Psyllid ID: psy5417

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MIRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN
ccccccccccccEEEEcccccHHHHHHHHcccccccEEEEcccccccccccccccEEHHHHHHHHHHHccccccccHHHHHHHccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccEEEEEEcccEEEEEEcccEEEEEEccccc
cccEEcccccHccccccccHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHcccccHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccEEEEEccEEEccccccccc
mirvcdktdeentygfetpsrsackhlYKCCVDHHSFFrlvqvssnpppdiisSRFRYQFFLQIKQDIlqgrlpvsFELSAELGAYVVQCKYKtlavtdeentygfetpsrsackhLYKCcvdhvacpmittyaygkihsrcTLGLSSMLWILASCLKKSLAelgdydprrhspgyvsefrftsHQSAALESRVAELHrdlsgqtpsqaelnyldrvknlplygvdlhpvlgedsieyflgltpAGIVVLRNKIKVASYLWKESN
mirvcdktdeentygfetpsrsacKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN
MIRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN
********************RSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDY********YV*********************************LNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLW****
MIRV***TDEENTYGFETPSRSACKHLYKCCVDHHSFF**************************************FELSAELGAYVVQCKYKTLAVTDEE*TY*******SACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKES*
*************YGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN
*IRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query265 2.2.26 [Sep-21-2011]
P52963 686 Band 4.1-like protein 4A yes N/A 0.377 0.145 0.58 3e-30
Q9HCS5 686 Band 4.1-like protein 4A yes N/A 0.377 0.145 0.58 3e-30
O57457 619 Band 4.1-like protein 4 O yes N/A 0.433 0.185 0.508 7e-30
Q5FVG2 731 Band 4.1-like protein 5 O yes N/A 0.362 0.131 0.48 6e-22
Q8BGS1 731 Band 4.1-like protein 5 O no N/A 0.362 0.131 0.48 6e-22
Q9MYU8 505 Band 4.1-like protein 5 O no N/A 0.362 0.190 0.48 9e-22
Q58CU2 502 Band 4.1-like protein 5 O no N/A 0.362 0.191 0.48 1e-21
Q9HCM4 733 Band 4.1-like protein 5 O no N/A 0.362 0.130 0.48 1e-21
Q9JMC8 527 Band 4.1-like protein 4B no N/A 0.403 0.203 0.427 1e-19
B2RYE5 527 Band 4.1-like protein 4B no N/A 0.403 0.203 0.427 1e-19
>sp|P52963|E41LA_MOUSE Band 4.1-like protein 4A OS=Mus musculus GN=Epb41l4a PE=2 SV=2 Back     alignment and function desciption
 Score =  132 bits (332), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%)

Query: 162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLP 221
           AELGD+DP +H+ GYVSE+RF   Q   LE  +  +H+ L GQ PS+AELNYL   K+L 
Sbjct: 145 AELGDHDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQAPSEAELNYLRTAKSLE 204

Query: 222 LYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLW 261
           +YGVDLHPV GE+  EYFLGLTP+G+VV +NK +V  Y W
Sbjct: 205 MYGVDLHPVYGENKSEYFLGLTPSGVVVYKNKKQVGKYFW 244

Mus musculus (taxid: 10090)
>sp|Q9HCS5|E41LA_HUMAN Band 4.1-like protein 4A OS=Homo sapiens GN=EPB41L4A PE=1 SV=2 Back     alignment and function description
>sp|O57457|E41L4_DANRE Band 4.1-like protein 4 OS=Danio rerio GN=epb4.1l4 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVG2|E41L5_RAT Band 4.1-like protein 5 OS=Rattus norvegicus GN=Epb41l5 PE=2 SV=2 Back     alignment and function description
>sp|Q8BGS1|E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus GN=Epb41l5 PE=1 SV=1 Back     alignment and function description
>sp|Q9MYU8|E41L5_CANFA Band 4.1-like protein 5 OS=Canis familiaris GN=EPB41L5 PE=2 SV=1 Back     alignment and function description
>sp|Q58CU2|E41L5_BOVIN Band 4.1-like protein 5 OS=Bos taurus GN=EPB41L5 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCM4|E41L5_HUMAN Band 4.1-like protein 5 OS=Homo sapiens GN=EPB41L5 PE=1 SV=3 Back     alignment and function description
>sp|Q9JMC8|E41LB_MOUSE Band 4.1-like protein 4B OS=Mus musculus GN=Epb41l4b PE=2 SV=2 Back     alignment and function description
>sp|B2RYE5|E41LB_RAT Band 4.1-like protein 4B OS=Rattus norvegicus GN=Epb41l4b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
307192534 1624 Coiled-coil domain-containing protein 13 0.384 0.062 0.682 6e-38
322785550 585 hypothetical protein SINV_14833 [Solenop 0.384 0.174 0.692 9e-38
332017847 635 Band 4.1-like protein 4A [Acromyrmex ech 0.384 0.160 0.692 1e-37
307169937 634 Band 4.1-like protein 4A [Camponotus flo 0.384 0.160 0.692 1e-37
380027966 727 PREDICTED: band 4.1-like protein 4A-like 0.384 0.140 0.692 7e-37
328778071 727 PREDICTED: band 4.1-like protein 4A-like 0.384 0.140 0.692 7e-37
195055007 1357 GH16444 [Drosophila grimshawi] gi|193892 0.343 0.067 0.74 8e-37
383852336 726 PREDICTED: band 4.1-like protein 4A-like 0.384 0.140 0.692 8e-37
391338828 884 PREDICTED: band 4.1-like protein 4A-like 0.456 0.136 0.588 1e-36
350421356 731 PREDICTED: band 4.1-like protein 4A-like 0.384 0.139 0.692 1e-36
>gi|307192534|gb|EFN75722.1| Coiled-coil domain-containing protein 132 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 88/104 (84%)

Query: 162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLP 221
           +ELGDYDPRRHSPGYV+EFRF ++Q+  LE+R+ E+H+ L GQ PS AELNYLD+VK L 
Sbjct: 153 SELGDYDPRRHSPGYVTEFRFLANQTTELENRIVEIHKTLIGQLPSAAELNYLDKVKWLE 212

Query: 222 LYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKESN 265
           +YGVDLHPVLGED++EYFLGLTP+GI++LRNK KV +Y W   N
Sbjct: 213 MYGVDLHPVLGEDNVEYFLGLTPSGIILLRNKTKVGNYYWPRIN 256

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322785550|gb|EFZ12212.1| hypothetical protein SINV_14833 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332017847|gb|EGI58507.1| Band 4.1-like protein 4A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307169937|gb|EFN62446.1| Band 4.1-like protein 4A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380027966|ref|XP_003697683.1| PREDICTED: band 4.1-like protein 4A-like [Apis florea] Back     alignment and taxonomy information
>gi|328778071|ref|XP_394927.3| PREDICTED: band 4.1-like protein 4A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|195055007|ref|XP_001994414.1| GH16444 [Drosophila grimshawi] gi|193892177|gb|EDV91043.1| GH16444 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|383852336|ref|XP_003701684.1| PREDICTED: band 4.1-like protein 4A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|391338828|ref|XP_003743757.1| PREDICTED: band 4.1-like protein 4A-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|350421356|ref|XP_003492816.1| PREDICTED: band 4.1-like protein 4A-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
FB|FBgn0085376 1517 CG34347 [Drosophila melanogast 0.377 0.065 0.72 4.1e-47
UNIPROTKB|F1PNX3 665 EPB41L4A "Uncharacterized prot 0.377 0.150 0.6 7.9e-42
UNIPROTKB|F1RLG2 482 EPB41L4A "Uncharacterized prot 0.377 0.207 0.58 2.1e-40
UNIPROTKB|Q9HCS5 686 EPB41L4A "Band 4.1-like protei 0.377 0.145 0.58 2.4e-40
UNIPROTKB|F1NKS0 677 EPB41L4A "Uncharacterized prot 0.377 0.147 0.56 3.9e-40
MGI|MGI:103007 686 Epb4.1l4a "erythrocyte protein 0.377 0.145 0.58 3.9e-40
ZFIN|ZDB-GENE-990415-20 619 epb4.1l4 "erythrocyte protein 0.433 0.185 0.508 4.8e-40
UNIPROTKB|F6QDP6 651 EPB41L4A "Uncharacterized prot 0.377 0.153 0.59 9e-40
RGD|1306034 620 Epb41l4a "erythrocyte membrane 0.377 0.161 0.58 8.2e-39
ZFIN|ZDB-GENE-090312-61 877 si:dkey-178k16.1 "si:dkey-178k 0.377 0.114 0.44 2.9e-30
FB|FBgn0085376 CG34347 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 377 (137.8 bits), Expect = 4.1e-47, Sum P(2) = 4.1e-47
 Identities = 72/100 (72%), Positives = 82/100 (82%)

Query:   162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLP 221
             +ELGDYD RRHS GYVSEFR   +QS  LE+RV+ELH+ L G +PS AELNYLD+VK   
Sbjct:   138 SELGDYDQRRHSKGYVSEFRLLPNQSNELETRVSELHQQLKGMSPSSAELNYLDKVKWHD 197

Query:   222 LYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLW 261
             +YGVDLHPVLGEDS+EYFLGLTP+GIVVLRNK  VA Y W
Sbjct:   198 MYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNKTTVAHYYW 237
GO:0003779 "actin binding" evidence=ISS
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0005856 "cytoskeleton" evidence=IEA
UNIPROTKB|F1PNX3 EPB41L4A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLG2 EPB41L4A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HCS5 EPB41L4A "Band 4.1-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKS0 EPB41L4A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:103007 Epb4.1l4a "erythrocyte protein band 4.1-like 4a" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-20 epb4.1l4 "erythrocyte protein band 4.1-like 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6QDP6 EPB41L4A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306034 Epb41l4a "erythrocyte membrane protein band 4.1 like 4A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-61 si:dkey-178k16.1 "si:dkey-178k16.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O57457E41L4_DANRENo assigned EC number0.50830.43390.1857yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
cd13186111 cd13186, FERM_C_NBL4_NBL5, Novel band 4 1e-29
cd13184113 cd13184, FERM_C_4_1_family, Protein 4 4e-16
pfam00373113 pfam00373, FERM_M, FERM central domain 1e-15
cd13186111 cd13186, FERM_C_NBL4_NBL5, Novel band 4 4e-14
cd13189123 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine 5e-14
smart00295201 smart00295, B41, Band 4 2e-10
cd13192105 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin 2e-09
cd13189123 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine 5e-09
pfam0938090 pfam09380, FERM_C, FERM C-terminal PH-like domain 7e-09
pfam00373113 pfam00373, FERM_M, FERM central domain 9e-09
cd13186111 cd13186, FERM_C_NBL4_NBL5, Novel band 4 5e-08
cd13184113 cd13184, FERM_C_4_1_family, Protein 4 1e-07
smart00295201 smart00295, B41, Band 4 1e-06
cd13192105 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin 2e-06
cd13193122 cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleck 2e-06
cd0083691 cd00836, FERM_C-lobe, FERM domain C-lobe 3e-04
cd13192105 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin 5e-04
cd13189123 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine 0.002
pfam0938090 pfam09380, FERM_C, FERM C-terminal PH-like domain 0.002
cd13187124 cd13187, FERM_C_PTPH13, Protein tyrosine phosphata 0.002
>gnl|CDD|241340 cd13186, FERM_C_NBL4_NBL5, Novel band 4 Back     alignment and domain information 
 Score =  107 bits (269), Expect = 1e-29
 Identities = 36/57 (63%), Positives = 44/57 (77%)

Query: 205 TPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLW 261
           TP++AELNYL++ K L +YGVDLHPV GED  EYFLGLTP GI+V  NK K+  + W
Sbjct: 1   TPAEAELNYLNKAKWLEMYGVDLHPVKGEDGNEYFLGLTPTGILVYENKTKIGLFFW 57

1-like protein 4 and 5 FERM (NBL4 and 5) domain C-lobe. NBL4 (also called Erythrocyte protein band 4.1-like 4; Epb4 1l4) plays a role the beta-catenin/Tcf signaling pathway and is thought to be involved in establishing the cell polarity or proliferation. NBL4 may be also involved in adhesion, in cell motility and/or in cell-to-cell communication. No role for NBL5 has been proposed to date. Both NBL4 and NBL5 contain a N-terminal FERM domain which has a cloverleaf tripart structure (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe, B-lobe, C-lobe/F1, F2, F3). A single FERM_C repeat 2 from Tetraodon nigroviridis also included in this cdThe C-lobe is a member of the PH superfamily. The FERM domain is found in the cytoskeletal-associated proteins such as ezrin, moesin, radixin, 4.1R, and merlin. These proteins provide a link between the membrane and cytoskeleton and are involved in signal transduction pathways. The FERM domain is also found in protein tyrosine phosphatases (PTPs) , the tyrosine kinases FAK and JAK, in addition to other proteins involved in signaling. This domain is structurally similar to the PH and PTB domains and consequently is capable of binding to both peptides and phospholipids at different sites. Length = 111
>gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 Back     alignment and domain information
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information
>gnl|CDD|241340 cd13186, FERM_C_NBL4_NBL5, Novel band 4 Back     alignment and domain information
>gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information
>gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe Back     alignment and domain information
>gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain Back     alignment and domain information
>gnl|CDD|215882 pfam00373, FERM_M, FERM central domain Back     alignment and domain information
>gnl|CDD|241340 cd13186, FERM_C_NBL4_NBL5, Novel band 4 Back     alignment and domain information
>gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 Back     alignment and domain information
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information
>gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe Back     alignment and domain information
>gnl|CDD|241347 cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins FERM domain Back     alignment and domain information
>gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe Back     alignment and domain information
>gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe Back     alignment and domain information
>gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain Back     alignment and domain information
>gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 265
KOG3530|consensus 616 100.0
KOG3527|consensus 975 100.0
KOG0792|consensus 1144 100.0
KOG3529|consensus 596 99.96
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 99.9
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 99.89
KOG3531|consensus 1036 99.84
KOG4371|consensus 1332 99.6
KOG4261|consensus 1003 99.53
KOG0248|consensus936 99.21
cd0083692 FERM_C FERM_C domain. The FERM_C domain is the thi 99.09
KOG4371|consensus 1332 99.08
KOG3552|consensus 1298 98.59
PF0938090 FERM_C: FERM C-terminal PH-like domain; InterPro: 98.08
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 97.99
KOG4257|consensus 974 97.56
KOG3531|consensus 1036 97.48
KOG3727|consensus664 96.6
KOG3527|consensus 975 96.48
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 96.25
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 95.62
PTZ0045890 acyl CoA binding protein; Provisional 93.58
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 93.33
KOG3784|consensus407 88.63
KOG0817|consensus142 83.03
>KOG3530|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-50  Score=394.58  Aligned_cols=187  Identities=45%  Similarity=0.782  Sum_probs=182.1

Q ss_pred             eeEeeCCCCCCcccccCCCccccccccccCCCceeeEEeeeccCCCCCCccchhhHHHHHHHHHHHHhcCCccCCHHHHH
Q psy5417           2 IRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSA   81 (265)
Q Consensus         2 l~y~d~~~~e~~~~wl~~~~~l~kq~~k~~~~~~~l~frVkfy~~~p~~l~~~~tR~l~ylQ~r~dil~grlp~~~e~a~   81 (265)
                      |||+|..+   ..+||||.|+|.||++-  ++|++|+||||||+.+|..|+++.|||+||||+|+||++|||+|+.+.|+
T Consensus        54 Lry~D~~~---~~hWLD~tK~I~kqvK~--gppytL~~rVKfY~sdP~~Lree~tRYqfflQlKqDll~GRL~Cp~~~Aa  128 (616)
T KOG3530|consen   54 LRYQDSSK---VRHWLDPTKSIKKQVKI--GPPYTLHLRVKFYPSDPNNLREENTRYQFFLQLKQDLLSGRLYCPFETAA  128 (616)
T ss_pred             eeeechhh---cceecCcchhHHHHhcc--CCCeEEEEEEEeccCChhhhhchhhHHHHHHHHHHHHhcCCCCCchhhHH
Confidence            89999996   77899999999999975  78999999999999999999999999999999999999999999999999


Q ss_pred             HHhHHHhhhhcccccccccccccccCCCCccccccccccccCCccccceeeccccccccccccccchhHHHHHhhhcccc
Q psy5417          82 ELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSL  161 (265)
Q Consensus        82 ~Laal~~Qae~Gd~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~  161 (265)
                      +||||++|                                                                        
T Consensus       129 eLaAl~lQ------------------------------------------------------------------------  136 (616)
T KOG3530|consen  129 ELAALILQ------------------------------------------------------------------------  136 (616)
T ss_pred             HHHHHHHH------------------------------------------------------------------------
Confidence            99999999                                                                        


Q ss_pred             cccCCCCCCCCCCCCccccccCccchHHHHHHHHHHHHhhcCCCHHHHHHHHHHHhccCCCCCceeeeeecCCCCEEEEE
Q psy5417         162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLG  241 (265)
Q Consensus       162 ~~~gd~~~~~h~~~yl~~~~~~p~~~~~l~~~I~e~h~~l~G~t~~~A~~~yL~~~~~l~~YG~~~f~v~~~~~~~~~lG  241 (265)
                      +++|||++..|..+|+++++|+|.|++++|.+|.+.|++++|++|++||++||+.|+.|++|||++|+|++++|+++.||
T Consensus       137 sELGDYn~~~Ht~~yVSefRf~p~Qte~LE~~I~e~hK~~rGqspaqAElnyLnkAkwLemYGVDmH~V~g~dg~ey~LG  216 (616)
T KOG3530|consen  137 SELGDYNEEEHTGGYVSEFRFLPNQTEELEERIFELHKELRGQSPAQAELNYLNKAKWLEMYGVDMHPVKGHDGSEYYLG  216 (616)
T ss_pred             HHhcCCChhhccccceeeeEecccccHHHHHHHHHHHHHhcCCCHHHHHHHHHhhhhhhhhccccceeeecCCCceeEee
Confidence            67889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCceEEeeCCceeeeeecCCCC
Q psy5417         242 LTPAGIVVLRNKIKVASYLWKESN  265 (265)
Q Consensus       242 V~~~GI~v~~~~~~~~~f~W~~i~  265 (265)
                      ++|.||.||+++.++..|.|++|+
T Consensus       217 LTptGIlvf~g~~kig~f~WpkI~  240 (616)
T KOG3530|consen  217 LTPTGILVFEGKKKIGLFFWPKIT  240 (616)
T ss_pred             ccCceEEEEECCceeeEEecchhe
Confidence            999999999999999999999985

>KOG3527|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG4261|consensus Back     alignment and domain information
>KOG0248|consensus Back     alignment and domain information
>cd00836 FERM_C FERM_C domain Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3727|consensus Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>KOG0817|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
2he7_A283 Ferm Domain Of Epb41l3 (Dal-1) Length = 283 2e-20
3bin_A283 Structure Of The Dal-1 And Tslc1 (372-383) Complex 2e-20
3qij_A296 Primitive-Monoclinic Crystal Structure Of The Ferm 9e-20
1gg3_A279 Crystal Structure Of The Protein 4.1r Membrane Bind 1e-19
2rq1_A109 Solution Structure Of The 4.1r Ferm Alpha Lobe Doma 2e-10
1h4r_B314 Crystal Structure Of The Ferm Domain Of Merlin, The 2e-05
1h4r_A314 Crystal Structure Of The Ferm Domain Of Merlin, The 2e-05
1isn_A323 Crystal Structure Of Merlin Ferm Domain Length = 32 3e-05
3u8z_A300 Human Merlin Ferm Domain Length = 300 3e-05
1gc6_A297 Crystal Structure Of The Radixin Ferm Domain Comple 7e-05
2d10_A312 Crystal Structure Of The Radixin Ferm Domain Comple 7e-05
2d2q_A310 Crystal Structure Of The Dimerized Radixin Ferm Dom 7e-05
2emt_A322 Crystal Structure Analysis Of The Radixin Ferm Doma 8e-05
1j19_A317 Crystal Structure Of The Radxin Ferm Domain Complex 8e-05
2zpy_A312 Crystal Structure Of The Mouse Radxin Ferm Domain C 8e-05
1ni2_A296 Structure Of The Active Ferm Domain Of Ezrin Length 5e-04
>pdb|2HE7|A Chain A, Ferm Domain Of Epb41l3 (Dal-1) Length = 283 Back     alignment and structure 
Iteration: 1

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 65/100 (65%)
Query: 162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLP 221
           +ELGDYDP      Y+SEFRF  + +  LE +V ELH+   G TP++AE+++L+  K L 
Sbjct: 128 SELGDYDPDECGSDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLS 187
Query: 222 LYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLW 261
           +YGVDLH     + +E  LG+  +G+++ R+++++  + W
Sbjct: 188 MYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAW 227
>pdb|3BIN|A Chain A, Structure Of The Dal-1 And Tslc1 (372-383) Complex Length = 283 Back     alignment and structure
>pdb|3QIJ|A Chain A, Primitive-Monoclinic Crystal Structure Of The Ferm Domain Of Protein 4.1r Length = 296 Back     alignment and structure
>pdb|1GG3|A Chain A, Crystal Structure Of The Protein 4.1r Membrane Binding Domain Length = 279 Back     alignment and structure
>pdb|2RQ1|A Chain A, Solution Structure Of The 4.1r Ferm Alpha Lobe Domain Length = 109 Back     alignment and structure
>pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 Back     alignment and structure
>pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 Back     alignment and structure
>pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 Back     alignment and structure
>pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 Back     alignment and structure
>pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 Back     alignment and structure
>pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 Back     alignment and structure
>pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 Back     alignment and structure
>pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 Back     alignment and structure
>pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 8e-27
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 6e-09
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 7e-09
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 4e-04
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 8e-26
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 7e-10
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 4e-25
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 9e-14
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 6e-25
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 1e-10
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 4e-24
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 8e-11
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 3e-23
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 1e-10
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 8e-09
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 8e-04
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 1e-20
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 3e-11
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 8e-08
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 2e-15
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 1e-13
3au4_A555 Myosin-X; protein-protein complex, motor protein c 2e-14
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 1e-04
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 3e-04
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
 Score =  104 bits (261), Expect = 8e-27
 Identities = 42/117 (35%), Positives = 70/117 (59%), Gaps = 2/117 (1%)

Query: 147 SSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTP 206
            + L +L S      +ELGDYDP  H   YVS+F+   +Q+  LE +V ELH+     TP
Sbjct: 130 FATLALLGSYT--IQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTP 187

Query: 207 SQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLGLTPAGIVVLRNKIKVASYLWKE 263
           +QA+L +L+  K L +YGVDLH     + ++  LG+  +G++V ++K+++  + W +
Sbjct: 188 AQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPK 244
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 100.0
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 100.0
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 100.0
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 100.0
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 100.0
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 100.0
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 99.97
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 99.97
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 99.97
3au4_A555 Myosin-X; protein-protein complex, motor protein c 99.96
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 99.95
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 99.93
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.89
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 95.79
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 95.72
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 95.56
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 95.49
2lbb_A96 Acyl COA binding protein; protein binding, structu 95.11
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 94.88
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 94.08
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 94.07
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 94.04
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 93.39
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
Probab=100.00  E-value=4e-44  Score=328.65  Aligned_cols=186  Identities=32%  Similarity=0.607  Sum_probs=169.4

Q ss_pred             eeEeeCCCCCCcccccCCCccccccccccCCCceeeEEeeeccCCCCCCccchhhHHHHHHHHHHHHhcCCccCCHHHHH
Q psy5417           2 IRVCDKTDEENTYGFETPSRSACKHLYKCCVDHHSFFRLVQVSSNPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSA   81 (265)
Q Consensus         2 l~y~d~~~~e~~~~wl~~~~~l~kq~~k~~~~~~~l~frVkfy~~~p~~l~~~~tR~l~ylQ~r~dil~grlp~~~e~a~   81 (265)
                      |.|.|.++   +.+||++++++++|+.   ..++.|+|||||||++|..+.++.+|+++|+|+|+||++|++||+.++|+
T Consensus        61 L~~~~~~~---~~~wLd~~k~i~~q~~---~~~~~l~frvkfy~~~~~~l~~~~tr~l~ylQ~~~dil~G~~~c~~e~a~  134 (296)
T 3qij_A           61 LAIWDNAT---SKTWLDSAKEIKKQVR---GVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLA  134 (296)
T ss_dssp             EEEEEETT---EEEECCTTSBHHHHC------CCEEEEEESSCCSCGGGSSCHHHHHHHHHHHHHHHHHTSSCCCHHHHH
T ss_pred             EEEEcCCC---ccchhccchhHHHhcC---CCCcEEEEEEEEeCCCchhccCHHHHHHHHHHHHHHHHcCCCCCCHHHHH
Confidence            56777654   7899999999999975   46899999999999999999999999999999999999999999999999


Q ss_pred             HHhHHHhhhhcccccccccccccccCCCCccccccccccccCCccccceeeccccccccccccccchhHHHHHhhhcccc
Q psy5417          82 ELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHVACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSL  161 (265)
Q Consensus        82 ~Laal~~Qae~Gd~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~  161 (265)
                      +||||++||++|                                                                    
T Consensus       135 ~LAAl~~Qae~G--------------------------------------------------------------------  146 (296)
T 3qij_A          135 LLGSYTIQSELG--------------------------------------------------------------------  146 (296)
T ss_dssp             HHHHHHHHHHHC--------------------------------------------------------------------
T ss_pred             HHHHHHHHHhcC--------------------------------------------------------------------
Confidence            999999996655                                                                    


Q ss_pred             cccCCCCCCCCCCCCccccccCccchHHHHHHHHHHHHhhcCCCHHHHHHHHHHHhccCCCCCceeeeeecCCCCEEEEE
Q psy5417         162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLPLYGVDLHPVLGEDSIEYFLG  241 (265)
Q Consensus       162 ~~~gd~~~~~h~~~yl~~~~~~p~~~~~l~~~I~e~h~~l~G~t~~~A~~~yL~~~~~l~~YG~~~f~v~~~~~~~~~lG  241 (265)
                          ||++..|..+|+....++|.+.++|+++|.+.|+++.|||+.+|+.+||+.|++||+||+++|.|+++.|.++|||
T Consensus       147 ----d~~~~~~~~~yl~~~~~~P~~~~~~~~~I~~~h~~~~g~s~~eA~~~yL~~a~~l~~yG~~~f~vk~~~~~~~~Lg  222 (296)
T 3qij_A          147 ----DYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILG  222 (296)
T ss_dssp             ----SCCHHHHTTCCCTTSCCSSSCCHHHHHHHHHHHHTCCSCCHHHHHHHHHHHHTTSTTTTCEEEEEECTTSCEEEEE
T ss_pred             ----CCCccccchhhCcHhhcCCcCHHHHHHHHHHHHHHccCCCHHHHHHHHHHHHhcccccCceEEEEEcCCCCEEEEE
Confidence                4554445667888888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCceEEeeCCceeeeeecCCCC
Q psy5417         242 LTPAGIVVLRNKIKVASYLWKESN  265 (265)
Q Consensus       242 V~~~GI~v~~~~~~~~~f~W~~i~  265 (265)
                      |+++||.||+++.++..|+|++|.
T Consensus       223 V~~~Gi~v~~~~~kl~~f~w~~I~  246 (296)
T 3qij_A          223 VCSSGLLVYKDKLRINRFPWPKVL  246 (296)
T ss_dssp             ECSSEEEEEETTEEEEEEEGGGEE
T ss_pred             ECCCeEEEEeCCCeEEEEEhhhcC
Confidence            999999999999999999999873
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 265
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 5e-15
d1gg3a1106 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 7e-09
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 2e-13
d1mixa1114 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus 8e-09
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 2e-12
d1h4ra1111 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) 9e-12
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 2e-12
d1ef1a1111 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ 3e-11
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 2e-10
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 6e-09
d1gg3a292 b.55.1.5 (A:188-279) Erythroid membrane protein 4. 6e-05
d1h4ra299 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) 7e-09
d1h4ra299 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) 4e-07
d1h4ra299 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) 1e-04
d1ef1a299 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) 2e-08
d1ef1a299 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) 2e-07
d1ef1a299 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) 7e-05
d2al6a1123 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic 2e-06
d2al6a1123 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic 3e-04
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Second domain of FERM
family: Second domain of FERM
domain: Erythroid membrane protein 4.1R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 67.2 bits (164), Expect = 5e-15
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 162 AELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQTPSQAELNYLDRVKNLP 221
           +ELGDYDP  H   YVS+F+   +Q+  LE +V ELH+     TP+QA+L +L+  K L 
Sbjct: 45  SELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLS 104

Query: 222 LY 223
           +Y
Sbjct: 105 MY 106
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 99.96
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 99.94
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 99.79
d1h4ra299 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1ef1a299 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1gg3a292 Erythroid membrane protein 4.1R {Human (Homo sapie 98.92
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 98.59
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 96.56
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 95.13
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 94.55
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Second domain of FERM
family: Second domain of FERM
domain: Erythroid membrane protein 4.1R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=3e-29  Score=196.35  Aligned_cols=106  Identities=44%  Similarity=0.806  Sum_probs=99.9

Q ss_pred             CCCCCccchhhHHHHHHHHHHHHhcCCccCCHHHHHHHhHHHhhhhcccccccccccccccCCCCccccccccccccCCc
Q psy5417          46 NPPPDIISSRFRYQFFLQIKQDILQGRLPVSFELSAELGAYVVQCKYKTLAVTDEENTYGFETPSRSACKHLYKCCVDHV  125 (265)
Q Consensus        46 ~~p~~l~~~~tR~l~ylQ~r~dil~grlp~~~e~a~~Laal~~Qae~Gd~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~  125 (265)
                      |||..|.++.|||+||+|+|+||++|++||+.++|+.||||++||                                   
T Consensus         1 pdp~~L~~e~Tr~l~ylQlr~~i~~G~~~~~~~~a~~Laal~~Qa-----------------------------------   45 (106)
T d1gg3a1           1 PDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQS-----------------------------------   45 (106)
T ss_dssp             SSGGGSSCHHHHHHHHHHHHHHHHTTSSCCCHHHHHHHHHHHHHH-----------------------------------
T ss_pred             CCHHHhccHHHHHHHHHHHHHHHHhcccCCCHHHHHHHHHHHHHH-----------------------------------
Confidence            479999999999999999999999999999999999999999995                                   


Q ss_pred             cccceeeccccccccccccccchhHHHHHhhhcccccccCCCCCCCCCCCCccccccCccchHHHHHHHHHHHHhhcCCC
Q psy5417         126 ACPMITTYAYGKIHSRCTLGLSSMLWILASCLKKSLAELGDYDPRRHSPGYVSEFRFTSHQSAALESRVAELHRDLSGQT  205 (265)
Q Consensus       126 ~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~gd~~~~~h~~~yl~~~~~~p~~~~~l~~~I~e~h~~l~G~t  205 (265)
                                                           ++|||++..|..+|+....++|.+.++|+++|.+.|++++|||
T Consensus        46 -------------------------------------e~GD~~~~~~~~~yl~~~~~~p~~~~~~~~~I~~~h~~l~G~s   88 (106)
T d1gg3a1          46 -------------------------------------ELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMT   88 (106)
T ss_dssp             -------------------------------------HHCSCCTTSCSSCCGGGSCCCSSCCHHHHHHHHHHHHHCCSCC
T ss_pred             -------------------------------------HhCCCCccccchhhhhHHhcCCccHHHHHHHHHHHHHHccCcC
Confidence                                                 5566777778888999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCCCC
Q psy5417         206 PSQAELNYLDRVKNLPLY  223 (265)
Q Consensus       206 ~~~A~~~yL~~~~~l~~Y  223 (265)
                      +++|+..||++|++||+|
T Consensus        89 ~~~A~~~fL~~~~~l~~Y  106 (106)
T d1gg3a1          89 PAQADLEFLENAKKLSMY  106 (106)
T ss_dssp             HHHHHHHHHHHHHHSTTT
T ss_pred             HHHHHHHHHHHHhcCCCC
Confidence            999999999999999998
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure