sum_probs=32.3

Q ss_pred             CCCCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           35 PDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        35 g~~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+-+.|+.+++.+|+.|.|.|.+.-+.+. ..+.|+|.|++.+
T Consensus         1 G~l~~p~~vtv~~G~~v~L~C~v~~~~~~-~~~~V~W~k~~~~   42 (218)
T 4frw_A            1 GELETSDVVTVVLGQDAKLPCFYRGDSGE-QVGQVAWARVDAG   42 (218)
T ss_dssp             CCEECCSEEEEETTSCEEECCEECCCTTC-EEEEEEEEEECSS
T ss_pred             CeEeCCCeEEEEcCCCEEEEEEEEcCCCC-CccEEEEEECCCC
Confidence            45578999999999999999999755222 2245899998754



>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>1nko_A Sialic acid binding IG-like lectin 7; immunoglobulin, siglec7, immune system; 1.45A {Homo sapiens} SCOP: b.1.1.1 PDB: 2g5r_A* 1o7v_A* 2df3_A* 1o7s_A* 2hrl_A* Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>1qfo_A Protein (sialoadhesin); immunoglobulin superfamily, carbohydrate binding, immune system; HET: SIA GAL GLC; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1od7_A* 1oda_A* 1od9_A* 1qfp_A 2bve_A* 1url_A* Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} Back     alignment and structure
>2z35_A T-cell receptor alpha-chain; immune receptor, immune system; 2.20A {Mus musculus} PDB: 2pxy_A 2z31_A 1ac6_A Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>3bia_X T-cell immunoglobulin and mucin domain- containing protein 4; beta barrel, immunoglobulin fold, IGV domain, TIM, glycoprotein; HET: TLA; 2.20A {Mus musculus} PDB: 3bi9_X* 3bib_X* Back     alignment and structure
>1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2qhl_A Novel immune-type receptor 10; immunoglobulin variable domain-like beta-sandwich, immune system; 1.56A {Ictalurus punctatus} PDB: 3b5t_A 2qjd_A 2qte_A 2qqq_A Back     alignment and structure
>2atp_B T-cell surface glycoprotein CD8 beta chain; CD8AB, CD8AA, MHC, immune system; HET: NAG; 2.40A {Mus musculus} SCOP: b.1.1.1 PDB: 3b9k_B* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>3bj9_1 Immunoglobulin IOTA chain, immunoglobulin lambda- like polypeptide 1; immunoglobulin domain, beta sheet, polymorphism, immune system; 2.00A {Homo sapiens} PDB: 2h3n_A Back     alignment and structure
>1fo0_B Protein (BM3.3 T cell receptor beta-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_B* 2ol3_B* 1kb5_B 1kj2_B* Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3bp6_A Programmed cell death protein 1; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3rnk_A 3sbw_A 3bp5_A 1npu_A 3rnq_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3u1s_H FAB PGT145 heavy chain; IGG, broadly neutralizing antibody, HIV-1 GP120, immune SYST; HET: TYS; 2.30A {Homo sapiens} Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1dqt_A CTLA4, cytotoxic T lymphocyte associated antigen 4; immunoglobulin variable domain-like beta-sandwich, homodimer, immune system; 2.00A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1u9k_A Triggering receptor expressed on myeloid cells 1; activating receptors, TREM-1, innate immunity, immune system receptor, immune system; 1.76A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2i24_N NEW antigen receptor PBLA8; immunoglobulin fold, immune system; 1.35A {Ginglymostoma cirratum} PDB: 2i25_N 2i27_N 2i26_N Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2oi9_C V beta, T cell receptor beta chain; TCR, MHC, immune system; 2.35A {Mus musculus} PDB: 2e7l_C Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3kg5_A B-cell antigen receptor complex-associated protei chain; CD79B, IG-beta, BCR, immunoglobulin domain, protein binding; 3.20A {Homo sapiens} Back     alignment and structure
>3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1hkf_A NKP44, NK cell activating receptor; natural cytotoxicity receptor, immunoglobulin domain; 2.2A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3bik_B Programmed cell death protein 1; CO-stimulation, receptor-ligand complex, immunoglobulin-like sandwich, T cell, B cell, programmed death; 2.65A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ol3_A BM3.3 T-cell receptor alpha-chain; T cell receptor, class I MHC, H-2KBM8, TCR-PMHC complex, IMM system; HET: NAG; 2.90A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2wzp_D Camelid VHH5; baseplate, viral protein; 2.60A {Lama glama} PDB: 2bse_D Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3r8b_B G5-8, enterotoxin type B; immunoglobulin-like, OB-fold, toxin-immune system complex; 2.95A {Rattus norvegicus} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2otu_A FV light chain variable domain; antibody FV polyglutamine complex, immune system; 1.68A {Mus musculus} PDB: 2otw_A 2gsg_A Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2frg_P TREM-like transcript-1; immunoglobulin-like, beta-sandwich, cell surface receptor, triggering receptor, platelet receptor, ITIM, immune system; 1.19A {Homo sapiens} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3dmm_D T-cell surface glycoprotein CD8 beta chain; T cell CO-receptor CD8AB MHC complex, immune response, membrane, MHC I, phosphoprotein, transmembrane; 2.60A {Mus musculus} Back     alignment and structure
>1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2yc1_A Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_A 1dql_H 3cfi_C Back     alignment and structure
>2xt1_B Camelid VHH 9; viral protein-immune system complex; 1.32A {Vicugna pacos} PDB: 2xv6_B 2xxc_B 2xxm_B Back     alignment and structure
>3bdb_A Novel immune-type receptor 11; immunoglobulin variable domain-like beta-sandwich, stalk region, immune system; 2.80A {Ictalurus punctatus} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2hp4_A T-cell surface glycoprotein CD8 alpha chain; CO-receptor, soluble protein, KD, protein engineering, immunotherapy, immune-suppressor, immune system; 2.10A {Homo sapiens} PDB: 1akj_D 1cd8_A 3qzw_G 2q3a_A Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>3b9v_A Heavy chain variable domain; antibody engineering, phage display, immune system; 1.80A {Homo sapiens} PDB: 1fvc_B 3p9w_B 1fgv_H 2vh5_H* Back     alignment and structure
>3u6r_L Antibody 1:7 (light chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1kxv_C Camelid VHH domain CAB10; beta 8 alpha 8, beta barrel, hydrolase, immune system; 1.60A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>2pkd_A SLAM family member 5; signaling lymphocyte activation molecule, IGV, immunoglobulin variable, IGC, immunoglobulin constant, signaling protein; 2.04A {Homo sapiens} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1yc7_A Anti-VSG immunoglobulin heavy chain variable domain caban33; antibody, camel antibody, immune system; 1.60A {Camelus dromedarius} PDB: 1yc8_A 1yzz_A Back     alignment and structure
>2p45_B Antibody CAB-RN05; seMet phasing, camelid single-domain antibody, VHH, RNAse A, yeast surface display, hydrolase/immune system complex; 1.10A {Camelus dromedarius} PDB: 2p46_B 2p47_B 2p48_B 2p44_B 2p49_B 2p42_B 2p43_B 1bzq_K 3qsk_B 2p4a_B 1op9_A 1sjx_A 3qxt_A* 3qxu_A 3eba_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1sjv_A R9; camelids antibody, domain swapping, heavy chain antibody, AN; 1.94A {Lama glama} SCOP: b.1.1.1 Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3osk_A Cytotoxic T-lymphocyte protein 4; beta sandwich, homodimer, immunoglobulin superfamily (beta S fold, receptor, signalling, B7-1(CD80), B7-2(CD86); HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 PDB: 2x44_D 1i85_C 1ah1_A* 1i8l_C* 3bx7_C Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1j05_H T84.66 antibody, anti-CEA MAB T84.66, heavy chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1dvf_D 1mvu_B 1ap2_B 2ap2_B Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2h32_A Immunoglobulin IOTA chain; beta sheets, V and C-type IG folds, immune system; 2.70A {Homo sapiens} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1p4b_L Antibody variable light chain; FV antibody, antigen peptide binder, SCFV, picomolar binder, immune system; 2.35A {Mus musculus} SCOP: b.1.1.1 PDB: 1p4i_L Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2ak4_D SB27 T cell receptor alpha chain; bulged epitopes, PMHC/TCR complex, immune system; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kxf_D 3nfj_I 3ffc_D Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1xed_A Polymeric-immunoglobulin receptor; IG-like fold, immune system; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1a2y_B IGG1-kappa D1.3 FV (heavy chain); complex (immunoglobulin/hydrolase), immunoglobulin V region, signal, hydrolase, glycosidase, bacteriolytic enzyme, egg white; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1a7r_H 1dvf_B 1g7h_B 1g7i_B 1g7j_B 1g7l_B 1g7m_B 1kir_B 1vfa_B 1vfb_B 1kiq_B 1a7o_H 1a7n_H 1a7p_H 1kip_B 1a7q_H 1dl7_H* 1bvk_B 1bvl_A 1p4i_H ... Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1nez_G T-cell surface glycoprotein CD8 alpha chain; immune system; HET: NAG; 2.10A {Synthetic} SCOP: b.1.1.1 PDB: 1bqh_G* 3b9k_A* 2atp_A* 2arj_R Back     alignment and structure
>1oga_D T-cell receptor alpha chain V region, beta-2-microglobulin; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2xna_A 2xn9_A 2vlm_D 2vlk_D 2vlj_D 2vlr_D 2cdf_A 2wbj_C* 3qdm_D 3qeq_D Back     alignment and structure
>1xiw_D Immunoglobulin heavy chain variable region; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy3_B Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1rjc_A 1D2L19, camelid heavy chain antibody; beta sandwich, immunoglobulin fold, protein-protein hetero C alpha-beta orthogonal bundle, immune system-hydrolase compl; 1.40A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 1ri8_A 1xfp_A 1jtt_A 2x6m_A 1zmy_A 1f2x_K Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>1mfa_H IGG1-lambda Se155-4 FAB (heavy chain); immunoglobulin; HET: GLA MMA; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy2_B Back     alignment and structure
>1n4x_H Immunoglobulin heavy chain variable region; immune system; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy4_B Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2bnu_A TCR alpha chain, T-cell receptor alpha chain C region; superagonist peptide T-cell vaccines, transmembrane, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2bnq_D 2bnr_D 2f54_D 2pyf_A* 2pye_D* 2f53_D 2p5e_D* 2p5w_D* 3mv7_D 3mv8_D 3mv9_D 3utt_D 2cdg_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2x1q_A Gelsolin nanobody; contractIle protein; 1.06A {Lama glama} PDB: 2x1p_A 2xa3_A 3k7u_A 3sn6_N* 3stb_A 2x1o_A 3k80_A 1ol0_A 1u0q_A 1qd0_A* 3ezj_B 3p0g_B* 1mvf_A 1t2j_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>3t0v_A Immunoglobulin variable lambda domain; immunoglobulin fold, fluorogen activation, dimethylindole RE binding protein; HET: 1PE PE3; 1.45A {Homo sapiens} PDB: 3t0w_A* 3t0x_A* 3lrg_A 3lrh_A 2rhe_A Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3dmm_C T-cell surface glycoprotein CD8 alpha chain; T cell CO-receptor CD8AB MHC complex, immune response, membrane, MHC I, phosphoprotein, transmembrane; 2.60A {Mus musculus} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1i3u_A Antibody VHH LAMA domain; VHH fragment, immune system; HET: RR1; 1.95A {Lama glama} SCOP: b.1.1.1 PDB: 1i3v_A Back     alignment and structure
>1dlf_H Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 2dlf_H 1wz1_H* 3iy5_B 2uud_H* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1lp9_E T-cell receptor alpha chain; immunoregulatory complex, class I MHC:TCR CO-crystal, immune; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 2j8u_E 2jcc_E 2uwe_E 1nfd_A* Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1kxt_B Immunoglobulin VHH fragment; alpha 8 beta 8, beta barrel, hydrolase, immune system; 2.00A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>3qjh_A 5C.C7 alpha chain; immunoglobulin domain, T cell receptor, immune system; 1.90A {Mus musculus} PDB: 3qiu_C* 3qiw_C* 3qjf_A 3qib_C 2ial_A 2iam_C 2ian_D 4e41_D 4e42_A 3rug_E* 3axl_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3cx5_J Heavy chain (VH) of FV-fragment; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Mus musculus} SCOP: b.1.1.1 PDB: 1kb9_J* 1kyo_J* 1p84_J* 2ibz_X* 1ezv_X* 3cxh_J* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3u6r_H Antibody 1:7 (heavy chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3r0m_A Llama VHH A12; IG domain, immune system; 1.50A {Lama glama} PDB: 3rjq_B* 1g9e_A 1hcv_A 1shm_A 3qxw_A 3qxv_A Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2nw2_A ELS4 TCR alpha chain; T cell receptor, immune system; 1.40A {Homo sapiens} PDB: 2nx5_D 4dzb_A Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>3rgv_A YAE62 TCR A chain; TCR, MHC, MHC class I, immune system; 2.90A {Mus musculus} PDB: 3c60_A Back     alignment and structure
>1smo_A Triggering receptor expressed on myeloid cells 1; activating receptors, TREM-1, innate immune system receptor, system; HET: TLA; 1.47A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1kgc_D T-cell receptor alpha chain; LC13 clone, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1mi5_D 3kpr_D 3kps_D 3o6f_C 3t0e_C 3pqy_D 2esv_D 3dxa_D 3dx9_A Back     alignment and structure
>1mqk_H Antibody 7E2 FV fragment, heavy chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_C 3ehb_C* 3hb3_C* 1qle_H* 2otu_B 2gsg_B 2otw_B 1qfw_I* 3ab0_B 1i8k_B 1i8i_B 1vhp_A 1bfv_H* 1cfv_H* 2bfv_H* 1dsf_H Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1jtp_A Single-domain antibody; immunoglobulin, heavy chain antibody, VHH, interface, binding, antibody, hydrolase; 1.90A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 1jto_A 1mel_A 2x89_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1zvh_A Immunoglobulin heavy chain antibody variable domain; beta sandwich, immunoglobulin fold, protein-protein heterocomplex; 1.50A {Camelus dromedarius} SCOP: b.1.1.1 PDB: 3dwt_A 1g6v_K 1zv5_A 1kxq_E Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1ymm_D T cell receptor alpha chain; protein-protein complex, T cell repertoire, auto-immunity, I system; HET: NAG; 3.50A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3iy0_H FAB 14, heavy domain; cryoem, neutralizing antibody, parvovirus, canine, feline, FAB footprint, immune system; 12.50A {Mus musculus} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>4ei6_A Valpha1 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_C 4elk_A 4elm_E* 3qeu_A 1ao7_D 3qdj_D 3qdg_D 3qfj_D 1qsf_D 1qse_D* 3d39_D* 3d3v_D* 3h9s_D 3pwp_D 2gj6_D 3utp_D* 3uts_D 1qrn_D 3hg1_D 3rdt_A ... Back     alignment and structure
>2q86_A Valpha14 TCR; INKT cells, TCR, glycolipid recognition, innate immunity, IM system; HET: NAG BMA MAN FUC; 1.85A {Mus musculus} PDB: 3quy_C* 3o9w_C* 3qux_C* 3o8x_C* 3quz_C* 3rtq_C* 3rzc_C* 3ta3_C* 3tvm_C* 3qi9_C* 3ard_C* 3are_C* 3arf_C* 3arg_C* 3he6_C* 3he7_C* 3arb_C* 3scm_C* 3sda_C* 3sdc_C* ... Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3mbe_C I-AG7; T cell receptor, histocompatability antigen, MHC class II, I immune system; HET: NAG; 2.89A {Mus musculus} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1q8m_A Triggering receptor expressed on myeloid cells 1; V-type IG-like domain, immunoglobulin-like, immune system receptor; HET: GSH; 2.60A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3gsn_A RA14 TCR alpha chain (TRAV24, TRAJ49); HLA, human cytomegalovirus, PP65, T cell receptor (TCR), immune response, public response; 2.80A {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3c6l_A TCR 2W20 alpha chain; TCR-PMHC complex; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2eys_A NKT15; natural killer T cell receptor, immune system; 2.21A {Homo sapiens} PDB: 2eyr_A 2eyt_A 3huj_E* 3tyf_A 3tzv_A* 3sdx_E* 2po6_C* 2cde_A 3to4_C* Back     alignment and structure
>1zvy_A Immunoglobulin heavy chain antibody variable DOMA; beta sandwich, immunoglobulin fold, protein protein heteroco alpha-beta orthogonal bundle, hydrolase-immune system compl; 1.63A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2d7t_H Anti polyhydroxybutyrate antibody FV, heavy chain; plastic, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3iu4_H CHP3 FAB heavy chain; antibody, ganglioside, idiotype, immune system; 1.75A {Mus musculus} PDB: 1ibg_H* 3iy6_B Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3k81_A Single strand antibody VHH domain; krepa6, single domain antibody, immune system, RNA BIND protein; 3.40A {Lama glama} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3v0a_C Llama antibody F12; botulinum neurotoxin, toxin, neurotoxin associated protein, progenitor toxin complex, VHH bound interlocked complex; HET: MES; 2.70A {Lama glama} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3k74_B Nanobody; immunoglobulin, antibiotic resista methotrexate resistance, NADP, one-carbon metabolism, oxidoreductase, trimethoprim resistance; 1.95A {Lama glama} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3nn8_A Engineered SCFV, heavy chain; beta barrel, antibody fragment, immunoglobulin, immune syste; 3.10A {Mus musculus} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3tjh_C 42F3 alpha; IG MHC, antigen recognition, TCR-PMHC, membrane receptor, IM system; 2.12A {Mus musculus} PDB: 3tpu_A 3tfk_C 1j8h_D* 1fyt_D* 4gkz_A* 3rev_A 1mwa_A* 1g6r_A* 1tcr_A* 2ckb_A 1zgl_M 3c5z_A 1i9e_A* 2oi9_B 2e7l_A 2icw_I 3e2h_B 3e3q_D 4h1l_G Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3lh2_H FV 4E10 heavy chain; epitope-scaffold, immune system; 2.65A {Homo sapiens} PDB: 3h3p_H 3lhp_H 2xtj_D Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3eak_A NBBCII10-FGLA; antibody, nanobody, humanization, VHH domain, immune system; 1.95A {Camelus dromedarius} SCOP: b.1.1.1 Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3jts_B Beta-2-microglobulin; alpha helix, beta sheet, beta barrel, immune response, MHC I membrane, transmembrane, disease mutation; 2.80A {Homo sapiens} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.95
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 97.89
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 97.8
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 97.79
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.76
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 97.74
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 97.74
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.72
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.71
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.64
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.63
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 97.58
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 97.54
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 97.49
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 97.49
d1gxea_130 Cardiac myosin binding protein C, different domain 97.48
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.44
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.39
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.36
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 97.33
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.31
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.25
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.23
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 97.22
d2avga1110 Cardiac myosin binding protein C, different domain 97.21
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 97.2
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.19
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.18
d2ifga192 High affinity nerve growth factor receptor TrkA, d 97.18
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.18
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.1
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.09
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 97.04
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.99
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 96.98
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 96.98
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.95
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 96.93
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 96.91
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.89
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 96.89
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.88
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 96.82
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 96.8
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 96.75
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 96.74
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.73
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 96.7
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.61
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 96.61
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 96.57
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 96.48
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 96.45
d1pd6a_94 Cardiac myosin binding protein C, different domain 96.41
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 96.29
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 96.19
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.18
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 96.17
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 96.14
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.11
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 96.03
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 95.99
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 95.99
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 95.98
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 95.94
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 95.93
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 95.89
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 95.88
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 95.8
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 95.72
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 95.71
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.69
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 95.68
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 95.67
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 95.66
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.65
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 95.58
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.56
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 95.54
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 95.51
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 95.4
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.37
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 95.37
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 95.36
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 95.34
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 95.3
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 95.28
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 95.26
d1ospl1107 Immunoglobulin light chain kappa variable domain, 95.25
d1j05a_111 Immunoglobulin light chain kappa variable domain, 95.22
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 95.2
d2gsia1111 Immunoglobulin light chain kappa variable domain, 95.08
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 94.98
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 94.95
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 94.94
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 94.94
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 94.93
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 94.92
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 94.92
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 94.82
d1jhll_108 Immunoglobulin light chain kappa variable domain, 94.74
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 94.64
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 94.58
d1lgva1112 Immunoglobulin light chain lambda variable domain, 94.52
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 94.52
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 94.46
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 94.38
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 94.36
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 94.15
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 94.09
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 93.96
d1op3k1106 Immunoglobulin light chain kappa variable domain, 93.87
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 93.75
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 93.67
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 93.67
d1mexl1107 Immunoglobulin light chain kappa variable domain, 93.65
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 93.6
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 93.49
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 93.29
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 93.28
d8faba1103 Immunoglobulin light chain lambda variable domain, 93.04
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 93.04
d1mjul1112 Immunoglobulin light chain kappa variable domain, 92.8
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 92.6
d1d5il1107 Immunoglobulin light chain kappa variable domain, 92.43
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 92.12
d1oaql_110 Immunoglobulin light chain lambda variable domain, 91.67
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 91.51
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 91.29
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 90.73
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 90.45
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 89.36
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 88.96
d2a7ya180 Hypothetical protein Rv2302/MT2359 {Mycobacterium 88.1
d1w72l1109 Immunoglobulin light chain lambda variable domain, 87.99
d2rhea_114 Immunoglobulin light chain lambda variable domain, 87.91
d1nfde1108 Immunoglobulin light chain lambda variable domain, 87.81
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 87.17
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 86.97
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 85.48
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 85.42
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 84.69
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 84.6
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 84.12
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 82.3
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 80.2
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: V set domains (antibody variable domain-like)
domain: CD80, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.95  E-value=1.5e-06  Score=51.68  Aligned_cols=36  Identities=19%  Similarity=0.438  Sum_probs=31.3

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .++||.+||+|+|+|.++.+...-.+|.+.|.|++.
T Consensus         2 ~~Vt~~~G~~a~L~C~~~~~~~~~~~~~v~w~~~~~   37 (105)
T d1dr9a1           2 IHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKK   37 (105)
T ss_dssp             CEEEEETTSCEEECCSCCCCTTHHHHCEEEEEETTE
T ss_pred             eEEEEEeCCCEEEEEEECCcccceeEEEEEEEecce
Confidence            368999999999999999887666789999999864



>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7ya1 b.34.6.3 (A:1-80) Hypothetical protein Rv2302/MT2359 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure