Psyllid ID: psy5391
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| 57941020 | 151 | AGAP010338-PA [Anopheles gambiae str. PE | 0.452 | 0.470 | 0.676 | 3e-22 | |
| 195377279 | 150 | GJ11942 [Drosophila virilis] gi|19415457 | 0.452 | 0.473 | 0.676 | 3e-21 | |
| 195016704 | 150 | GH15005 [Drosophila grimshawi] gi|193897 | 0.452 | 0.473 | 0.676 | 3e-21 | |
| 194746888 | 150 | GF24868 [Drosophila ananassae] gi|190623 | 0.452 | 0.473 | 0.619 | 3e-21 | |
| 427786355 | 152 | Putative 39s ribosomal protein l23 [Rhip | 0.535 | 0.552 | 0.6 | 5e-21 | |
| 346469935 | 152 | hypothetical protein [Amblyomma maculatu | 0.535 | 0.552 | 0.588 | 5e-21 | |
| 195439942 | 150 | GK12514 [Drosophila willistoni] gi|19416 | 0.452 | 0.473 | 0.661 | 5e-21 | |
| 17647675 | 150 | mitochondrial ribosomal protein L23, iso | 0.452 | 0.473 | 0.633 | 5e-21 | |
| 380018796 | 142 | PREDICTED: 39S ribosomal protein L23, mi | 0.503 | 0.556 | 0.637 | 7e-21 | |
| 239788444 | 154 | ACYPI31744 [Acyrthosiphon pisum] | 0.471 | 0.480 | 0.702 | 7e-21 |
| >gi|57941020|ref|XP_559130.1| AGAP010338-PA [Anopheles gambiae str. PEST] gi|68566025|sp|Q5TUE9.1|RM23_ANOGA RecName: Full=Probable 39S ribosomal protein L23, mitochondrial; Short=L23mt; Short=MRP-L23 gi|55242836|gb|EAL41058.1| AGAP010338-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 109 bits (273), Expect = 3e-22, Method: Compositional matrix adjust.
Identities = 48/71 (67%), Positives = 57/71 (80%)
Query: 1 MSSRWYPIYQKGNPQLRIFLPNFWMKLVRSKEPLPPNVVEFHVPLAMTNHDIKNYLEKIY 60
MSSRWYPIYQ+GNPQLR+FLPNFW+KLVR PPNVV+F + MT HD+KNYLEKIY
Sbjct: 1 MSSRWYPIYQRGNPQLRVFLPNFWLKLVRPANEQPPNVVQFACSMEMTRHDVKNYLEKIY 60
Query: 61 NVTVKHVESTL 71
NV V +V + +
Sbjct: 61 NVPVVNVRTRI 71
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195377279|ref|XP_002047418.1| GJ11942 [Drosophila virilis] gi|194154576|gb|EDW69760.1| GJ11942 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195016704|ref|XP_001984468.1| GH15005 [Drosophila grimshawi] gi|193897950|gb|EDV96816.1| GH15005 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|194746888|ref|XP_001955886.1| GF24868 [Drosophila ananassae] gi|190623168|gb|EDV38692.1| GF24868 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|427786355|gb|JAA58629.1| Putative 39s ribosomal protein l23 [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|346469935|gb|AEO34812.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|195439942|ref|XP_002067818.1| GK12514 [Drosophila willistoni] gi|194163903|gb|EDW78804.1| GK12514 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|17647675|ref|NP_523889.1| mitochondrial ribosomal protein L23, isoform A [Drosophila melanogaster] gi|221330777|ref|NP_001137873.1| mitochondrial ribosomal protein L23, isoform B [Drosophila melanogaster] gi|442629719|ref|NP_001261325.1| mitochondrial ribosomal protein L23, isoform C [Drosophila melanogaster] gi|442629721|ref|NP_001261326.1| mitochondrial ribosomal protein L23, isoform D [Drosophila melanogaster] gi|68566063|sp|Q9W021.1|RM23_DROME RecName: Full=39S ribosomal protein L23, mitochondrial; Short=L23mt; Short=MRP-L23 gi|7292229|gb|AAF47639.1| mitochondrial ribosomal protein L23, isoform A [Drosophila melanogaster] gi|17945986|gb|AAL49037.1| RE49852p [Drosophila melanogaster] gi|220902427|gb|ACL83229.1| mitochondrial ribosomal protein L23, isoform B [Drosophila melanogaster] gi|220948942|gb|ACL87014.1| mRpL23-PA [synthetic construct] gi|440215199|gb|AGB94020.1| mitochondrial ribosomal protein L23, isoform C [Drosophila melanogaster] gi|440215200|gb|AGB94021.1| mitochondrial ribosomal protein L23, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|380018796|ref|XP_003693307.1| PREDICTED: 39S ribosomal protein L23, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|239788444|dbj|BAH70904.1| ACYPI31744 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| FB|FBgn0035335 | 150 | mRpL23 "mitochondrial ribosoma | 0.452 | 0.473 | 0.633 | 2.1e-22 | |
| UNIPROTKB|F1NVZ3 | 152 | MRPL23 "Uncharacterized protei | 0.426 | 0.440 | 0.567 | 2.6e-15 | |
| ZFIN|ZDB-GENE-040625-12 | 153 | mrpl23 "mitochondrial ribosoma | 0.426 | 0.437 | 0.537 | 2.6e-15 | |
| UNIPROTKB|F1PBY1 | 153 | MRPL23 "Uncharacterized protei | 0.452 | 0.464 | 0.478 | 6.9e-15 | |
| UNIPROTKB|F1NK84 | 105 | MRPL23 "Uncharacterized protei | 0.363 | 0.542 | 0.631 | 1.8e-14 | |
| MGI|MGI:1196612 | 146 | Mrpl23 "mitochondrial ribosoma | 0.452 | 0.486 | 0.450 | 4.9e-14 | |
| RGD|68343 | 146 | Mrpl23 "mitochondrial ribosoma | 0.452 | 0.486 | 0.450 | 4.9e-14 | |
| UNIPROTKB|A6NJD9 | 163 | MRPL23 "39S ribosomal protein | 0.452 | 0.435 | 0.436 | 3.4e-13 | |
| UNIPROTKB|A8MVT4 | 166 | MRPL23 "39S ribosomal protein | 0.452 | 0.427 | 0.436 | 3.4e-13 | |
| UNIPROTKB|A8MYK1 | 191 | MRPL23 "39S ribosomal protein | 0.452 | 0.371 | 0.436 | 3.4e-13 |
| FB|FBgn0035335 mRpL23 "mitochondrial ribosomal protein L23" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 260 (96.6 bits), Expect = 2.1e-22, P = 2.1e-22
Identities = 45/71 (63%), Positives = 56/71 (78%)
Query: 1 MSSRWYPIYQKGNPQLRIFLPNFWMKLVRSKEPLPPNVVEFHVPLAMTNHDIKNYLEKIY 60
MS+RWYPIYQ+GNPQLR+FLPNFWMKL+R E PPNVV F V + MT +D++NYLEKIY
Sbjct: 1 MSTRWYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIY 60
Query: 61 NVTVKHVESTL 71
+ V V + +
Sbjct: 61 KLPVVDVRTRI 71
|
|
| UNIPROTKB|F1NVZ3 MRPL23 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-12 mrpl23 "mitochondrial ribosomal protein L23" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PBY1 MRPL23 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NK84 MRPL23 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196612 Mrpl23 "mitochondrial ribosomal protein L23" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|68343 Mrpl23 "mitochondrial ribosomal protein L23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NJD9 MRPL23 "39S ribosomal protein L23, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MVT4 MRPL23 "39S ribosomal protein L23, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MYK1 MRPL23 "39S ribosomal protein L23, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| pfam00276 | 90 | pfam00276, Ribosomal_L23, Ribosomal protein L23 | 0.003 |
| >gnl|CDD|144021 pfam00276, Ribosomal_L23, Ribosomal protein L23 | Back alignment and domain information |
|---|
Score = 34.6 bits (80), Expect = 0.003
Identities = 11/34 (32%), Positives = 17/34 (50%)
Query: 36 PNVVEFHVPLAMTNHDIKNYLEKIYNVTVKHVES 69
PN F V +IK+ +E I+ V V+ V +
Sbjct: 19 PNQYVFIVDKKANKTEIKDAVEHIFGVKVEKVNT 52
|
Length = 90 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| KOG4089|consensus | 165 | 99.9 | ||
| PF00276 | 91 | Ribosomal_L23: Ribosomal protein L23; InterPro: IP | 99.7 | |
| PRK05738 | 92 | rplW 50S ribosomal protein L23; Reviewed | 99.65 | |
| CHL00030 | 93 | rpl23 ribosomal protein L23 | 99.59 | |
| COG0089 | 94 | RplW Ribosomal protein L23 [Translation, ribosomal | 99.55 | |
| PRK12280 | 158 | rplW 50S ribosomal protein L23; Reviewed | 99.46 | |
| TIGR03636 | 77 | L23_arch archaeal ribosomal protein L23. This mode | 99.42 | |
| PRK14548 | 84 | 50S ribosomal protein L23P; Provisional | 99.4 | |
| PTZ00191 | 145 | 60S ribosomal protein L23a; Provisional | 99.21 | |
| KOG1751|consensus | 157 | 98.4 |
| >KOG4089|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.4e-24 Score=174.54 Aligned_cols=98 Identities=36% Similarity=0.695 Sum_probs=84.9
Q ss_pred CC-CccccceecCCCceeEeecCcEEEEeeCCCCCCCcEEEEEecCCCCHHHHHHHHHHHhCceeeEEEeeeecC----c
Q psy5391 1 MS-SRWYPIYQKGNPQLRIFLPNFWMKLVRSKEPLPPNVVEFHVPLAMTNHDIKNYLEKIYNVTVKHVESTLENA----T 75 (157)
Q Consensus 1 ms-~r~ypl~~~G~~q~rIFLPnf~~~LvR~~~~l~pN~vtF~Vp~~mTK~DIK~YLEkiYnVkV~~VnT~I~~g----k 75 (157)
|+ +|+||+|+.|+||++||||||||.|+||...++|++++|+||++|||+||++||+++||++|.+|+|.+.+| +
T Consensus 1 m~s~~~y~~~k~gn~q~rVf~Pn~~~~l~rp~~~q~p~~~~FrVp~~m~k~DvR~YL~~iY~l~v~~vrtrl~~Gk~~~~ 80 (165)
T KOG4089|consen 1 MGSRRGYRLYKFGNPQLRVFFPNFWINLVRPLVTQPPKIVKFRVPMSMNKFDVRDYLTHIYDLPVVDVRTRLQHGKDYKK 80 (165)
T ss_pred CcccceeeeeecCCcceeEecchhHHhhhcccccCCCceEEEEcchhhccccHHHHHHHhcCCceeeeeeeeeechhhhc
Confidence 55 779999999999999999999999999998899999999999999999999999999999999999999999 4
Q ss_pred ceeccccccceecccCCCceeeeee
Q psy5391 76 SMAEWVSWLAFQMTLQPTRTVSTSL 100 (157)
Q Consensus 76 ~KR~~~~~~R~~~~kqP~~k~a~~~ 100 (157)
.++..++- ..|.+.=+++.|.+.
T Consensus 81 ~k~r~~~~--k~i~kdmd~p~~Yv~ 103 (165)
T KOG4089|consen 81 TKKRLQSP--KRIKKDMDEPVAYVE 103 (165)
T ss_pred ceeccccc--ceeecccccceeeec
Confidence 44444443 334444478888883
|
|
| >PF00276 Ribosomal_L23: Ribosomal protein L23; InterPro: IPR013025 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK05738 rplW 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >CHL00030 rpl23 ribosomal protein L23 | Back alignment and domain information |
|---|
| >COG0089 RplW Ribosomal protein L23 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12280 rplW 50S ribosomal protein L23; Reviewed | Back alignment and domain information |
|---|
| >TIGR03636 L23_arch archaeal ribosomal protein L23 | Back alignment and domain information |
|---|
| >PRK14548 50S ribosomal protein L23P; Provisional | Back alignment and domain information |
|---|
| >PTZ00191 60S ribosomal protein L23a; Provisional | Back alignment and domain information |
|---|
| >KOG1751|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| 3tve_T | 92 | 50S ribosomal protein L23; RNA, ribosome, tRNA, tr | 99.64 | |
| 3r8s_T | 93 | 50S ribosomal protein L23; protein biosynthesis, R | 99.63 | |
| 2zjr_Q | 95 | 50S ribosomal protein L23; ribosome, large ribosom | 99.61 | |
| 1vq8_S | 85 | 50S ribosomal protein L23P; ribosome 50S, protein- | 99.42 | |
| 3j21_T | 86 | 50S ribosomal protein L23P; archaea, archaeal, KIN | 99.37 | |
| 2zkr_s | 156 | 60S ribosomal protein L23A; protein-RNA complex, 6 | 99.27 | |
| 3u5e_X | 142 | 60S ribosomal protein L25; translation, ribosome, | 99.23 | |
| 4a17_R | 150 | RPL23A, 60S ribosomal protein L21; eukaryotic ribo | 99.21 | |
| 3iz5_X | 152 | 60S ribosomal protein L23A (L23P); eukaryotic ribo | 99.16 | |
| 3bbo_V | 198 | Ribosomal protein L23; large ribosomal subunit, sp | 99.15 |
| >3tve_T 50S ribosomal protein L23; RNA, ribosome, tRNA, translation, mRNA; 3.10A {Thermus thermophilus} PDB: 3pyr_T 3pyo_T 3pyv_T 3pyt_T 3tvh_T 1n88_A 1vsa_R 1vsp_R 2hgj_W 2hgq_W 2hgu_W 2j01_X 2j03_X 2jl6_X 2jl8_X 2v47_X 2v49_X 2wdi_X 2wdj_X 2wdl_X ... | Back alignment and structure |
|---|
Probab=99.64 E-value=5.2e-16 Score=113.39 Aligned_cols=65 Identities=18% Similarity=0.170 Sum_probs=56.2
Q ss_pred CCCCCcEEEEEecCCCCHHHHHHHHHHHhCceeeEEEeeeecCcceeccccccceecccCCCceeeeeee
Q psy5391 32 EPLPPNVVEFHVPLAMTNHDIKNYLEKIYNVTVKHVESTLENATSMAEWVSWLAFQMTLQPTRTVSTSLF 101 (157)
Q Consensus 32 ~~l~pN~vtF~Vp~~mTK~DIK~YLEkiYnVkV~~VnT~I~~gk~KR~~~~~~R~~~~kqP~~k~a~~~~ 101 (157)
..++.|+++|.|+++|||.|||+++|++|||+|.+|||++.+||.||.+. .+-+.+++|+|+|++
T Consensus 17 ~~~e~n~~~F~V~~~AnK~qIK~aVe~lf~VkV~~VnT~~~~gK~kR~g~-----~~G~~~~~KKA~VtL 81 (92)
T 3tve_T 17 AGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGR-----YLGKRPDRKKAIVQV 81 (92)
T ss_dssp TTTTTTEEEEEECTTCCHHHHHHHHHHHTTCCEEEEEEEEECCCEEESSS-----CEEECCCEEEEEEEE
T ss_pred HHhhCCEEEEEECCCCCHHHHHHHHHHHhCCceeeeeeeeeCCceeeecc-----ccccCCCceEEEEEc
Confidence 34556999999999999999999999999999999999999999887642 244569999999944
|
| >3r8s_T 50S ribosomal protein L23; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_T 3j19_T 2wwq_T 3oat_T* 3oas_T* 3ofd_T 3ofc_T 3ofr_T* 3ofz_T* 3og0_T 3ofq_T 3r8t_T 2j28_T 3e1b_M 3e1d_M 3iy9_T 3i1n_T 1p85_R 1p86_R 1vs8_T ... | Back alignment and structure |
|---|
| >2zjr_Q 50S ribosomal protein L23; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.12.1.1 PDB: 1sm1_R* 2aar_R 2d3o_R 2zjp_Q* 2zjq_Q 1nkw_R 3cf5_Q* 3dll_Q* 3pio_Q* 3pip_Q* 1nwy_R* 1nwx_R* 1xbp_R* 1pnu_R 1pny_R 1vor_U 1vou_U 1vow_U 1voy_U 1vp0_U | Back alignment and structure |
|---|
| >1vq8_S 50S ribosomal protein L23P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.12.1.1 PDB: 1vq4_S* 1vq5_S* 1vq6_S* 1vq7_S* 1s72_S* 1vq9_S* 1vqk_S* 1vql_S* 1vqm_S* 1vqn_S* 1vqo_S* 1vqp_S* 1yhq_S* 1yi2_S* 1yij_S* 1yit_S* 1yj9_S* 1yjn_S* 1yjw_S* 2otj_S* ... | Back alignment and structure |
|---|
| >3j21_T 50S ribosomal protein L23P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2zkr_s 60S ribosomal protein L23A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >3u5e_X 60S ribosomal protein L25; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_K 2ww9_K 3izc_X 3izs_X 2wwb_K 3o5h_W 3o58_W 3u5i_X 4b6a_X 1s1i_T 3jyw_T | Back alignment and structure |
|---|
| >4a17_R RPL23A, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_R 4a1c_R 4a1e_R | Back alignment and structure |
|---|
| >3bbo_V Ribosomal protein L23; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 157 | ||||
| d2qamt1 | 93 | d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherich | 7e-04 | |
| d2zjrq1 | 93 | d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococc | 7e-04 | |
| d2j01x1 | 93 | d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus t | 0.001 | |
| d1vqos1 | 81 | d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon | 0.004 |
| >d2qamt1 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} Length = 93 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal proteins S24e, L23 and L15e superfamily: Ribosomal proteins S24e, L23 and L15e family: L23p domain: Ribosomal protein L23 species: Escherichia coli [TaxId: 562]
Score = 34.7 bits (80), Expect = 7e-04
Identities = 9/31 (29%), Positives = 16/31 (51%)
Query: 37 NVVEFHVPLAMTNHDIKNYLEKIYNVTVKHV 67
N + V T +IK ++K++ V V+ V
Sbjct: 28 NTIVLKVAKDATKAEIKAAVQKLFEVEVEVV 58
|
| >d2zjrq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} Length = 93 | Back information, alignment and structure |
|---|
| >d2j01x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} Length = 93 | Back information, alignment and structure |
|---|
| >d1vqos1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 81 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| d2zjrq1 | 93 | Ribosomal protein L23 {Deinococcus radiodurans [Ta | 99.57 | |
| d2qamt1 | 93 | Ribosomal protein L23 {Escherichia coli [TaxId: 56 | 99.56 | |
| d2j01x1 | 93 | Ribosomal protein L23 {Thermus thermophilus [TaxId | 99.51 | |
| d1vqos1 | 81 | Ribosomal protein L23 {Archaeon Haloarcula marismo | 99.34 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 88.43 |
| >d2zjrq1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal proteins S24e, L23 and L15e superfamily: Ribosomal proteins S24e, L23 and L15e family: L23p domain: Ribosomal protein L23 species: Deinococcus radiodurans [TaxId: 1299]
Probab=99.57 E-value=1.2e-15 Score=109.84 Aligned_cols=65 Identities=17% Similarity=0.177 Sum_probs=56.8
Q ss_pred CCcEEEEEecCCCCHHHHHHHHHHHhCceeeEEEeeeecCcceeccccccceecccCCCceeeeeeeecccccc
Q psy5391 35 PPNVVEFHVPLAMTNHDIKNYLEKIYNVTVKHVESTLENATSMAEWVSWLAFQMTLQPTRTVSTSLFESYLSSG 108 (157)
Q Consensus 35 ~pN~vtF~Vp~~mTK~DIK~YLEkiYnVkV~~VnT~I~~gk~KR~~~~~~R~~~~kqP~~k~a~~~~~~~l~~~ 108 (157)
..|+++|.|+++|||.|||+++|++|||+|.+|||++.+|+.||..+ .+-..+++|+|+| +|..|
T Consensus 20 e~n~y~F~V~~~atK~~Ik~ave~lf~VkV~~Vnt~~~~gK~kr~~~-----~~g~~~~~KKAiV----tL~~g 84 (93)
T d2zjrq1 20 ERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKRVGR-----FIGQRNDRKKAIV----RLAEG 84 (93)
T ss_dssp TTTCCEEEECSSCTHHHHHHHHHHHHCCCCSEEEECCBCCCCCSSSS-----CCCCCCCBEEEEE----ECCSS
T ss_pred HCCEEEEEEeCCCCHHHHHHHHHHHcCCCeEEEEEEEeCCCceEECC-----cceecCCCEEEEE----EcCCc
Confidence 56999999999999999999999999999999999999999887532 3456799999999 55554
|
| >d2qamt1 d.12.1.1 (T:1-93) Ribosomal protein L23 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j01x1 d.12.1.1 (X:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vqos1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|