Psyllid ID: psy5412

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
ccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEccccEEEEEcccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHccccc
cccHHHHcccccHHHcccHHHHHHHHHcccccccEEEEEccccccEEEEEEEEEcccEEEEEEEEcccEEEEccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHcc
matdldpndpdmkylsvdrnafndpatqaewtqkrlvwvphenqgfvaAGIKGELGDSVEVELVETgkrivvpkddiqkmnppkfdkvedmadltclneASVLHNIKdryysgliy
matdldpndpdMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVEtgkrivvpkddiqkmnppkfdkveDMADLTclneasvlhnikdryysgliy
MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
*************************ATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDI********DKVEDMADLTCLNEASVLHNIKDRYYSGLI*
*******************************TQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
********DPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
***********MKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q99323 2057 Myosin heavy chain, non-m yes N/A 0.991 0.055 0.728 4e-42
P35580 1976 Myosin-10 OS=Homo sapiens yes N/A 0.991 0.058 0.681 2e-38
Q27991 1976 Myosin-10 OS=Bos taurus G yes N/A 0.991 0.058 0.681 3e-38
Q9JLT0 1976 Myosin-10 OS=Rattus norve yes N/A 0.991 0.058 0.681 3e-38
Q61879 1976 Myosin-10 OS=Mus musculus yes N/A 0.991 0.058 0.681 3e-38
P35749 1972 Myosin-11 OS=Homo sapiens no N/A 0.913 0.053 0.707 6e-38
P35748 1972 Myosin-11 OS=Oryctolagus no N/A 0.913 0.053 0.707 6e-38
O08638 1972 Myosin-11 OS=Mus musculus no N/A 0.913 0.053 0.698 2e-37
P14105 1959 Myosin-9 OS=Gallus gallus no N/A 0.896 0.053 0.701 3e-37
P10587 1979 Myosin-11 OS=Gallus gallu no N/A 0.948 0.055 0.654 2e-36
>sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster GN=zip PE=1 SV=2 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 86/118 (72%), Positives = 98/118 (83%), Gaps = 3/118 (2%)

Query: 1   MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKR--LVWVPHENQGFVAAGIKGELGDS 58
           M+ ++D NDP++KYLSV+RN FN P      +  R  LVWVPHENQGFVAA IK E GD 
Sbjct: 46  MSEEVDRNDPELKYLSVERNQFN-PIRPRRPSGHRSVLVWVPHENQGFVAASIKREHGDE 104

Query: 59  VEVELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
           VEVEL ETGKR+++ +DDIQKMNPPKFDKVEDMA+LTCLNEASVLHNIKDRYYSGLIY
Sbjct: 105 VEVELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIY 162
Nonmuscle myosin appears to be responsible for cellularization. Required for morphogenesis and cytokinesis.
Drosophila melanogaster (taxid: 7227)
>sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 Back     alignment and function description
>sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus GN=MYH10 PE=2 SV=2 Back     alignment and function description
>sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus GN=Myh10 PE=1 SV=1 Back     alignment and function description
>sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus GN=Myh10 PE=1 SV=2 Back     alignment and function description
>sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 Back     alignment and function description
>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11 PE=2 SV=2 Back     alignment and function description
>sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 Back     alignment and function description
>sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 Back     alignment and function description
>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
261245147 992 IP15404p [Drosophila melanogaster] 1.0 0.116 0.827 3e-53
261824082 755 LD21871p [Drosophila melanogaster] 1.0 0.153 0.827 6e-53
90855661 271 IP15304p [Drosophila melanogaster] 1.0 0.428 0.827 1e-52
158285519 1974 AGAP007523-PA [Anopheles gambiae str. PE 1.0 0.058 0.863 1e-51
158285521 2003 AGAP007523-PB [Anopheles gambiae str. PE 1.0 0.057 0.863 1e-51
157118639 2001 myosin heavy chain, nonmuscle or smooth 1.0 0.057 0.863 1e-51
402534579 1425 LP03737p1 [Drosophila melanogaster] 1.0 0.081 0.827 1e-51
332019190146 Myosin heavy chain, non-muscle [Acromyrm 0.982 0.780 0.815 2e-51
195353352 1557 GM11766 [Drosophila sechellia] gi|194127 1.0 0.074 0.827 2e-51
322789317119 hypothetical protein SINV_02228 [Solenop 0.965 0.941 0.830 3e-51
>gi|261245147|gb|ACX54880.1| IP15404p [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  211 bits (538), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/116 (82%), Positives = 107/116 (92%)

Query: 1   MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVE 60
           M+ ++D NDP++KYLSV+RN FNDPATQAEWTQKRLVWVPHENQGFVAA IK E GD VE
Sbjct: 48  MSEEVDRNDPELKYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVE 107

Query: 61  VELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
           VEL ETGKR+++ +DDIQKMNPPKFDKVEDMA+LTCLNEASVLHNIKDRYYSGLIY
Sbjct: 108 VELAETGKRVMILRDDIQKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIY 163

Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|261824082|gb|ACX94162.1| LD21871p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|90855661|gb|ABE01192.1| IP15304p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|158285519|ref|XP_001687903.1| AGAP007523-PA [Anopheles gambiae str. PEST] gi|157020031|gb|EDO64552.1| AGAP007523-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158285521|ref|XP_308355.3| AGAP007523-PB [Anopheles gambiae str. PEST] gi|157020032|gb|EAA45415.3| AGAP007523-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157118639|ref|XP_001659191.1| myosin heavy chain, nonmuscle or smooth muscle [Aedes aegypti] gi|108883253|gb|EAT47478.1| AAEL001411-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|402534579|gb|AFQ62077.1| LP03737p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|332019190|gb|EGI59700.1| Myosin heavy chain, non-muscle [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195353352|ref|XP_002043169.1| GM11766 [Drosophila sechellia] gi|194127257|gb|EDW49300.1| GM11766 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|322789317|gb|EFZ14629.1| hypothetical protein SINV_02228 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
UNIPROTKB|E7ERA5188 MYH10 "Myosin-10" [Homo sapien 0.991 0.611 0.681 8.9e-38
UNIPROTKB|I3LER3132 LOC100620173 "Uncharacterized 0.913 0.803 0.698 3.9e-37
UNIPROTKB|P35580 1976 MYH10 "Myosin-10" [Homo sapien 0.991 0.058 0.681 3.8e-36
MGI|MGI:1930780 1976 Myh10 "myosin, heavy polypepti 0.991 0.058 0.681 3.8e-36
RGD|71000 1976 Myh10 "myosin, heavy chain 10, 0.991 0.058 0.681 3.8e-36
UNIPROTKB|G3V9Y1 1976 Myh10 "Myosin-10" [Rattus norv 0.991 0.058 0.681 3.8e-36
UNIPROTKB|F8W6L6 1992 MYH10 "Myosin-10" [Homo sapien 0.991 0.057 0.681 3.9e-36
UNIPROTKB|F1LMQ5 2009 Myh10 "Myosin-10" [Rattus norv 0.991 0.057 0.681 3.9e-36
UNIPROTKB|F1LQ02 2013 Myh10 "Myosin-10" [Rattus norv 0.991 0.057 0.681 3.9e-36
UNIPROTKB|F1PVV7 2046 MYH10 "Uncharacterized protein 0.991 0.056 0.681 4e-36
UNIPROTKB|E7ERA5 MYH10 "Myosin-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 8.9e-38, P = 8.9e-38
 Identities = 79/116 (68%), Positives = 89/116 (76%)

Query:     1 MATDLDPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVE 60
             MA      DP+ +YL VDR    +PATQA+WT K+LVW+P E  GF AA IK E GD V 
Sbjct:     1 MAQRTGLEDPE-RYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVM 59

Query:    61 VELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
             VEL E GK+ +V KDDIQKMNPPKF KVEDMA+LTCLNEASVLHN+KDRYYSGLIY
Sbjct:    60 VELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIY 115
GO:0003774 "motor activity" evidence=IEA
GO:0003779 "actin binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0000281 "cytokinesis after mitosis" evidence=IEA
GO:0001701 "in utero embryonic development" evidence=IEA
GO:0001725 "stress fiber" evidence=IEA
GO:0001764 "neuron migration" evidence=IEA
GO:0001778 "plasma membrane repair" evidence=IEA
GO:0005819 "spindle" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005938 "cell cortex" evidence=IEA
GO:0006887 "exocytosis" evidence=IEA
GO:0006930 "substrate-dependent cell migration, cell extension" evidence=IEA
GO:0007097 "nuclear migration" evidence=IEA
GO:0007411 "axon guidance" evidence=IEA
GO:0007512 "adult heart development" evidence=IEA
GO:0008283 "cell proliferation" evidence=IEA
GO:0008360 "regulation of cell shape" evidence=IEA
GO:0016460 "myosin II complex" evidence=IEA
GO:0021592 "fourth ventricle development" evidence=IEA
GO:0021670 "lateral ventricle development" evidence=IEA
GO:0021678 "third ventricle development" evidence=IEA
GO:0021680 "cerebellar Purkinje cell layer development" evidence=IEA
GO:0030424 "axon" evidence=IEA
GO:0030426 "growth cone" evidence=IEA
GO:0031594 "neuromuscular junction" evidence=IEA
GO:0043025 "neuronal cell body" evidence=IEA
GO:0043197 "dendritic spine" evidence=IEA
GO:0050885 "neuromuscular process controlling balance" evidence=IEA
GO:0055003 "cardiac myofibril assembly" evidence=IEA
GO:0055015 "ventricular cardiac muscle cell development" evidence=IEA
GO:0060041 "retina development in camera-type eye" evidence=IEA
UNIPROTKB|I3LER3 LOC100620173 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P35580 MYH10 "Myosin-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1930780 Myh10 "myosin, heavy polypeptide 10, non-muscle" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71000 Myh10 "myosin, heavy chain 10, non-muscle" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9Y1 Myh10 "Myosin-10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8W6L6 MYH10 "Myosin-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMQ5 Myh10 "Myosin-10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ02 Myh10 "Myosin-10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVV7 MYH10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35580MYH10_HUMANNo assigned EC number0.68100.99130.0581yesN/A
Q61879MYH10_MOUSENo assigned EC number0.68100.99130.0581yesN/A
Q27991MYH10_BOVINNo assigned EC number0.68100.99130.0581yesN/A
Q99323MYSN_DROMENo assigned EC number0.72880.99130.0559yesN/A
Q9JLT0MYH10_RATNo assigned EC number0.68100.99130.0581yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-21
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 1e-18
smart00242 677 smart00242, MYSc, Myosin 4e-14
pfam0273642 pfam02736, Myosin_N, Myosin N-terminal SH3-like do 1e-09
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 1e-09
cd00124 679 cd00124, MYSc, Myosin motor domain 1e-07
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 2e-05
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 3e-05
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-04
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 2e-04
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 3e-04
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 4e-04
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 0.001
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information 
 Score = 87.3 bits (217), Expect = 3e-21
 Identities = 29/35 (82%), Positives = 33/35 (94%)

Query: 82  PPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
           PPKFDKVEDMA+LT LNEASVLHN+++RYYS LIY
Sbjct: 1   PPKFDKVEDMAELTHLNEASVLHNLRERYYSDLIY 35

Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|111612 pfam02736, Myosin_N, Myosin N-terminal SH3-like domain Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG0161|consensus 1930 99.9
PTZ00014 821 myosin-A; Provisional 99.73
COG5022 1463 Myosin heavy chain [Cytoskeleton] 99.5
KOG0163|consensus 1259 99.32
PF0273642 Myosin_N: Myosin N-terminal SH3-like domain; Inter 99.13
KOG4229|consensus 1062 95.7
KOG0162|consensus 1106 95.66
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 94.34
smart0074361 Agenet Tudor-like domain present in plant sequence 92.73
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 92.58
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 91.55
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 87.4
PF1207352 DUF3553: Protein of unknown function (DUF3553); In 84.18
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 83.07
smart0029363 PWWP domain with conserved PWWP motif. conservatio 82.22
cd0583587 Dnmt3b_related The PWWP domain is an essential com 81.03
>KOG0161|consensus Back     alignment and domain information 
Probab=99.90  E-value=2.2e-24  Score=194.29  Aligned_cols=109  Identities=57%  Similarity=0.859  Sum_probs=99.1

Q ss_pred             CCCccccccccchhhccCcccccccccceeeeeeCCCCCeeeeEEeeecCCeEEEEEecCCcEEEEeCCCcccCCCCCcC
Q psy5412           7 PNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMNPPKFD   86 (116)
Q Consensus         7 ~~~~~~~~l~~~~~~~~~~~~~~~~~~g~~vWv~d~~~~~v~a~V~~~~~~~~~v~~~~~g~~~~v~~~~~~~~np~~~~   86 (116)
                      ..+++++||+.+++++... ++.+|+++.+|||||++++|+.|.|++..|++|+|...++|..+.|+.+++++||||+++
T Consensus         4 ~~~~~~~~lr~~~~~~~~~-~~~~~d~kk~vWvpd~~e~fv~~~i~~~~~~~v~v~~~~~~~~~~v~~~~v~~~NPPkfd   82 (1930)
T KOG0161|consen    4 EKDPGWKYLRVSREERLDA-QSRPFDSKKWVWVPDPKEGFVKAEIKSEEGEKVTVETEEGGTLTQVKEDDVQKMNPPKFD   82 (1930)
T ss_pred             cccccchhhcccHHHhhcc-cccchhhcceeeecCCCCCeeeeeeeccCCCceEEEEcCCceeEEecHHHcCcCCCCCcc
Confidence            4678899999999998764 569999999999999999999999999987778888644555555999999999999999


Q ss_pred             CccccccCCCCChHHHHHHHHHHhhcCCCC
Q psy5412          87 KVEDMADLTCLNEASVLHNIKDRYYSGLIY  116 (116)
Q Consensus        87 ~vdDl~~L~~LnEasIL~nLr~Ry~~~~IY  116 (116)
                      .++||++|+|||||||||||+.||.+++||
T Consensus        83 k~eDMa~LT~lNeasVL~nL~~RY~~~lIy  112 (1930)
T KOG0161|consen   83 KVEDMAELTFLNEASVLHNLKQRYASDLIY  112 (1930)
T ss_pred             ccccHHHhcccChHHHHhhHHHHHHhChHH
Confidence            999999999999999999999999999998

>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>PF02736 Myosin_N: Myosin N-terminal SH3-like domain; InterPro: IPR004009 This domain has an SH3-like fold Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>PF12073 DUF3553: Protein of unknown function (DUF3553); InterPro: IPR021938 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-39
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-39
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-39
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 2e-39
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 2e-39
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-38
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 2e-28
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 4e-27
1b7t_A 835 Myosin Digested By Papain Length = 835 5e-27
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 5e-27
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 2e-26
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 2e-26
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 1e-25
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 1e-25
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 4e-22
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 7e-16
2w4a_M 840 Isometrically Contracting Insect Asynchronous Fligh 7e-14
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 4e-12
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 4e-12
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-11
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-11
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-11
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-11
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 4e-11
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-11
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 4e-11
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 4e-11
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 4e-11
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 4e-11
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 4e-11
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 4e-11
2y9e_X 758 Structural Basis For The Allosteric Interference Of 4e-11
2y0r_X 758 Structural Basis For The Allosteric Interference Of 4e-11
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 5e-11
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 5e-11
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 5e-11
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 5e-11
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 5e-11
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 6e-11
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-10
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 2e-10
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-10
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-10
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 3e-06
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 7e-06
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 8e-06
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 8e-06
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 8e-06
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 8e-06
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 8e-06
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 8e-06
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 8e-06
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 8e-06
2x51_A 789 M6 Delta Insert1 Length = 789 8e-06
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 8e-06
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure 
Iteration: 1

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%)
Query: 7   PNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVET 66
           P   D K+L VD+N  N+P  QA+W+ K+LVWVP E  GF AA IK E GD V VEL E 
Sbjct: 4   PLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQEN 63
Query: 67  GKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
           GK++ + KDDIQKMNPPKF KVEDMA+LTCLNEASVLHN+++RY+SGLIY
Sbjct: 64  GKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIY 113
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|2W4A|M Chain M, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 840 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-42
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 2e-41
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-37
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 3e-36
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 5e-36
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 4e-35
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 5e-33
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-28
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 9e-28
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 7e-15
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score =  147 bits (372), Expect = 1e-42
 Identities = 72/111 (64%), Positives = 86/111 (77%)

Query: 6   DPNDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVE 65
            P   D K+L VD+N  N+P  QA+W+ K+LVWVP E  GF AA IK E GD V VEL E
Sbjct: 3   KPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQE 62

Query: 66  TGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
            GK++ + KDDIQKMNPPKF KVEDMA+LTCLNEASVLHN+++RY+SGLIY
Sbjct: 63  NGKKVTLSKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIY 113
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 99.93
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.92
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.91
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 99.89
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.89
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.84
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 99.83
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 99.77
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 99.77
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.73
3qii_A85 PHD finger protein 20; tudor domain, structural ge 95.56
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 94.84
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 93.32
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 93.23
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 92.71
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 92.66
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 90.44
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 90.09
2d9t_A78 Tudor domain-containing protein 3; structural geno 89.73
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 89.13
3s6w_A54 Tudor domain-containing protein 3; methylated argi 87.63
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 84.91
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 81.01
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
Probab=99.93  E-value=6.5e-27  Score=198.14  Aligned_cols=111  Identities=41%  Similarity=0.588  Sum_probs=103.0

Q ss_pred             CCCC--CCccccccccchhhccCcccccccccceeeeeeCCCCCeeeeEEeeecCCeEEEEEecCCcEEEEeCCCcccCC
Q psy5412           4 DLDP--NDPDMKYLSVDRNAFNDPATQAEWTQKRLVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMN   81 (116)
Q Consensus         4 ~~~~--~~~~~~~l~~~~~~~~~~~~~~~~~~g~~vWv~d~~~~~v~a~V~~~~~~~~~v~~~~~g~~~~v~~~~~~~~n   81 (116)
                      |+++  .+++++||+++++++.. .|+.+|+.|.+|||||++++|++|+|++..+++++|+. ++|++++++.+++.++|
T Consensus         3 ~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~~vWv~d~~~~~~~~~v~~~~~~~~~v~~-~~g~~~~v~~~~v~~~n   80 (783)
T 4db1_A            3 DSEMAVFGAAAPYLRKSEKERLE-AQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAET-EYGKTVTVKEDQVMQQN   80 (783)
T ss_dssp             TGGGGGGGGGGGGTCCCHHHHHH-HHHSCCCTTTEEEEECSSSSEEEEEEEEECSSEEEEEE-TTTEEEEEEGGGCEECC
T ss_pred             CcchhhcCchhhHhccCHHHHHH-hhccCCcCCCEEEEECCCCCEEEEEEEEecCCEEEEEE-CCCCEEeCCHHHcccCC
Confidence            4444  35688999999999864 68999999999999999999999999999999999984 89999999999999999


Q ss_pred             CCCcCCccccccCCCCChHHHHHHHHHHhhcCCCC
Q psy5412          82 PPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY  116 (116)
Q Consensus        82 p~~~~~vdDl~~L~~LnEasIL~nLr~Ry~~~~IY  116 (116)
                      |+.+++++||+.|++||||+|||||+.||.+++||
T Consensus        81 p~~~~~~eDl~~L~~LnE~svL~nL~~Ry~~~~IY  115 (783)
T 4db1_A           81 PPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIY  115 (783)
T ss_dssp             CGGGTTCSBGGGCSCCSHHHHHHHHHHHHHTTCCE
T ss_pred             CCccCCcchhhccccccHHHHHHHHHHHhcCCceE
Confidence            99999999999999999999999999999999998
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 116
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 1e-23
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 2e-21
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 1e-19
d1br2a146 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal 1e-18
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 9e-17
d1kk8a148 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal 3e-15
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 5e-15
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 9e-12
d2mysa146 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal 3e-11
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]

 Score = 92.1 bits (228), Expect = 1e-23
 Identities = 27/55 (49%), Positives = 41/55 (74%)

Query: 62  ELVETGKRIVVPKDDIQKMNPPKFDKVEDMADLTCLNEASVLHNIKDRYYSGLIY 116
           + +   ++ ++ +     MNPPKF+K+EDMA++T LNEASVL+N++ RY SGLIY
Sbjct: 11  QYLAVDRKKLMKEQTAAFMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIY 65
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 46 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 48 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 46 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1br2a146 Myosin S1 fragment, N-terminal domain {Chicken (Ga 99.36
d1kk8a148 Myosin S1 fragment, N-terminal domain {Bay scallop 99.26
d2mysa146 Myosin S1 fragment, N-terminal domain {Chicken (Ga 99.16
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.03
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 98.92
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 98.85
d1w7ja158 Myosin S1 fragment, N-terminal domain {Chicken (Ga 98.51
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 93.59
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 89.01
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 87.63
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 80.36
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 80.07
>d1br2a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Myosin S1 fragment, N-terminal domain
family: Myosin S1 fragment, N-terminal domain
domain: Myosin S1 fragment, N-terminal domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

Probab=99.36  E-value=4e-13  Score=75.22  Aligned_cols=46  Identities=65%  Similarity=1.011  Sum_probs=37.8

Q ss_pred             eeeeeCCCCCeeeeEEeeecCCeEEEEEecCCcEEEEeCCCcccCC
Q psy5412          36 LVWVPHENQGFVAAGIKGELGDSVEVELVETGKRIVVPKDDIQKMN   81 (116)
Q Consensus        36 ~vWv~d~~~~~v~a~V~~~~~~~~~v~~~~~g~~~~v~~~~~~~~n   81 (116)
                      .|||||++++|+.|.|++..|++++|++.++|++++++.+++++||
T Consensus         1 ~VWVPd~kegfv~a~Ik~~~Gd~vtV~~~~~Gk~~tvkkddvq~MN   46 (46)
T d1br2a1           1 LVWVPSEKHGFEAASIKEEKGDEVTVELQENGKKVTLSKDDIQKMN   46 (46)
T ss_dssp             CEEEECSSSSEEEEEC------CEEEEESSSCCEEEECSTTCEECC
T ss_pred             CEEeeCCcccEEEEEEEeccCCEEEEEEcCCCcEEEEcHHHcEecC
Confidence            4999999999999999999999999997789999999999999987
>d1kk8a1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysa1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure