Psyllid ID: psy5547
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 714 | 2.2.26 [Sep-21-2011] | |||||||
| Q9U639 | 652 | Heat shock 70 kDa protein | N/A | N/A | 0.450 | 0.493 | 0.893 | 1e-165 | |
| Q9W6Y1 | 686 | Heat shock cognate 71 kDa | N/A | N/A | 0.408 | 0.425 | 0.919 | 1e-158 | |
| P08108 | 651 | Heat shock cognate 70 kDa | N/A | N/A | 0.408 | 0.448 | 0.905 | 1e-157 | |
| Q71U34 | 646 | Heat shock cognate 71 kDa | N/A | N/A | 0.408 | 0.452 | 0.905 | 1e-157 | |
| P11142 | 646 | Heat shock cognate 71 kDa | yes | N/A | 0.408 | 0.452 | 0.905 | 1e-157 | |
| A2Q0Z1 | 646 | Heat shock cognate 71 kDa | yes | N/A | 0.408 | 0.452 | 0.905 | 1e-157 | |
| P19120 | 650 | Heat shock cognate 71 kDa | yes | N/A | 0.408 | 0.449 | 0.905 | 1e-157 | |
| P63018 | 646 | Heat shock cognate 71 kDa | yes | N/A | 0.408 | 0.452 | 0.905 | 1e-157 | |
| P63017 | 646 | Heat shock cognate 71 kDa | yes | N/A | 0.408 | 0.452 | 0.905 | 1e-157 | |
| P11147 | 651 | Heat shock 70 kDa protein | yes | N/A | 0.408 | 0.448 | 0.912 | 1e-157 |
| >sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 582 bits (1499), Expect = e-165, Method: Compositional matrix adjust.
Identities = 294/329 (89%), Positives = 300/329 (91%), Gaps = 7/329 (2%)
Query: 305 GGFPGAPGAAPGAGAGPGPTIEEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQR 364
GG P A G P EEVSSMVLTKMKETAEAYLGKTV NAVITVPAYFNDSQR
Sbjct: 98 GGKPKIKVAYKGEDKTFFP--EEVSSMVLTKMKETAEAYLGKTVQNAVITVPAYFNDSQR 155
Query: 365 QATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSIL 424
QATKD+GTI+GLNVLRIINEPTAAAIAYGLDKK GSGERNVLIFDLGGGTFDVSIL
Sbjct: 156 QATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-----GSGERNVLIFDLGGGTFDVSIL 210
Query: 425 TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERA 484
TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERA
Sbjct: 211 TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERA 270
Query: 485 KRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQ 544
KRTLSSSTQASIEIDSLFEG+DFYTS+TRARFEELNADLFR TMEPVEKSLRDAKMDK+Q
Sbjct: 271 KRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMDKSQ 330
Query: 545 IHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQD 604
IHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQD
Sbjct: 331 IHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQD 390
Query: 605 LLLLDVTPLSLGIETAGGFELTSIPPATS 633
LLLLDVTPLSLGIETAGG T I T+
Sbjct: 391 LLLLDVTPLSLGIETAGGVMTTLIKRNTT 419
|
Manduca sexta (taxid: 7130) |
| >sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 714 | ||||||
| 322779002 | 644 | hypothetical protein SINV_04536 [Solenop | 0.459 | 0.509 | 0.869 | 1e-168 | |
| 292606983 | 654 | heat shock cognate protein 70 [Nilaparva | 0.429 | 0.469 | 0.925 | 1e-166 | |
| 12585261 | 652 | RecName: Full=Heat shock 70 kDa protein | 0.450 | 0.493 | 0.893 | 1e-163 | |
| 112982828 | 649 | heat shock cognate protein [Bombyx mori] | 0.450 | 0.496 | 0.890 | 1e-163 | |
| 211908975 | 347 | cognate 70 kDa heat shock protein, parti | 0.420 | 0.864 | 0.93 | 1e-163 | |
| 124100014 | 653 | heat shock protein 70 [Dendrolimus super | 0.450 | 0.493 | 0.893 | 1e-162 | |
| 242003741 | 660 | Heat shock 70 kDa protein cognate, putat | 0.427 | 0.462 | 0.935 | 1e-162 | |
| 378760814 | 650 | Hsc70 [Plutella xylostella] | 0.450 | 0.495 | 0.893 | 1e-162 | |
| 124108394 | 653 | heat shock protein 70 [Dendrolimus punct | 0.450 | 0.493 | 0.893 | 1e-162 | |
| 291419607 | 652 | heat shock protein 70 [Chilo suppressali | 0.450 | 0.493 | 0.893 | 1e-162 |
| >gi|322779002|gb|EFZ09406.1| hypothetical protein SINV_04536 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 597 bits (1538), Expect = e-168, Method: Compositional matrix adjust.
Identities = 287/330 (86%), Positives = 312/330 (94%), Gaps = 2/330 (0%)
Query: 1 MEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGA 60
+EPVEK+LRDAKMDKAQ+H IVLVGGSTRIPK+QKLLQDFFNGKELNKSINPDEAVAYGA
Sbjct: 314 LEPVEKALRDAKMDKAQVHSIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGA 373
Query: 61 AVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSD 120
AVQAAILHGDKSE VQDLLLLDVTPLSLGIETAGGVMT LIKRNTTIPTKQTQTFTTYSD
Sbjct: 374 AVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTTLIKRNTTIPTKQTQTFTTYSD 433
Query: 121 NQPGVLIQVYEGERAMTKDNNLLGKFELTSIPPAPRGVPQIEVTFDIDANGILNVSAIEK 180
NQPGVLIQVYEGERAMTKDNN+LGKFELT IPPAPRGVPQIEVTFDIDANGILNVSAIEK
Sbjct: 434 NQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEK 493
Query: 181 STGKENKITITNDRGRLSKEDIERMVNDAEKYKAEDEKQKAVITAKNSLESYCFNMKSTM 240
STGKENKITITND+GRLSKEDIERMVN+AEKY++EDE+Q+ I+AKNSLESYCFNMKSTM
Sbjct: 494 STGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEQQRERISAKNSLESYCFNMKSTM 553
Query: 241 EDEKLKDKISSAERTQILDKCNDVIKWLDSNQLAEKEEFEDKQKELEAICNPIITKLYQA 300
ED+K+KDKI ++++ ++L KC++VI WLD+NQLAEKEEF DKQKELEAICNPIITKLYQ+
Sbjct: 554 EDDKVKDKIDASDKEKVLSKCSEVISWLDANQLAEKEEFADKQKELEAICNPIITKLYQS 613
Query: 301 GGAP-GGFPGAPGAAPGAGA-GPGPTIEEV 328
GGAP GGFPGA GA P G+ G GPTIEEV
Sbjct: 614 GGAPEGGFPGAGGARPNPGSGGAGPTIEEV 643
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|292606983|gb|ADE34170.1| heat shock cognate protein 70 [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
| >gi|12585261|sp|Q9U639.1|HSP7D_MANSE RecName: Full=Heat shock 70 kDa protein cognate 4; Short=Hsc 70-4 gi|6457366|gb|AAF09496.1|AF194819_1 heat shock cognate 70 protein [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|112982828|ref|NP_001036892.1| heat shock cognate protein [Bombyx mori] gi|20563125|dbj|BAB92074.1| heat shock cognate protein [Bombyx mori] gi|320526705|gb|ADW41775.1| heat shock protein 70 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|211908975|gb|ACJ12782.1| cognate 70 kDa heat shock protein, partial [Pyrrhocoris apterus] | Back alignment and taxonomy information |
|---|
| >gi|124100014|gb|ABM90551.1| heat shock protein 70 [Dendrolimus superans] | Back alignment and taxonomy information |
|---|
| >gi|242003741|ref|XP_002422844.1| Heat shock 70 kDa protein cognate, putative [Pediculus humanus corporis] gi|212505714|gb|EEB10106.1| Heat shock 70 kDa protein cognate, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|378760814|gb|AFC38439.1| Hsc70 [Plutella xylostella] | Back alignment and taxonomy information |
|---|
| >gi|124108394|gb|ABM90803.1| heat shock protein 70 [Dendrolimus punctatus] gi|125663923|gb|ABN50911.1| heat shock protein 70 [Dendrolimus punctatus x Dendrolimus tabulaeformis] | Back alignment and taxonomy information |
|---|
| >gi|291419607|gb|ADE05296.1| heat shock protein 70 [Chilo suppressalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 714 | ||||||
| ZFIN|ZDB-GENE-040426-1221 | 647 | hsc70 "heat shock cognate 70" | 0.408 | 0.451 | 0.841 | 1e-133 | |
| UNIPROTKB|P19120 | 650 | HSPA8 "Heat shock cognate 71 k | 0.408 | 0.449 | 0.831 | 2.7e-133 | |
| UNIPROTKB|E2R0T6 | 646 | HSPA8 "Uncharacterized protein | 0.408 | 0.452 | 0.831 | 2.7e-133 | |
| UNIPROTKB|P11142 | 646 | HSPA8 "Heat shock cognate 71 k | 0.408 | 0.452 | 0.831 | 2.7e-133 | |
| UNIPROTKB|A2Q0Z1 | 646 | HSPA8 "Heat shock cognate 71 k | 0.408 | 0.452 | 0.831 | 2.7e-133 | |
| MGI|MGI:105384 | 646 | Hspa8 "heat shock protein 8" [ | 0.408 | 0.452 | 0.831 | 2.7e-133 | |
| RGD|621725 | 646 | Hspa8 "heat shock 70kDa protei | 0.408 | 0.452 | 0.831 | 2.7e-133 | |
| ZFIN|ZDB-GENE-031217-2 | 647 | hspa8l "heat shock protein 8-l | 0.408 | 0.451 | 0.831 | 2.7e-133 | |
| UNIPROTKB|F1NRW7 | 647 | HSPA8 "Heat shock cognate 71 k | 0.408 | 0.451 | 0.828 | 3.5e-133 | |
| UNIPROTKB|F1NWP3 | 646 | HSPA8 "Heat shock cognate 71 k | 0.408 | 0.452 | 0.828 | 3.5e-133 |
| ZFIN|ZDB-GENE-040426-1221 hsc70 "heat shock cognate 70" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 1249 (444.7 bits), Expect = 1.0e-133, Sum P(3) = 1.0e-133
Identities = 250/297 (84%), Positives = 263/297 (88%)
Query: 326 EEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEP 385
EEVSSMVLTKMKE +EAYLGKTVSNAVITVPAYFNDSQRQATKD+GTIAGLNVLRIINEP
Sbjct: 117 EEVSSMVLTKMKEISEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEP 176
Query: 386 TAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE 445
TAAAIAYGLDKKVG GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE
Sbjct: 177 TAAAIAYGLDKKVG-----GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE 231
Query: 446 DFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGV 505
DFDNRMVNHF+ EFKRK+KKD+T NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG
Sbjct: 232 DFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGA 291
Query: 506 DFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 565
DFYTS+TRARFEELNADLFRGT+EPVEK+LRDAKMDKAQIHDIVLVGGSTRIPK+QKLLQ
Sbjct: 292 DFYTSITRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351
Query: 566 DFFNGKELNKSINPDEXXXXXXXXXXXILHGDKSEEVQDXXXXXXXXXXXGIETAGG 622
DFFNG++LNKSINPDE IL GD SE VQD GIETAGG
Sbjct: 352 DFFNGRDLNKSINPDEAVAYGAAVQAAILTGDTSENVQDLLLLDVTPLSLGIETAGG 408
|
|
| UNIPROTKB|P19120 HSPA8 "Heat shock cognate 71 kDa protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0T6 HSPA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11142 HSPA8 "Heat shock cognate 71 kDa protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2Q0Z1 HSPA8 "Heat shock cognate 71 kDa protein" [Equus caballus (taxid:9796)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105384 Hspa8 "heat shock protein 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621725 Hspa8 "heat shock 70kDa protein 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031217-2 hspa8l "heat shock protein 8-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRW7 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWP3 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P09446 | HSP7A_CAEEL | No assigned EC number | 0.8391 | 0.4285 | 0.4781 | yes | N/A |
| O73885 | HSP7C_CHICK | No assigned EC number | 0.8855 | 0.4089 | 0.4520 | yes | N/A |
| Q71U34 | HSP7C_SAGOE | No assigned EC number | 0.9057 | 0.4089 | 0.4520 | N/A | N/A |
| P08108 | HSP70_ONCMY | No assigned EC number | 0.9057 | 0.4089 | 0.4485 | N/A | N/A |
| P63018 | HSP7C_RAT | No assigned EC number | 0.9057 | 0.4089 | 0.4520 | yes | N/A |
| P63017 | HSP7C_MOUSE | No assigned EC number | 0.9057 | 0.4089 | 0.4520 | yes | N/A |
| Q5NVM9 | HSP7C_PONAB | No assigned EC number | 0.9023 | 0.4089 | 0.4520 | yes | N/A |
| P19378 | HSP7C_CRIGR | No assigned EC number | 0.9023 | 0.4089 | 0.4520 | yes | N/A |
| A2Q0Z1 | HSP7C_HORSE | No assigned EC number | 0.9057 | 0.4089 | 0.4520 | yes | N/A |
| Q9W6Y1 | HSP7C_ORYLA | No assigned EC number | 0.9191 | 0.4089 | 0.4256 | N/A | N/A |
| P11147 | HSP7D_DROME | No assigned EC number | 0.9124 | 0.4089 | 0.4485 | yes | N/A |
| P11142 | HSP7C_HUMAN | No assigned EC number | 0.9057 | 0.4089 | 0.4520 | yes | N/A |
| P19120 | HSP7C_BOVIN | No assigned EC number | 0.9057 | 0.4089 | 0.4492 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 714 | |||
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 0.0 | |
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 0.0 | |
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 0.0 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 1e-179 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 1e-168 | |
| PRK00290 | 627 | PRK00290, dnaK, molecular chaperone DnaK; Provisio | 1e-159 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 1e-150 | |
| PRK00290 | 627 | PRK00290, dnaK, molecular chaperone DnaK; Provisio | 1e-142 | |
| TIGR02350 | 595 | TIGR02350, prok_dnaK, chaperone protein DnaK | 1e-139 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 1e-136 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 1e-132 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 1e-132 | |
| TIGR02350 | 595 | TIGR02350, prok_dnaK, chaperone protein DnaK | 1e-125 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 1e-125 | |
| cd11733 | 377 | cd11733, HSPA9-like_NBD, Nucleotide-binding domain | 1e-121 | |
| CHL00094 | 621 | CHL00094, dnaK, heat shock protein 70 | 1e-121 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 1e-117 | |
| PTZ00400 | 663 | PTZ00400, PTZ00400, DnaK-type molecular chaperone; | 1e-116 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 1e-109 | |
| PRK05183 | 616 | PRK05183, hscA, chaperone protein HscA; Provisiona | 1e-108 | |
| PLN03184 | 673 | PLN03184, PLN03184, chloroplast Hsp70; Provisional | 1e-106 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 1e-105 | |
| PTZ00400 | 663 | PTZ00400, PTZ00400, DnaK-type molecular chaperone; | 1e-105 | |
| cd10235 | 339 | cd10235, HscC_like_NBD, Nucleotide-binding domain | 1e-104 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 1e-103 | |
| CHL00094 | 621 | CHL00094, dnaK, heat shock protein 70 | 1e-103 | |
| TIGR01991 | 599 | TIGR01991, HscA, Fe-S protein assembly chaperone H | 1e-100 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 9e-96 | |
| cd10236 | 355 | cd10236, HscA_like_NBD, Nucleotide-binding domain | 3e-95 | |
| PLN03184 | 673 | PLN03184, PLN03184, chloroplast Hsp70; Provisional | 1e-91 | |
| PTZ00186 | 657 | PTZ00186, PTZ00186, heat shock 70 kDa precursor pr | 3e-89 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 5e-88 | |
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 2e-87 | |
| cd10237 | 417 | cd10237, HSPA13-like_NBD, Nucleotide-binding domai | 1e-82 | |
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 2e-81 | |
| PRK05183 | 616 | PRK05183, hscA, chaperone protein HscA; Provisiona | 3e-76 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 3e-76 | |
| TIGR01991 | 599 | TIGR01991, HscA, Fe-S protein assembly chaperone H | 3e-74 | |
| PTZ00186 | 657 | PTZ00186, PTZ00186, heat shock 70 kDa precursor pr | 2e-71 | |
| cd11737 | 383 | cd11737, HSPA4_NBD, Nucleotide-binding domain of H | 4e-68 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 2e-66 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 9e-64 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 2e-59 | |
| PRK01433 | 595 | PRK01433, hscA, chaperone protein HscA; Provisiona | 7e-54 | |
| PRK01433 | 595 | PRK01433, hscA, chaperone protein HscA; Provisiona | 2e-47 | |
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 3e-43 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 5e-32 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 4e-25 | |
| cd10231 | 415 | cd10231, YegD_like, Escherichia coli YegD, a putat | 9e-24 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 2e-21 | |
| cd10235 | 339 | cd10235, HscC_like_NBD, Nucleotide-binding domain | 2e-19 | |
| cd11733 | 377 | cd11733, HSPA9-like_NBD, Nucleotide-binding domain | 3e-19 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 3e-19 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 8e-18 | |
| cd10236 | 355 | cd10236, HscA_like_NBD, Nucleotide-binding domain | 2e-17 | |
| cd10237 | 417 | cd10237, HSPA13-like_NBD, Nucleotide-binding domai | 2e-17 | |
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 2e-16 | |
| cd10229 | 404 | cd10229, HSPA12_like_NBD, Nucleotide-binding domai | 3e-16 | |
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 7e-16 | |
| cd10225 | 320 | cd10225, MreB_like, MreB and similar proteins | 2e-12 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 2e-11 | |
| cd11737 | 383 | cd11737, HSPA4_NBD, Nucleotide-binding domain of H | 1e-10 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 5e-09 | |
| PRK13930 | 335 | PRK13930, PRK13930, rod shape-determining protein | 7e-09 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 8e-09 | |
| TIGR02529 | 239 | TIGR02529, EutJ, ethanolamine utilization protein | 8e-08 | |
| TIGR00904 | 333 | TIGR00904, mreB, cell shape determining protein, M | 1e-07 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 3e-07 | |
| COG4820 | 277 | COG4820, EutJ, Ethanolamine utilization protein, p | 4e-07 | |
| pfam06723 | 327 | pfam06723, MreB_Mbl, MreB/Mbl protein | 6e-07 | |
| cd00012 | 185 | cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- | 3e-06 | |
| PRK13928 | 336 | PRK13928, PRK13928, rod shape-determining protein | 3e-06 | |
| TIGR01312 | 481 | TIGR01312, XylB, D-xylulose kinase | 7e-06 | |
| PRK15080 | 267 | PRK15080, PRK15080, ethanolamine utilization prote | 1e-05 | |
| COG1077 | 342 | COG1077, MreB, Actin-like ATPase involved in cell | 6e-05 | |
| PRK13927 | 334 | PRK13927, PRK13927, rod shape-determining protein | 9e-05 | |
| TIGR01312 | 481 | TIGR01312, XylB, D-xylulose kinase | 4e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 8e-04 | |
| cd07809 | 487 | cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup | 0.001 | |
| PRK11678 | 450 | PRK11678, PRK11678, putative chaperone; Provisiona | 0.002 | |
| PRK13929 | 335 | PRK13929, PRK13929, rod-share determining protein | 0.002 |
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
Score = 604 bits (1560), Expect = 0.0
Identities = 245/270 (90%), Positives = 259/270 (95%), Gaps = 5/270 (1%)
Query: 326 EEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEP 385
EE+SSMVLTKMKE AEAYLGKTV+NAVITVPAYFNDSQRQATKD+GTIAGLNVLRIINEP
Sbjct: 112 EEISSMVLTKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEP 171
Query: 386 TAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE 445
TAAAIAYGLDKK G GERNVLIFDLGGGTFDVS+LTIEDGIFEVK+TAGDTHLGGE
Sbjct: 172 TAAAIAYGLDKK-----GGGERNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGE 226
Query: 446 DFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGV 505
DFDNR+VNHFVQEFKRK+KKD++ NKRALRRLRTACERAKRTLSSSTQASIEIDSLFEG+
Sbjct: 227 DFDNRLVNHFVQEFKRKHKKDISGNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGI 286
Query: 506 DFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 565
DFYTS+TRARFEEL ADLFRGT+EPVEK LRDAK+DK+QIHDIVLVGGSTRIPKVQKLLQ
Sbjct: 287 DFYTSITRARFEELCADLFRGTLEPVEKVLRDAKLDKSQIHDIVLVGGSTRIPKVQKLLQ 346
Query: 566 DFFNGKELNKSINPDEAVAYGAAVQAAILH 595
DFFNGKELNKSINPDEAVAYGAAVQAAIL
Sbjct: 347 DFFNGKELNKSINPDEAVAYGAAVQAAILS 376
|
This subfamily includes human HSPA1A (70-kDa heat shock protein 1A, also known as HSP72; HSPA1; HSP70I; HSPA1B; HSP70-1; HSP70-1A), HSPA1B (70-kDa heat shock protein 1B, also known as HSPA1A; HSP70-2; HSP70-1B), and HSPA1L (70-kDa heat shock protein 1-like, also known as HSP70T; hum70t; HSP70-1L; HSP70-HOM). The genes for these three HSPA1 proteins map in close proximity on the major histocompatibility complex (MHC) class III region on chromosome 6, 6p21.3. This subfamily also includes human HSPA8 (heat shock 70kDa protein 8, also known as LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; NIP71; HSPA10; the HSPA8 gene maps to 11q24.1), human HSPA2 (70-kDa heat shock protein 2, also known as HSP70-2; HSP70-3, the HSPA2 gene maps to 14q24.1), human HSPA6 (also known as heat shock 70kDa protein 6 (HSP70B') gi 94717614, the HSPA6 gene maps to 1q23.3), human HSPA7 (heat shock 70kDa protein 7 , also known as HSP70B; the HSPA7 gene maps to 1q23.3) and Saccharmoyces cerevisiae Stress-Seventy subfamily B/Ssb1p. This subfamily belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Associations of polymorphisms within the MHC-III HSP70 gene locus with longevity, systemic lupus erythematosus, Meniere's disease, noise-induced hearing loss, high-altitude pulmonary edema, and coronary heart disease, have been found. HSPA2 is involved in cancer cell survival, is required for maturation of male gametophytes, and is linked to male infertility. The induction of HSPA6 is a biomarker of cellular stress. HSPA8 participates in the folding and trafficking of client proteins to different subcellular compartments, and in the signal transduction and apoptosis process; it has been shown to protect cardiomyocytes against oxidative stress partly through an interaction with alpha-enolase. S. cerevisiae Ssb1p, is part of the ribosome-associated complex (RAC), it acts as a chaperone for nascent polypeptides, and is important for translation fidelity; Ssb1p is also a [PSI+] prion-curing factor. Length = 376 |
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 | Back alignment and domain information |
|---|
| >gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 | Back alignment and domain information |
|---|
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein | Back alignment and domain information |
|---|
| >gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase | Back alignment and domain information |
|---|
| >gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 714 | |||
| KOG0100|consensus | 663 | 100.0 | ||
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 100.0 | |
| KOG0101|consensus | 620 | 100.0 | ||
| KOG0102|consensus | 640 | 100.0 | ||
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 100.0 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 100.0 | |
| KOG0100|consensus | 663 | 100.0 | ||
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 100.0 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 100.0 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 100.0 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 100.0 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 100.0 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 100.0 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 100.0 | |
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 100.0 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 100.0 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 100.0 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 100.0 | |
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 100.0 | |
| KOG0101|consensus | 620 | 100.0 | ||
| KOG0103|consensus | 727 | 100.0 | ||
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 100.0 | |
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 100.0 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 100.0 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 100.0 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 100.0 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 100.0 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 100.0 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 100.0 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 100.0 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 100.0 | |
| KOG0104|consensus | 902 | 100.0 | ||
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 100.0 | |
| PRK11678 | 450 | putative chaperone; Provisional | 100.0 | |
| KOG0103|consensus | 727 | 100.0 | ||
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 100.0 | |
| KOG0102|consensus | 640 | 100.0 | ||
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 100.0 | |
| KOG0104|consensus | 902 | 100.0 | ||
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 99.97 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 99.97 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 99.96 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 99.96 | |
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 99.96 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 99.95 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 99.93 | |
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 99.93 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 99.89 | |
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 99.81 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 99.78 | |
| COG0849 | 418 | ftsA Cell division ATPase FtsA [Cell division and | 99.64 | |
| COG4820 | 277 | EutJ Ethanolamine utilization protein, possible ch | 99.49 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 99.41 | |
| PRK13917 | 344 | plasmid segregation protein ParM; Provisional | 99.37 | |
| smart00268 | 373 | ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki | 99.32 | |
| TIGR03739 | 320 | PRTRC_D PRTRC system protein D. A novel genetic sy | 99.27 | |
| PTZ00280 | 414 | Actin-related protein 3; Provisional | 99.09 | |
| PF00022 | 393 | Actin: Actin; InterPro: IPR004000 Actin [, ] is a | 99.08 | |
| TIGR01175 | 348 | pilM type IV pilus assembly protein PilM. This pro | 99.01 | |
| PTZ00281 | 376 | actin; Provisional | 98.93 | |
| PTZ00004 | 378 | actin-2; Provisional | 98.93 | |
| PF06406 | 318 | StbA: StbA protein; InterPro: IPR009440 This entry | 98.92 | |
| PF11104 | 340 | PilM_2: Type IV pilus assembly protein PilM;; PDB: | 98.9 | |
| PTZ00466 | 380 | actin-like protein; Provisional | 98.88 | |
| PTZ00452 | 375 | actin; Provisional | 98.87 | |
| PF07520 | 1002 | SrfB: Virulence factor SrfB; InterPro: IPR009216 T | 98.59 | |
| KOG0679|consensus | 426 | 98.59 | ||
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 98.55 | |
| PRK11678 | 450 | putative chaperone; Provisional | 98.54 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 98.54 | |
| COG4972 | 354 | PilM Tfp pilus assembly protein, ATPase PilM [Cell | 98.27 | |
| COG5277 | 444 | Actin and related proteins [Cytoskeleton] | 98.21 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 98.16 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 98.15 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 98.06 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 98.01 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 98.0 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 97.96 | |
| PF08841 | 332 | DDR: Diol dehydratase reactivase ATPase-like domai | 97.95 | |
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 97.93 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 97.92 | |
| KOG0797|consensus | 618 | 97.89 | ||
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 97.89 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 97.83 | |
| PRK10719 | 475 | eutA reactivating factor for ethanolamine ammonia | 97.79 | |
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 97.72 | |
| COG4457 | 1014 | SrfB Uncharacterized protein conserved in bacteria | 97.71 | |
| KOG0676|consensus | 372 | 97.62 | ||
| PRK13317 | 277 | pantothenate kinase; Provisional | 97.26 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 97.25 | |
| KOG0677|consensus | 389 | 96.96 | ||
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 96.93 | |
| PF02782 | 198 | FGGY_C: FGGY family of carbohydrate kinases, C-ter | 96.79 | |
| KOG0680|consensus | 400 | 96.4 | ||
| PRK15027 | 484 | xylulokinase; Provisional | 96.02 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 96.01 | |
| PLN02669 | 556 | xylulokinase | 95.91 | |
| KOG2517|consensus | 516 | 95.76 | ||
| PF02782 | 198 | FGGY_C: FGGY family of carbohydrate kinases, C-ter | 95.64 | |
| PF01869 | 271 | BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In | 95.52 | |
| TIGR00555 | 279 | panK_eukar pantothenate kinase, eukaryotic/staphyl | 95.34 | |
| PRK04123 | 548 | ribulokinase; Provisional | 95.34 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 95.28 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 95.24 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 95.24 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 95.19 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 95.12 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 95.02 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 95.01 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 94.89 | |
| PLN02295 | 512 | glycerol kinase | 94.81 | |
| PF14450 | 120 | FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B | 94.67 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 94.66 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 94.62 | |
| PF01968 | 290 | Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr | 94.61 | |
| PRK15027 | 484 | xylulokinase; Provisional | 94.6 | |
| PRK10640 | 471 | rhaB rhamnulokinase; Provisional | 94.03 | |
| PLN02669 | 556 | xylulokinase | 93.99 | |
| COG1069 | 544 | AraB Ribulose kinase [Energy production and conver | 93.78 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 93.46 | |
| KOG2531|consensus | 545 | 93.35 | ||
| KOG0681|consensus | 645 | 93.32 | ||
| PRK04123 | 548 | ribulokinase; Provisional | 93.1 | |
| PLN02295 | 512 | glycerol kinase | 93.08 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 93.08 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 92.91 | |
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 92.9 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 92.88 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 92.77 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 92.75 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 92.53 | |
| PRK13917 | 344 | plasmid segregation protein ParM; Provisional | 92.48 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 92.46 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 92.43 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 92.41 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 92.33 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 92.2 | |
| KOG2531|consensus | 545 | 91.88 | ||
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 91.76 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 91.3 | |
| PF07318 | 343 | DUF1464: Protein of unknown function (DUF1464); In | 91.14 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 91.09 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 90.62 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 90.56 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 90.28 | |
| COG0248 | 492 | GppA Exopolyphosphatase [Nucleotide transport and | 89.89 | |
| PRK10640 | 471 | rhaB rhamnulokinase; Provisional | 89.8 | |
| PRK11031 | 496 | guanosine pentaphosphate phosphohydrolase; Provisi | 89.72 | |
| PRK13317 | 277 | pantothenate kinase; Provisional | 89.35 | |
| PRK10854 | 513 | exopolyphosphatase; Provisional | 88.54 | |
| PF02541 | 285 | Ppx-GppA: Ppx/GppA phosphatase family; InterPro: I | 88.48 | |
| COG0554 | 499 | GlpK Glycerol kinase [Energy production and conver | 88.25 | |
| TIGR00744 | 318 | ROK_glcA_fam ROK family protein (putative glucokin | 87.49 | |
| PF03702 | 364 | UPF0075: Uncharacterised protein family (UPF0075); | 86.39 | |
| PF11104 | 340 | PilM_2: Type IV pilus assembly protein PilM;; PDB: | 84.94 | |
| COG1069 | 544 | AraB Ribulose kinase [Energy production and conver | 83.48 | |
| PF00022 | 393 | Actin: Actin; InterPro: IPR004000 Actin [, ] is a | 83.36 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 83.14 | |
| TIGR00329 | 305 | gcp_kae1 metallohydrolase, glycoprotease/Kae1 fami | 82.77 | |
| KOG2517|consensus | 516 | 82.65 | ||
| PRK14878 | 323 | UGMP family protein; Provisional | 82.27 | |
| PTZ00340 | 345 | O-sialoglycoprotein endopeptidase-like protein; Pr | 82.08 | |
| TIGR03706 | 300 | exo_poly_only exopolyphosphatase. It appears that | 81.86 | |
| PLN02666 | 1275 | 5-oxoprolinase | 81.67 | |
| PLN02920 | 398 | pantothenate kinase 1 | 80.4 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 80.35 |
| >KOG0100|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-77 Score=589.45 Aligned_cols=378 Identities=57% Similarity=0.880 Sum_probs=359.4
Q ss_pred CCCCCCCccchhhhHHHHHHHHHHHHHhCCCCCeEEEeeCCCCCHHHHHHHHHHHHHcCCCeeEeeechhHHHHHhhccc
Q psy5547 317 AGAGPGPTIEEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDK 396 (714)
Q Consensus 317 ~~~~~~~s~eev~a~~L~~l~~~~~~~~~~~~~~~vitVPa~~~~~~r~~l~~A~~~AGl~~~~li~Ep~AAa~~~~~~~ 396 (714)
.+..+.++||+|++|+|.++++.|+.|+|.++.++|+||||||++.||+++++|...|||+++++|+||+|||++|+++.
T Consensus 141 ~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATKDAGtIAgLnV~RIiNePTaAAIAYGLDK 220 (663)
T KOG0100|consen 141 GGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVVRIINEPTAAAIAYGLDK 220 (663)
T ss_pred CCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhcccceeccceEEEeecCccHHHHHhcccc
Confidence 44568899999999999999999999999999999999999999999999999999999999999999999999999987
Q ss_pred ccCCCCCCCCcEEEEEEeCCceEEEEEEEEeCCEEEEEEecCCCCccHHHHHHHHHHHHHHHHHHhhccCccccHHHHHH
Q psy5547 397 KVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRR 476 (714)
Q Consensus 397 ~~~~~~~~~~~~vlVvD~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~~ 476 (714)
.. .++++||||+||||||||++.++++.|+++++.||.++||++||++.++|+.+-++++++.+++.+.+++.+
T Consensus 221 k~------gEknilVfDLGGGTFDVSlLtIdnGVFeVlaTnGDThLGGEDFD~rvm~~fiklykkK~gkDv~kdnkA~~K 294 (663)
T KOG0100|consen 221 KD------GEKNILVFDLGGGTFDVSLLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKHGKDVRKDNKAVQK 294 (663)
T ss_pred cC------CcceEEEEEcCCceEEEEEEEEcCceEEEEecCCCcccCccchHHHHHHHHHHHHhhhcCCccchhhHHHHH
Confidence 63 578999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhHhcCCCCeeEEEEecccCCceeEEEecHHHHHHHHHHHHhhhhhHHHHHHHHcCCCccccceEEEEcCCCC
Q psy5547 477 LRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTR 556 (714)
Q Consensus 477 l~~~~e~~K~~ls~~~~~~i~i~~~~~~~~~~~~itr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~ViLvGG~s~ 556 (714)
|+++||+||+.||++.+..+.++++++|.+|+-++||..|+++..++|...+.+++++|+++++.+.+|+.|+||||++|
T Consensus 295 LrRe~EkAKRaLSsqhq~riEIeS~fdG~DfSEtLtRAkFEElNmDLFr~TlkPv~kvl~Ds~lkKsdideiVLVGGsTr 374 (663)
T KOG0100|consen 295 LRREVEKAKRALSSQHQVRIEIESLFDGVDFSETLTRAKFEELNMDLFRKTLKPVQKVLEDSDLKKSDIDEIVLVGGSTR 374 (663)
T ss_pred HHHHHHHHHhhhccccceEEeeeeccccccccchhhhhHHHHhhhHHHHHhhHHHHHHHhhcCcccccCceEEEecCccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cHHHHHHHHHHcCCCcccCCCCCchhhHhhHHHHHHHHhCCCcccccceEEEEeecceeEEEEeCCeeEEeeCCCCCccc
Q psy5547 557 IPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGFELTSIPPATSRLC 636 (714)
Q Consensus 557 ~p~l~~~l~~~f~~~~v~~~~~p~~ava~GAa~~a~~l~~~~~~~~~~~~~~~v~~~sigi~~~~g~~~~~i~~~t~~~~ 636 (714)
+|.++++|+++|.|++....+||++|||+|||.+|..|+|. ....++++.||+|+++||++.||.|..+|||||.+|.
T Consensus 375 IPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsGe--e~t~divLLDv~pLtlGIETvGGVMTklI~RNTviPT 452 (663)
T KOG0100|consen 375 IPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSGE--EDTGDIVLLDVNPLTLGIETVGGVMTKLIPRNTVIPT 452 (663)
T ss_pred ChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhcccccc--cCcCcEEEEeeccccceeeeecceeeccccCCcccCc
Confidence 99999999999999999999999999999999999999998 5568999999999999999999999999999999885
Q ss_pred ---------cccc-ceeeeeeec---------CCCcc-------cCCCCccc-------ccceeeee---------eeEE
Q psy5547 637 ---------LDEV-TASISMLTG---------YPGLC-------LPSGSQLV-------REDKINIT---------KTVI 674 (714)
Q Consensus 637 ---------~d~~-t~~i~~~~~---------y~g~~-------~p~g~~~~-------~~~~l~~~---------~~~~ 674 (714)
.|++ |++|++|.| .+|.| +|+|+|++ .|++|+++ .+|+
T Consensus 453 kKSQvFsTa~DnQ~tV~I~vyEGER~mtkdn~lLGkFdltGipPAPRGvpqIEVtFevDangiL~VsAeDKgtg~~~kit 532 (663)
T KOG0100|consen 453 KKSQVFSTAQDNQPTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKKEKIT 532 (663)
T ss_pred cccceeeecccCCceEEEEEeeccccccccccccccccccCCCCCCCCCccEEEEEEEccCceEEEEeeccCCCCcceEE
Confidence 3555 489999987 44655 89999999 89999954 4899
Q ss_pred EEeccccccHHHHHHHHHHhhhhhhhhh
Q psy5547 675 FVSCSQRRCIERYVEMIAIAGRCTRHRR 702 (714)
Q Consensus 675 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 702 (714)
++|+++||+.|+|+|||.+||+|++++.
T Consensus 533 ItNd~~rLt~EdIerMv~eAekFAeeDk 560 (663)
T KOG0100|consen 533 ITNDKGRLTPEDIERMVNEAEKFAEEDK 560 (663)
T ss_pred EecCCCCCCHHHHHHHHHHHHHHhhhhH
Confidence 9999999999999999999999999654
|
|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >KOG0100|consensus | Back alignment and domain information |
|---|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >KOG0101|consensus | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG0103|consensus | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >KOG0102|consensus | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0104|consensus | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >PRK13917 plasmid segregation protein ParM; Provisional | Back alignment and domain information |
|---|
| >smart00268 ACTIN Actin | Back alignment and domain information |
|---|
| >TIGR03739 PRTRC_D PRTRC system protein D | Back alignment and domain information |
|---|
| >PTZ00280 Actin-related protein 3; Provisional | Back alignment and domain information |
|---|
| >PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton | Back alignment and domain information |
|---|
| >TIGR01175 pilM type IV pilus assembly protein PilM | Back alignment and domain information |
|---|
| >PTZ00281 actin; Provisional | Back alignment and domain information |
|---|
| >PTZ00004 actin-2; Provisional | Back alignment and domain information |
|---|
| >PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] | Back alignment and domain information |
|---|
| >PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A | Back alignment and domain information |
|---|
| >PTZ00466 actin-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00452 actin; Provisional | Back alignment and domain information |
|---|
| >PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0679|consensus | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5277 Actin and related proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >KOG0797|consensus | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] | Back alignment and domain information |
|---|
| >KOG0676|consensus | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >KOG0677|consensus | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >KOG0680|consensus | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >KOG2517|consensus | Back alignment and domain information |
|---|
| >PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis | Back alignment and domain information |
|---|
| >TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK10640 rhaB rhamnulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >COG1069 AraB Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >KOG2531|consensus | Back alignment and domain information |
|---|
| >KOG0681|consensus | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >PRK13917 plasmid segregation protein ParM; Provisional | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >KOG2531|consensus | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >PF07318 DUF1464: Protein of unknown function (DUF1464); InterPro: IPR009927 This family consists of several hypothetical archaeal proteins of around 350 residues in length | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10640 rhaB rhamnulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10854 exopolyphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF02541 Ppx-GppA: Ppx/GppA phosphatase family; InterPro: IPR003695 Exopolyphosphate phosphatase (Ppx) 3 | Back alignment and domain information |
|---|
| >COG0554 GlpK Glycerol kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) | Back alignment and domain information |
|---|
| >PF03702 UPF0075: Uncharacterised protein family (UPF0075); InterPro: IPR005338 Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P | Back alignment and domain information |
|---|
| >PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A | Back alignment and domain information |
|---|
| >COG1069 AraB Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >TIGR00329 gcp_kae1 metallohydrolase, glycoprotease/Kae1 family | Back alignment and domain information |
|---|
| >KOG2517|consensus | Back alignment and domain information |
|---|
| >PRK14878 UGMP family protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00340 O-sialoglycoprotein endopeptidase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03706 exo_poly_only exopolyphosphatase | Back alignment and domain information |
|---|
| >PLN02666 5-oxoprolinase | Back alignment and domain information |
|---|
| >PLN02920 pantothenate kinase 1 | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 714 | ||||
| 3c7n_B | 554 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 1e-143 | ||
| 1yuw_A | 554 | Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 | 1e-142 | ||
| 2v7z_A | 543 | Crystal Structure Of The 70-Kda Heat Shock Cognate | 1e-141 | ||
| 2qw9_B | 394 | Crystal Structure Of Bovine Hsc70 (1-394aa)in The A | 1e-140 | ||
| 2qwn_A | 394 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 1e-139 | ||
| 1ba1_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 1e-138 | ||
| 1ngg_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-138 | ||
| 1bup_A | 386 | T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot | 1e-138 | ||
| 1ngh_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-138 | ||
| 1hpm_A | 386 | How Potassium Affects The Activity Of The Molecular | 1e-138 | ||
| 1ngb_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-138 | ||
| 1atr_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-138 | ||
| 1nga_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-138 | ||
| 1ngd_A | 386 | Structural Basis Of The 70-kilodalton Heat Shock Co | 1e-137 | ||
| 1ngf_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-137 | ||
| 1ngc_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-137 | ||
| 1nge_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-137 | ||
| 1ats_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-137 | ||
| 1ba0_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 1e-137 | ||
| 1hx1_A | 400 | Crystal Structure Of A Bag Domain In Complex With T | 1e-135 | ||
| 3cqx_A | 386 | Chaperone Complex Length = 386 | 1e-135 | ||
| 2bup_A | 381 | T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 | 1e-135 | ||
| 1kax_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71m | 1e-135 | ||
| 1kay_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71a | 1e-135 | ||
| 1kaz_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71e | 1e-135 | ||
| 3fzf_A | 381 | Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP | 1e-135 | ||
| 1qqo_A | 378 | E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-133 | ||
| 2e8a_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 1e-133 | ||
| 2e88_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 1e-133 | ||
| 3a8y_A | 392 | Crystal Structure Of The Complex Between The Bag5 B | 1e-133 | ||
| 1qqm_A | 378 | D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-132 | ||
| 3jxu_A | 409 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-132 | ||
| 1qqn_A | 378 | D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-132 | ||
| 3gdq_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-130 | ||
| 1s3x_A | 382 | The Crystal Structure Of The Human Hsp70 Atpase Dom | 1e-130 | ||
| 3d2f_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 1e-130 | ||
| 1hjo_A | 380 | Atpase Domain Of Human Heat Shock 70kda Protein 1 L | 1e-130 | ||
| 3i33_A | 404 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-129 | ||
| 3fe1_A | 403 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-129 | ||
| 3d2e_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 1e-128 | ||
| 4fsv_A | 387 | Crystal Structure Of A Heat Shock 70kda Protein 2 ( | 1e-128 | ||
| 3kvg_A | 400 | Crystal Structure Of The N-Terminal Domain Of Hsp70 | 1e-115 | ||
| 3gl1_A | 387 | Crystal Structure Of Atpase Domain Of Ssb1 Chaperon | 1e-101 | ||
| 3iuc_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-101 | ||
| 3ldl_A | 384 | Crystal Structure Of Human Grp78 (70kda Heat Shock | 1e-100 | ||
| 1xqs_C | 191 | Crystal Structure Of The Hspbp1 Core Domain Complex | 3e-93 | ||
| 3qfp_A | 390 | Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D | 4e-91 | ||
| 3qfu_A | 394 | Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE | 4e-91 | ||
| 2v7y_A | 509 | Crystal Structure Of The Molecular Chaperone Dnak F | 8e-75 | ||
| 2kho_A | 605 | Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP | 2e-73 | ||
| 4b9q_A | 605 | Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L | 3e-71 | ||
| 1dkg_D | 383 | Crystal Structure Of The Nucleotide Exchange Factor | 9e-69 | ||
| 1ckr_A | 159 | High Resolution Solution Structure Of The Heat Shoc | 3e-64 | ||
| 3dob_A | 152 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 2e-48 | ||
| 3h0x_A | 152 | Crystal Structure Of Peptide-Binding Domain Of Kar2 | 6e-48 | ||
| 2qxl_A | 658 | Crystal Structure Analysis Of Sse1, A Yeast Hsp110 | 4e-43 | ||
| 3c7n_A | 668 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 4e-43 | ||
| 3d2f_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 5e-43 | ||
| 2op6_A | 152 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 3e-42 | ||
| 3d2e_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 2e-41 | ||
| 3n8e_A | 182 | Substrate Binding Domain Of The Human Heat Shock 70 | 1e-35 | ||
| 4gni_A | 409 | Structure Of The Ssz1 Atpase Bound To Atp And Magne | 4e-35 | ||
| 3dqg_A | 151 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 1e-34 | ||
| 3dpo_A | 219 | Crystal Structure Of The Substrate Binding Domain O | 5e-31 | ||
| 1dky_A | 219 | The Substrate Binding Domain Of Dnak In Complex Wit | 8e-31 | ||
| 1dkx_A | 219 | The Substrate Binding Domain Of Dnak In Complex Wit | 8e-31 | ||
| 1bpr_A | 191 | Nmr Structure Of The Substrate Binding Domain Of Dn | 3e-30 | ||
| 1dg4_A | 115 | Nmr Structure Of The Substrate Binding Domain Of Dn | 3e-25 | ||
| 1q5l_A | 135 | Nmr Structure Of The Substrate Binding Domain Of Dn | 3e-25 | ||
| 3lof_A | 113 | C-Terminal Domain Of Human Heat Shock 70kda Protein | 9e-24 | ||
| 1ud0_A | 113 | Crystal Structure Of The C-Terminal 10-Kda Subdomai | 2e-23 | ||
| 2lmg_A | 75 | Solution Structure Of The C-Terminal Domain (537-61 | 4e-23 | ||
| 2p32_A | 120 | Crystal Structure Of The C-Terminal 10 Kda Subdomai | 5e-23 | ||
| 1u00_A | 227 | Hsca Substrate Binding Domain Complexed With The Is | 1e-18 | ||
| 1jcf_A | 344 | Mreb From Thermotoga Maritima, Trigonal Length = 34 | 6e-05 | ||
| 1jce_A | 344 | Mreb From Thermotoga Maritima Length = 344 | 3e-04 |
| >pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 | Back alignment and structure |
|
| >pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 | Back alignment and structure |
| >pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 | Back alignment and structure |
| >pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 | Back alignment and structure |
| >pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 | Back alignment and structure |
| >pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 | Back alignment and structure |
| >pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 | Back alignment and structure |
| >pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 | Back alignment and structure |
| >pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 | Back alignment and structure |
| >pdb|3CQX|A Chain A, Chaperone Complex Length = 386 | Back alignment and structure |
| >pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 | Back alignment and structure |
| >pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 | Back alignment and structure |
| >pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 | Back alignment and structure |
| >pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 | Back alignment and structure |
| >pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 | Back alignment and structure |
| >pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 | Back alignment and structure |
| >pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 | Back alignment and structure |
| >pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 | Back alignment and structure |
| >pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 | Back alignment and structure |
| >pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 | Back alignment and structure |
| >pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 | Back alignment and structure |
| >pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 | Back alignment and structure |
| >pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 | Back alignment and structure |
| >pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 | Back alignment and structure |
| >pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 | Back alignment and structure |
| >pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 | Back alignment and structure |
| >pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 | Back alignment and structure |
| >pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 | Back alignment and structure |
| >pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 | Back alignment and structure |
| >pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 | Back alignment and structure |
| >pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 | Back alignment and structure |
| >pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 | Back alignment and structure |
| >pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 | Back alignment and structure |
| >pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 | Back alignment and structure |
| >pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 | Back alignment and structure |
| >pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 | Back alignment and structure |
| >pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 | Back alignment and structure |
| >pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 | Back alignment and structure |
| >pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 | Back alignment and structure |
| >pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 | Back alignment and structure |
| >pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 | Back alignment and structure |
| >pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 | Back alignment and structure |
| >pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 | Back alignment and structure |
| >pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 | Back alignment and structure |
| >pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 | Back alignment and structure |
| >pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 | Back alignment and structure |
| >pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 | Back alignment and structure |
| >pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 | Back alignment and structure |
| >pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 | Back alignment and structure |
| >pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 | Back alignment and structure |
| >pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 | Back alignment and structure |
| >pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 | Back alignment and structure |
| >pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 | Back alignment and structure |
| >pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 | Back alignment and structure |
| >pdb|3LOF|A Chain A, C-Terminal Domain Of Human Heat Shock 70kda Protein 1b. Length = 113 | Back alignment and structure |
| >pdb|1UD0|A Chain A, Crystal Structure Of The C-Terminal 10-Kda Subdomain Of Hsc70 Length = 113 | Back alignment and structure |
| >pdb|2LMG|A Chain A, Solution Structure Of The C-Terminal Domain (537-610) Of Human Heat Shock Protein 70 Length = 75 | Back alignment and structure |
| >pdb|2P32|A Chain A, Crystal Structure Of The C-Terminal 10 Kda Subdomain From C. Elegans Hsp70 Length = 120 | Back alignment and structure |
| >pdb|1U00|A Chain A, Hsca Substrate Binding Domain Complexed With The Iscu Recognition Peptide Elppvkihc Length = 227 | Back alignment and structure |
| >pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 | Back alignment and structure |
| >pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 | Back alignment and structure |
|---|
Score = 678 bits (1751), Expect = 0.0
Identities = 265/297 (89%), Positives = 282/297 (94%), Gaps = 5/297 (1%)
Query: 326 EEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEP 385
EEVSSMVLTKMKE AEAYLGKTV+NAV+TVPAYFNDSQRQATKD+GTIAGLNVLRIINEP
Sbjct: 117 EEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEP 176
Query: 386 TAAAIAYGLDKKVGSAAGSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE 445
TAAAIAYGLDKK ERNVLIFDLGGGTFDVSILTI GIFEVKSTAGDTHLGGE
Sbjct: 177 TAAAIAYGLDKK-----VGAERNVLIFDLGGGTFDVSILTIAAGIFEVKSTAGDTHLGGE 231
Query: 446 DFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGV 505
DFDNRMVNHF+ EFKRK+KKD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+
Sbjct: 232 DFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGI 291
Query: 506 DFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQ 565
DFYTS+TRARFEELNADLFRGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK+QKLLQ
Sbjct: 292 DFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351
Query: 566 DFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGG 622
DFFNGKELNKSINPDEAVAYGAAVQAAIL GDKSE VQDLLLLDVTPLSLGIETAGG
Sbjct: 352 DFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGG 408
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 | Back alignment and structure |
|---|
| >3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 | Back alignment and structure |
|---|
| >3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 | Back alignment and structure |
|---|
| >2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 | Back alignment and structure |
|---|
| >3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 | Back alignment and structure |
|---|
| >2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Length = 120 | Back alignment and structure |
|---|
| >3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Length = 113 | Back alignment and structure |
|---|
| >1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Length = 113 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Length = 419 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 714 | |||
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 100.0 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 100.0 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 100.0 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 100.0 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 100.0 | |
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 100.0 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 100.0 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 100.0 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 100.0 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 100.0 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 100.0 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 100.0 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 100.0 | |
| 4e81_A | 219 | Chaperone protein DNAK; chaperone; 1.90A {Escheric | 100.0 | |
| 1u00_A | 227 | HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A | 100.0 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 100.0 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 99.98 | |
| 3n8e_A | 182 | Stress-70 protein, mitochondrial; beta-sandwich, h | 99.97 | |
| 3h0x_A | 152 | 78 kDa glucose-regulated protein homolog; structur | 99.95 | |
| 3dob_A | 152 | Heat shock 70 kDa protein F44E5.5; structural geno | 99.94 | |
| 3dqg_A | 151 | Heat shock 70 kDa protein F; structural genomics, | 99.94 | |
| 2op6_A | 152 | Heat shock 70 kDa protein D; HSP70/peptide-binding | 99.92 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 99.91 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 99.88 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 99.87 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 99.84 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 99.82 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 99.82 | |
| 1q5l_A | 135 | Chaperone protein DNAK; HSP70, chaperone, heat sho | 99.81 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 99.72 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 99.55 | |
| 3js6_A | 355 | Uncharacterized PARM protein; partition, segregati | 99.53 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 99.51 | |
| 3lof_A | 113 | Heat shock 70 kDa protein 1; structural genomics, | 99.4 | |
| 3dob_A | 152 | Heat shock 70 kDa protein F44E5.5; structural geno | 99.39 | |
| 3h0x_A | 152 | 78 kDa glucose-regulated protein homolog; structur | 99.36 | |
| 3dqg_A | 151 | Heat shock 70 kDa protein F; structural genomics, | 99.35 | |
| 4apw_A | 329 | ALP12; actin-like protein; 19.70A {Clostridium tet | 99.34 | |
| 3n8e_A | 182 | Stress-70 protein, mitochondrial; beta-sandwich, h | 99.29 | |
| 4e81_A | 219 | Chaperone protein DNAK; chaperone; 1.90A {Escheric | 99.25 | |
| 3dwl_A | 427 | Actin-related protein 3; propellor, actin-binding, | 99.25 | |
| 2d0o_A | 610 | DIOL dehydratase-reactivating factor large subunit | 99.2 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 99.18 | |
| 2p32_A | 120 | Heat shock 70 kDa protein A; three-helix bundle, c | 99.18 | |
| 1ud0_A | 113 | HSC70, 70 kDa heat-shock-like protein; chaperone; | 99.12 | |
| 2op6_A | 152 | Heat shock 70 kDa protein D; HSP70/peptide-binding | 99.1 | |
| 3qb0_A | 498 | Actin-related protein 4; actin fold, ATP binding, | 99.09 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.08 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.03 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.02 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 98.9 | |
| 1u00_A | 227 | HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A | 98.85 | |
| 4fo0_A | 593 | Actin-related protein 8; chromatin remodeling, nuc | 98.85 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 98.22 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 98.21 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 98.16 | |
| 4am6_A | 655 | Actin-like protein ARP8; nuclear protein, chromati | 98.07 | |
| 1q5l_A | 135 | Chaperone protein DNAK; HSP70, chaperone, heat sho | 97.84 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 97.78 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 97.34 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 97.29 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 97.19 | |
| 2i7n_A | 360 | Pantothenate kinase 1; PANK, transferase; HET: ACO | 97.18 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 96.93 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 96.91 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 96.87 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 96.35 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 96.16 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 96.04 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 96.01 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 95.99 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 95.97 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 95.88 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 95.87 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 95.62 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 95.58 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 95.56 | |
| 4apw_A | 329 | ALP12; actin-like protein; 19.70A {Clostridium tet | 95.5 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 95.5 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 95.48 | |
| 3js6_A | 355 | Uncharacterized PARM protein; partition, segregati | 95.47 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 95.45 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 95.43 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 95.35 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 95.08 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 94.85 | |
| 1t6c_A | 315 | Exopolyphosphatase; alpha/beta protein, actin-like | 94.59 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 94.19 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 94.16 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 94.11 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 94.07 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 93.8 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 93.79 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 93.49 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 93.09 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 92.95 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 92.89 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 92.87 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 92.86 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 92.7 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 92.68 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 92.65 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 92.49 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 91.8 | |
| 3mdq_A | 315 | Exopolyphosphatase; structural genomics, joint cen | 91.63 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 91.42 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 91.18 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 90.96 | |
| 3r8e_A | 321 | Hypothetical sugar kinase; ribonuclease H-like mot | 90.75 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 90.39 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 90.18 | |
| 3cer_A | 343 | Possible exopolyphosphatase-like protein; NESG, BL | 89.62 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 89.44 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 89.35 | |
| 2d0o_A | 610 | DIOL dehydratase-reactivating factor large subunit | 88.66 | |
| 2ivn_A | 330 | O-sialoglycoprotein endopeptidase; UP1 keops compl | 87.95 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 87.83 | |
| 4db3_A | 327 | Glcnac kinase, N-acetyl-D-glucosamine kinase; stru | 87.65 | |
| 1u6z_A | 513 | Exopolyphosphatase; alpha/beta protein, askha (ace | 87.47 | |
| 3vgl_A | 321 | Glucokinase; ROK family, transferase; HET: BGC ANP | 86.65 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 85.86 | |
| 3hi0_A | 508 | Putative exopolyphosphatase; 17739545, structural | 84.2 | |
| 3qbx_A | 371 | Anhydro-N-acetylmuramic acid kinase; acetate and s | 83.75 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 80.45 |
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
Probab=100.00 E-value=9.3e-59 Score=526.99 Aligned_cols=374 Identities=47% Similarity=0.728 Sum_probs=337.0
Q ss_pred CCCCccchhhhHHHHHHHHHHHHHhCCCCCeEEEeeCCCCCHHHHHHHHHHHHHcCCCeeEeeechhHHHHHhhcccccC
Q psy5547 320 GPGPTIEEVSSMVLTKMKETAEAYLGKTVSNAVITVPAYFNDSQRQATKDSGTIAGLNVLRIINEPTAAAIAYGLDKKVG 399 (714)
Q Consensus 320 ~~~~s~eev~a~~L~~l~~~~~~~~~~~~~~~vitVPa~~~~~~r~~l~~A~~~AGl~~~~li~Ep~AAa~~~~~~~~~~ 399 (714)
+..++|+++++++|++|++.++.++|.++.++|||||++|++.||+++++|++.|||+++++++||+|||++|+.....
T Consensus 107 ~~~~~p~ei~a~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~AGl~v~~li~EP~AAAlaygl~~~~- 185 (605)
T 4b9q_A 107 GQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGT- 185 (605)
T ss_dssp TEEECHHHHHHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEEHHHHHHHHHHTTSCC-
T ss_pred CEEECHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHHcCCceEEEeCcHHHHHHHhhhhccC-
Confidence 3589999999999999999999999999999999999999999999999999999999999999999999999876531
Q ss_pred CCCCCCCcEEEEEEeCCceEEEEEEEEeC----CEEEEEEecCCCCccHHHHHHHHHHHHHHHHHHhhccCccccHHHHH
Q psy5547 400 SAAGSGERNVLIFDLGGGTFDVSILTIED----GIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALR 475 (714)
Q Consensus 400 ~~~~~~~~~vlVvD~GggT~Dvsv~~~~~----~~~~v~~~~g~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~ 475 (714)
.+.+++|||+||||||++++++.+ +.++++++.|+..+||.+||+.|++|+.++|..+++.+...+++.+.
T Consensus 186 -----~~~~vlV~DlGGGT~Dvsi~~~~~~~~~~~~evla~~gd~~lGG~d~D~~l~~~l~~~f~~~~~~~~~~~~~~~~ 260 (605)
T 4b9q_A 186 -----GNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQ 260 (605)
T ss_dssp -----SSEEEEEEEECSSCEEEEEEEEEESSSCEEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHTCCCGGGCHHHHH
T ss_pred -----CCCEEEEEECCCCeEEEEEEEEecCCCCceEEEEEecCCCCcChHHHHHHHHHHHHHHHhhhcCCCcccCHHHHH
Confidence 468999999999999999999987 89999999999999999999999999999999988888888999999
Q ss_pred HHHHHHHHHhHhcCCCCeeEEEEecccCC----ceeEEEecHHHHHHHHHHHHhhhhhHHHHHHHHcCCCccccceEEEE
Q psy5547 476 RLRTACERAKRTLSSSTQASIEIDSLFEG----VDFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLV 551 (714)
Q Consensus 476 ~l~~~~e~~K~~ls~~~~~~i~i~~~~~~----~~~~~~itr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~ViLv 551 (714)
+|+.+||++|+.||......+.++.+..+ .++.+.|||++|++++.++++++..+++++|+++++...+|+.|+||
T Consensus 261 ~L~~~aE~~K~~Ls~~~~~~i~~~~~~~~~~g~~~~~~~itr~~~e~l~~~~~~~i~~~v~~~L~~a~~~~~~i~~VvLv 340 (605)
T 4b9q_A 261 RLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV 340 (605)
T ss_dssp HHHHHHHHHHHHTTTCSEEEEEEEEEEECSSSEEEEEEEEEHHHHHHHHHHHHHHTTHHHHHHHHHTTCCGGGCSEEEEE
T ss_pred HHHHHHHHHHHhcCcCCCeEEEEeeeccCCCCCeeEEEEEeHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCcEEEEe
Confidence 99999999999999999888888765433 57889999999999999999999999999999999999999999999
Q ss_pred cCCCCcHHHHHHHHHHcCCCcccCCCCCchhhHhhHHHHHHHHhCCCcccccceEEEEeecceeEEEEeCCeeEEeeCCC
Q psy5547 552 GGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGFELTSIPPA 631 (714)
Q Consensus 552 GG~s~~p~l~~~l~~~f~~~~v~~~~~p~~ava~GAa~~a~~l~~~~~~~~~~~~~~~v~~~sigi~~~~g~~~~~i~~~ 631 (714)
||+|++|+|+++|++.| +.++..+.||++|||+|||++|+.+++. ++++.+.|++|+||||++.+|.|.++||+|
T Consensus 341 GG~sriP~v~~~l~~~f-g~~~~~~~nPdeaVA~GAai~a~~l~~~----~~~~~l~dv~p~slgie~~~g~~~~ii~rn 415 (605)
T 4b9q_A 341 GGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLLLDVTPLSLGIETMGGVMTTLIAKN 415 (605)
T ss_dssp SGGGGSHHHHHHHHHHH-TSCCCSSSCTTTHHHHHHHHHHHHHHTS----SCSEEEECBCSSCEEEEETTTEEEEEECTT
T ss_pred CCccCchHHHHHHHHHh-ccCcCCCcChhHHHHHhHHHHHHHhcCC----CCceEEEeeeeeEEEEEEcCCEEEEEEeCC
Confidence 99999999999999999 7888899999999999999999999986 578999999999999999999999999999
Q ss_pred CCcccc---------cccc-eeeeeeec---------CCCcc-------cCCCCccc-------ccceeeee--------
Q psy5547 632 TSRLCL---------DEVT-ASISMLTG---------YPGLC-------LPSGSQLV-------REDKINIT-------- 670 (714)
Q Consensus 632 t~~~~~---------d~~t-~~i~~~~~---------y~g~~-------~p~g~~~~-------~~~~l~~~-------- 670 (714)
|++|+. |+++ ..+.++.| +.|.| .|+|.|.+ .||.|+++
T Consensus 416 t~iP~~~~~~f~t~~d~q~~v~i~v~~ge~~~~~~n~~lg~~~l~~i~~~~~g~~~i~v~f~id~~gil~v~a~~~~tg~ 495 (605)
T 4b9q_A 416 TTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGK 495 (605)
T ss_dssp CBSSEEEEEEECCSSTTCCEEEEEEEESSCSBGGGSEEEEEEEEECCCCCSTTCCCEEEEEEECTTSCEEEEEEETTTCC
T ss_pred CcCCcceEEEeeeecccCceEEEEEEeccccccccCCEeeEEEEeCCCCCcCCCceEEEEEEEcCCcEEEEEEEecCCCc
Confidence 999863 4554 56777765 22333 56677765 78888854
Q ss_pred -eeEEEEeccccccHHHHHHHHHHhhhhhhhhhhhh
Q psy5547 671 -KTVIFVSCSQRRCIERYVEMIAIAGRCTRHRRMRY 705 (714)
Q Consensus 671 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 705 (714)
..+++++. .+||+++|++|+++|++++++|+.+.
T Consensus 496 ~~~i~i~~~-~~ls~~ei~~~~~~~~~~~~~d~~~~ 530 (605)
T 4b9q_A 496 EQKITIKAS-SGLNEDEIQKMVRDAEANAEADRKCE 530 (605)
T ss_dssp EECCEEESC-CSCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred EEEEEecCC-CCCCHHHHHHHHHHhhhhHhhHHHHH
Confidence 46788766 47999999999999999999766543
|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A | Back alignment and structure |
|---|
| >1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A | Back alignment and structure |
|---|
| >3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A | Back alignment and structure |
|---|
| >3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A | Back alignment and structure |
|---|
| >3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A | Back alignment and structure |
|---|
| >3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 | Back alignment and structure |
|---|
| >2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 | Back alignment and structure |
|---|
| >4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A | Back alignment and structure |
|---|
| >2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* | Back alignment and structure |
|---|
| >3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3qbx_A Anhydro-N-acetylmuramic acid kinase; acetate and sugar kinases, HSP70, actin superfamily, anhydro-N-actetylmuramic acid binding; HET: AH0; 2.10A {Pseudomonas aeruginosa} PDB: 3qbw_A* | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 714 | ||||
| d1bupa2 | 193 | c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP | 3e-87 | |
| d1bupa2 | 193 | c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP | 1e-27 | |
| d1dkgd2 | 198 | c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP | 4e-83 | |
| d1dkgd2 | 198 | c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP | 2e-23 | |
| d1yuwa1 | 159 | b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus | 2e-75 | |
| d1yuwa1 | 159 | b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus | 7e-10 | |
| d1dkza2 | 118 | b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI | 1e-55 | |
| d1dkza2 | 118 | b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI | 1e-05 | |
| d1u00a2 | 115 | b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 | 7e-49 | |
| d1u00a2 | 115 | b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 | 1e-05 | |
| d1ud0a_ | 84 | a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: | 3e-37 | |
| d1dkgd1 | 183 | c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas | 1e-33 | |
| d1jcea2 | 196 | c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre | 2e-32 | |
| d1jcea2 | 196 | c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre | 2e-12 | |
| d1bupa1 | 185 | c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas | 2e-32 | |
| d2zgya2 | 163 | c.55.1.1 (A:158-320) Plasmid segregation protein P | 6e-27 | |
| d2zgya2 | 163 | c.55.1.1 (A:158-320) Plasmid segregation protein P | 9e-05 | |
| d1dkza1 | 97 | a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: | 2e-22 | |
| d2fsja1 | 161 | c.55.1.12 (A:165-325) Hypothetical protein Ta0583 | 8e-21 | |
| d1u00a1 | 112 | a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) | 9e-19 | |
| d1jcea1 | 137 | c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB | 1e-18 | |
| d1e4ft2 | 191 | c.55.1.1 (T:200-390) Cell division protein FtsA {T | 1e-04 |
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Score = 270 bits (691), Expect = 3e-87
Identities = 173/190 (91%), Positives = 187/190 (98%)
Query: 405 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYK 464
ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHF+ EFKRK+K
Sbjct: 3 AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHK 62
Query: 465 KDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNADLF 524
KD++ NKRA+RRLRTACERAKRTLSSSTQASIEIDSL+EG+DFYTS+TRARFEELNADLF
Sbjct: 63 KDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLF 122
Query: 525 RGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVA 584
RGT++PVEK+LRDAK+DK+QIHDIVLVGGSTRIPK+QKLLQDFFNGKELNKSINPDEAVA
Sbjct: 123 RGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVA 182
Query: 585 YGAAVQAAIL 594
YGAAVQAAIL
Sbjct: 183 YGAAVQAAIL 192
|
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 | Back information, alignment and structure |
|---|
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 | Back information, alignment and structure |
|---|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 | Back information, alignment and structure |
|---|
| >d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 84 | Back information, alignment and structure |
|---|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 | Back information, alignment and structure |
|---|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
| >d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Length = 97 | Back information, alignment and structure |
|---|
| >d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 | Back information, alignment and structure |
|---|
| >d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112 | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 | Back information, alignment and structure |
|---|
| >d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 714 | |||
| d1bupa2 | 193 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 100.0 | |
| d1dkgd2 | 198 | Heat shock protein 70kDa, ATPase fragment {Escheri | 100.0 | |
| d1yuwa1 | 159 | DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.95 | |
| d1dkza2 | 118 | DnaK {Escherichia coli [TaxId: 562]} | 99.88 | |
| d1u00a2 | 115 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 99.86 | |
| d1jcea2 | 196 | Prokaryotic actin homolog MreB {Thermotoga maritim | 99.8 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.57 | |
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.56 | |
| d1bupa2 | 193 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.51 | |
| d1ud0a_ | 84 | DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.49 | |
| d1yuwa1 | 159 | DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.48 | |
| d2zgya2 | 163 | Plasmid segregation protein ParM {Escherichia coli | 99.47 | |
| d1dkgd2 | 198 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.47 | |
| d1e4ft2 | 191 | Cell division protein FtsA {Thermotoga maritima [T | 99.42 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 99.31 | |
| d2fsja1 | 161 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 99.25 | |
| d1jcea2 | 196 | Prokaryotic actin homolog MreB {Thermotoga maritim | 98.92 | |
| d1dkza1 | 97 | DnaK {Escherichia coli [TaxId: 562]} | 98.89 | |
| d1u00a1 | 112 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 98.87 | |
| d1dkza2 | 118 | DnaK {Escherichia coli [TaxId: 562]} | 98.31 | |
| d1u00a2 | 115 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 98.18 | |
| d2fxua2 | 225 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 98.07 | |
| d1k8ka2 | 258 | Actin-related protein 3, Arp3 {Cow (Bos taurus) [T | 97.95 | |
| d1nbwa3 | 202 | ATPase domain of the glycerol dehydratase reactiva | 97.72 | |
| d1k8kb1 | 190 | Actin-related protein 2, Arp2 {Cow (Bos taurus) [T | 97.61 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 97.59 | |
| d2d0oa3 | 203 | Diol dehydratase-reactivating factor large subunit | 97.58 | |
| d2zgya2 | 163 | Plasmid segregation protein ParM {Escherichia coli | 97.16 | |
| d1r59o2 | 235 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 96.18 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 96.15 | |
| d2p3ra2 | 247 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 95.68 | |
| d2i7na2 | 212 | Pantothenate kinase 1, PANK1 {Human (Homo sapiens) | 95.64 | |
| d2fsja1 | 161 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 94.84 | |
| d2p3ra2 | 247 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 93.64 | |
| d1r59o2 | 235 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 92.46 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 91.96 | |
| d1e4ft2 | 191 | Cell division protein FtsA {Thermotoga maritima [T | 91.74 | |
| d1dkza1 | 97 | DnaK {Escherichia coli [TaxId: 562]} | 91.65 | |
| d1t6ca2 | 180 | Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 | 87.47 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 84.66 | |
| d1u6za3 | 177 | Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 | 81.74 | |
| d2hoea2 | 169 | N-acetylglucosamine kinase {Thermotoga maritima [T | 81.08 |
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Actin-like ATPase domain family: Actin/HSP70 domain: Heat shock protein 70kDa, ATPase fragment species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=5.6e-36 Score=288.54 Aligned_cols=191 Identities=91% Similarity=1.318 Sum_probs=183.4
Q ss_pred CCcEEEEEEeCCceEEEEEEEEeCCEEEEEEecCCCCccHHHHHHHHHHHHHHHHHHhhccCccccHHHHHHHHHHHHHH
Q psy5547 405 GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTTNKRALRRLRTACERA 484 (714)
Q Consensus 405 ~~~~vlVvD~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~id~~l~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~e~~ 484 (714)
.+++|||||+||||+|+|++++.++.++++++.|+..+||.+||++|++|+.+++..+++.+...+++.+.+|+.+||++
T Consensus 3 ~e~~VlV~D~GggT~Dvsv~~~~~~~~~v~~~~g~~~lGG~~~D~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~e~~ 82 (193)
T d1bupa2 3 AERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERA 82 (193)
T ss_dssp SCEEEEEEEECSSCEEEEEEEEETTEEEEEEEEEETTCSHHHHHHHHHHHHHHHHHHHHSCCCTTCHHHHHHHHHHHHHH
T ss_pred CCcEEEEEEeCCCeEEEEEEEEeCCEEEEEEecCCCCcchhHHHHHHHHHHHHHHHHHhCCCCccCHHHHHHHHHHHHHH
Confidence 46789999999999999999999999999999999999999999999999999999999888889999999999999999
Q ss_pred hHhcCCCCeeEEEEecccCCceeEEEecHHHHHHHHHHHHhhhhhHHHHHHHHcCCCccccceEEEEcCCCCcHHHHHHH
Q psy5547 485 KRTLSSSTQASIEIDSLFEGVDFYTSVTRARFEELNADLFRGTMEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKVQKLL 564 (714)
Q Consensus 485 K~~ls~~~~~~i~i~~~~~~~~~~~~itr~~~~~~~~~~~~~i~~~i~~~l~~~~~~~~~i~~ViLvGG~s~~p~l~~~l 564 (714)
|+.||.+.++.+.++.+..+.++..+|+|++|+++++++++++.++++++|++++..+.+|+.|+||||+|++|+|++.|
T Consensus 83 K~~ls~~~~~~~~~~~~~~~~~~~~~itr~~~e~~~~~~~~~~~~~i~~~l~~~~~~~~~i~~V~lvGG~sr~p~v~~~i 162 (193)
T d1bupa2 83 KRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL 162 (193)
T ss_dssp HHHHTTSSEEEEEEEEEETTEEEEEEEEHHHHHHHTHHHHHHTHHHHHHHHHHHTCCGGGCCEEEEESGGGGCHHHHHHH
T ss_pred hhccCCCceEEEEEecccCCCccceEEcHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCCEEEEECCccccHHHHHHH
Confidence 99999999999999988889999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHcCCCcccCCCCCchhhHhhHHHHHHHHh
Q psy5547 565 QDFFNGKELNKSINPDEAVAYGAAVQAAILH 595 (714)
Q Consensus 565 ~~~f~~~~v~~~~~p~~ava~GAa~~a~~l~ 595 (714)
++.|++.++..+.||++|||+|||++|+.|+
T Consensus 163 ~~~f~~~~i~~~~~p~~aVa~GaA~~aa~ls 193 (193)
T d1bupa2 163 QDFFNGKELNKSINPDEAVAYGAAVQAAILS 193 (193)
T ss_dssp HHHTTTCCCBCSSCGGGHHHHHHHHHHHHHC
T ss_pred HHHcCCCCCCCCCChHHHHHHHHHHHHHhhC
Confidence 9999888888889999999999999999875
|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6ca2 c.55.1.8 (A:133-312) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u6za3 c.55.1.8 (A:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hoea2 c.55.1.10 (A:200-368) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|