Psyllid ID: psy5572


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
ccccEEEEEEHHHHHHHHHcccccccEEEEEEccccEEEEEEccccEEEEEEEccccccccc
ccccEEHHHHHHHHHHHHHcccccccEEEEEcccccEEEEEEcccccEEEEEEccccccccc
MQEPVSLNFACRYLLNfakaaplsnqVCLSmsldvplvvefkiddighiryylapkiesddn
MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYylapkiesddn
MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
*****SLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAP*******
***PVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYL**KI*****
MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
*QEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query62 2.2.26 [Sep-21-2011]
P17917260 Proliferating cell nuclea yes N/A 1.0 0.238 0.709 8e-20
O16852260 Proliferating cell nuclea N/A N/A 1.0 0.238 0.709 1e-19
O01377260 Proliferating cell nuclea N/A N/A 1.0 0.238 0.709 4e-19
P61258261 Proliferating cell nuclea N/A N/A 1.0 0.237 0.661 2e-17
P12004261 Proliferating cell nuclea yes N/A 1.0 0.237 0.661 2e-17
P57761261 Proliferating cell nuclea yes N/A 1.0 0.237 0.661 3e-17
P17070263 Proliferating cell nuclea yes N/A 0.983 0.231 0.622 4e-17
P24314268 Proliferating cell nuclea N/A N/A 0.983 0.227 0.639 5e-17
P04961261 Proliferating cell nuclea yes N/A 1.0 0.237 0.661 5e-17
Q3ZBW4261 Proliferating cell nuclea yes N/A 1.0 0.237 0.661 6e-17
>sp|P17917|PCNA_DROME Proliferating cell nuclear antigen OS=Drosophila melanogaster GN=mus209 PE=1 SV=2 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 44/62 (70%), Positives = 49/62 (79%)

Query: 1   MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
           MQEPV+L FACRYL  F KA PLS QV LSM  DVPLVVE+ I D+GHIRYYLAPKIE +
Sbjct: 199 MQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDN 258

Query: 61  DN 62
           + 
Sbjct: 259 ET 260




This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.
Drosophila melanogaster (taxid: 7227)
>sp|O16852|PCNA_SARCR Proliferating cell nuclear antigen OS=Sarcophaga crassipalpis GN=PCNA PE=3 SV=1 Back     alignment and function description
>sp|O01377|PCNA_BOMMO Proliferating cell nuclear antigen OS=Bombyx mori GN=PCNA PE=2 SV=1 Back     alignment and function description
>sp|P61258|PCNA_MACFA Proliferating cell nuclear antigen OS=Macaca fascicularis GN=PCNA PE=2 SV=1 Back     alignment and function description
>sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1 Back     alignment and function description
>sp|P57761|PCNA_CRIGR Proliferating cell nuclear antigen OS=Cricetulus griseus GN=PCNA PE=1 SV=1 Back     alignment and function description
>sp|P17070|PCNA_ORYSJ Proliferating cell nuclear antigen OS=Oryza sativa subsp. japonica GN=Os02g0805200 PE=2 SV=2 Back     alignment and function description
>sp|P24314|PCNA_CATRO Proliferating cell nuclear antigen OS=Catharanthus roseus PE=2 SV=1 Back     alignment and function description
>sp|P04961|PCNA_RAT Proliferating cell nuclear antigen OS=Rattus norvegicus GN=Pcna PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBW4|PCNA_BOVIN Proliferating cell nuclear antigen OS=Bos taurus GN=PCNA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
170046021 260 proliferating cell nuclear antigen [Cule 1.0 0.238 0.790 1e-21
157167857 260 proliferating cell nuclear antigen [Aede 1.0 0.238 0.774 4e-21
67866971 260 proliferating cell nuclear antigen [Aede 1.0 0.238 0.774 4e-21
58392487 260 AGAP010220-PA [Anopheles gambiae str. PE 1.0 0.238 0.758 3e-20
312379886 260 hypothetical protein AND_08153 [Anophele 1.0 0.238 0.741 9e-20
289742701 260 DNA polymerase delta processivity factor 1.0 0.238 0.725 7e-19
349501993 261 proliferating cell nuclear antigen [Lito 1.0 0.237 0.725 3e-18
122831052 260 proliferating cell nuclear antigen [Fenn 1.0 0.238 0.725 3e-18
17136790 260 mutagen-sensitive 209, isoform A [Drosop 1.0 0.238 0.709 4e-18
195124095 260 GI18526 [Drosophila mojavensis] gi|19391 1.0 0.238 0.709 4e-18
>gi|170046021|ref|XP_001850584.1| proliferating cell nuclear antigen [Culex quinquefasciatus] gi|167868946|gb|EDS32329.1| proliferating cell nuclear antigen [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%)

Query: 1   MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
           MQEPV+L FACRYL +F KA PLSNQV LSMS DVPLVVE+KI D+GHIRYYLAPKIE D
Sbjct: 199 MQEPVTLTFACRYLNSFTKATPLSNQVQLSMSADVPLVVEYKIQDLGHIRYYLAPKIEDD 258

Query: 61  DN 62
           +N
Sbjct: 259 EN 260




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157167857|ref|XP_001662644.1| proliferating cell nuclear antigen [Aedes aegypti] gi|67866973|gb|AAY82461.1| proliferating cell nuclear antigen [Aedes aegypti] gi|108871048|gb|EAT35273.1| AAEL012545-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|67866971|gb|AAY82460.1| proliferating cell nuclear antigen [Aedes albopictus] Back     alignment and taxonomy information
>gi|58392487|ref|XP_319407.2| AGAP010220-PA [Anopheles gambiae str. PEST] gi|55236432|gb|EAA13806.2| AGAP010220-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312379886|gb|EFR26039.1| hypothetical protein AND_08153 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|289742701|gb|ADD20098.1| DNA polymerase delta processivity factor [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|349501993|gb|AEP83535.1| proliferating cell nuclear antigen [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|122831052|gb|ABM66815.1| proliferating cell nuclear antigen [Fenneropenaeus chinensis] Back     alignment and taxonomy information
>gi|17136790|ref|NP_476905.1| mutagen-sensitive 209, isoform A [Drosophila melanogaster] gi|45552759|ref|NP_995904.1| mutagen-sensitive 209, isoform B [Drosophila melanogaster] gi|194753480|ref|XP_001959040.1| mus209 [Drosophila ananassae] gi|194881527|ref|XP_001974882.1| mus209 [Drosophila erecta] gi|195486939|ref|XP_002091715.1| mus209 [Drosophila yakuba] gi|129693|sp|P17917.2|PCNA_DROME RecName: Full=Proliferating cell nuclear antigen; Short=PCNA; AltName: Full=Cyclin; AltName: Full=Mutagen-sensitive 209 protein gi|158038|gb|AAA28746.1| proliferating cell nuclear antigen [Drosophila melanogaster] gi|7302405|gb|AAF57493.1| mutagen-sensitive 209, isoform A [Drosophila melanogaster] gi|21483468|gb|AAM52709.1| LD45889p [Drosophila melanogaster] gi|45445452|gb|AAS64796.1| mutagen-sensitive 209, isoform B [Drosophila melanogaster] gi|190620338|gb|EDV35862.1| mus209 [Drosophila ananassae] gi|190658069|gb|EDV55282.1| mus209 [Drosophila erecta] gi|194177816|gb|EDW91427.1| mus209 [Drosophila yakuba] gi|220954336|gb|ACL89711.1| mus209-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195124095|ref|XP_002006529.1| GI18526 [Drosophila mojavensis] gi|193911597|gb|EDW10464.1| GI18526 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
FB|FBgn0005655260 mus209 "mutagen-sensitive 209" 0.983 0.234 0.721 1.4e-18
UNIPROTKB|P12004261 PCNA "Proliferating cell nucle 0.983 0.233 0.672 5.3e-17
UNIPROTKB|P61258261 PCNA "Proliferating cell nucle 0.983 0.233 0.672 5.3e-17
UNIPROTKB|P57761261 PCNA "Proliferating cell nucle 0.983 0.233 0.672 6.7e-17
UNIPROTKB|Q3ZBW4261 PCNA "Proliferating cell nucle 0.983 0.233 0.672 1.1e-16
UNIPROTKB|E2R0D6261 PCNA "Uncharacterized protein" 0.983 0.233 0.672 1.1e-16
UNIPROTKB|I3L813261 PCNA "Proliferating cell nucle 0.983 0.233 0.672 1.1e-16
RGD|3269261 Pcna "proliferating cell nucle 0.983 0.233 0.672 1.1e-16
MGI|MGI:97503261 Pcna "proliferating cell nucle 0.983 0.233 0.672 1.4e-16
UNIPROTKB|F1NLS0263 PCNA "Proliferating cell nucle 0.935 0.220 0.706 2.9e-16
FB|FBgn0005655 mus209 "mutagen-sensitive 209" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 44/61 (72%), Positives = 49/61 (80%)

Query:     1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
             MQEPV+L FACRYL  F KA PLS QV LSM  DVPLVVE+ I D+GHIRYYLAPKIE +
Sbjct:   199 MQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDN 258

Query:    61 D 61
             +
Sbjct:   259 E 259




GO:0006298 "mismatch repair" evidence=TAS
GO:0006261 "DNA-dependent DNA replication" evidence=TAS
GO:0006289 "nucleotide-excision repair" evidence=TAS
GO:0043626 "PCNA complex" evidence=ISS;NAS
GO:0006272 "leading strand elongation" evidence=NAS
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0006260 "DNA replication" evidence=IMP;TAS
GO:0007307 "eggshell chorion gene amplification" evidence=TAS
GO:0006275 "regulation of DNA replication" evidence=IEA
GO:0030337 "DNA polymerase processivity factor activity" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|P12004 PCNA "Proliferating cell nuclear antigen" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P61258 PCNA "Proliferating cell nuclear antigen" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P57761 PCNA "Proliferating cell nuclear antigen" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBW4 PCNA "Proliferating cell nuclear antigen" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0D6 PCNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3L813 PCNA "Proliferating cell nuclear antigen" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|3269 Pcna "proliferating cell nuclear antigen" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97503 Pcna "proliferating cell nuclear antigen" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLS0 PCNA "Proliferating cell nuclear antigen" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M7Q7PCNA1_ARATHNo assigned EC number0.56451.00.2357yesN/A
P17917PCNA_DROMENo assigned EC number0.70961.00.2384yesN/A
Q9PTP1PCNA_DANRENo assigned EC number0.63330.96770.2307yesN/A
Q9DEA3PCNA_CHICKNo assigned EC number0.70680.93540.2213yesN/A
Q9ZW35PCNA2_ARATHNo assigned EC number0.56451.00.2348yesN/A
P17918PCNA_MOUSENo assigned EC number0.67210.98380.2337yesN/A
Q3ZBW4PCNA_BOVINNo assigned EC number0.66121.00.2375yesN/A
Q54K47PCNA_DICDINo assigned EC number0.61400.91930.2209yesN/A
P17070PCNA_ORYSJNo assigned EC number0.62290.98380.2319yesN/A
P57761PCNA_CRIGRNo assigned EC number0.66121.00.2375yesN/A
P12004PCNA_HUMANNo assigned EC number0.66121.00.2375yesN/A
P04961PCNA_RATNo assigned EC number0.66121.00.2375yesN/A
Q03392PCNA_SCHPONo assigned EC number0.50810.96770.2307yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
PLN00057263 PLN00057, PLN00057, proliferating cell nuclear ant 2e-29
TIGR00590259 TIGR00590, pcna, proliferating cell nuclear antige 4e-28
pfam02747128 pfam02747, PCNA_C, Proliferating cell nuclear anti 5e-27
cd00577248 cd00577, PCNA, Proliferating Cell Nuclear Antigen 5e-20
PTZ00483264 PTZ00483, PTZ00483, proliferating cell nuclear ant 5e-11
PTZ00113275 PTZ00113, PTZ00113, proliferating cell nuclear ant 1e-09
PRK01115247 PRK01115, PRK01115, DNA polymerase sliding clamp; 1e-08
PHA03383262 PHA03383, PHA03383, PCNA-like protein; Provisional 3e-06
>gnl|CDD|177688 PLN00057, PLN00057, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
 Score =  103 bits (259), Expect = 2e-29
 Identities = 40/62 (64%), Positives = 52/62 (83%)

Query: 1   MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
           MQEPVSL FA RYL +F KA PLS+ V LS+S ++P+VVE+KI ++G+IRYYLAPKIE D
Sbjct: 199 MQEPVSLTFALRYLNSFTKATPLSDTVTLSLSKELPVVVEYKIAEMGYIRYYLAPKIEED 258

Query: 61  DN 62
           ++
Sbjct: 259 ED 260


Length = 263

>gnl|CDD|188067 TIGR00590, pcna, proliferating cell nuclear antigen (pcna) Back     alignment and domain information
>gnl|CDD|202372 pfam02747, PCNA_C, Proliferating cell nuclear antigen, C-terminal domain Back     alignment and domain information
>gnl|CDD|238322 cd00577, PCNA, Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>gnl|CDD|185661 PTZ00483, PTZ00483, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>gnl|CDD|240275 PTZ00113, PTZ00113, proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>gnl|CDD|234903 PRK01115, PRK01115, DNA polymerase sliding clamp; Validated Back     alignment and domain information
>gnl|CDD|177619 PHA03383, PHA03383, PCNA-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
PTZ00113275 proliferating cell nuclear antigen; Provisional 99.9
PF02747128 PCNA_C: Proliferating cell nuclear antigen, C-term 99.9
PLN00057263 proliferating cell nuclear antigen; Provisional 99.89
PTZ00483264 proliferating cell nuclear antigen; Provisional 99.89
TIGR00590259 pcna proliferating cell nuclear antigen (pcna). Al 99.89
PHA03383262 PCNA-like protein; Provisional 99.87
KOG1636|consensus260 99.87
PRK01115247 DNA polymerase sliding clamp; Validated 99.5
cd00577248 PCNA Proliferating Cell Nuclear Antigen (PCNA) dom 99.3
COG0592364 DnaN DNA polymerase sliding clamp subunit (PCNA ho 98.12
cd00140365 beta_clamp Beta clamp domain. The beta subunit (pr 97.77
PRK05643367 DNA polymerase III subunit beta; Validated 97.46
PF02768121 DNA_pol3_beta_3: DNA polymerase III beta subunit, 96.24
PRK14947384 DNA polymerase III subunit beta; Provisional 95.11
PRK14940367 DNA polymerase III subunit beta; Provisional 93.99
KOG3194|consensus279 93.82
PRK14945362 DNA polymerase III subunit beta; Provisional 93.46
smart00480345 POL3Bc DNA polymerase III beta subunit. 92.97
PF04005292 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, 92.76
cd00577 248 PCNA Proliferating Cell Nuclear Antigen (PCNA) dom 92.05
PRK14941374 DNA polymerase III subunit beta; Provisional 91.78
PRK14942373 DNA polymerase III subunit beta; Provisional 90.66
PRK14943374 DNA polymerase III subunit beta; Provisional 90.6
PRK06673376 DNA polymerase III subunit beta; Validated 90.55
TIGR00663367 dnan DNA polymerase III, beta subunit. University) 90.02
PRK14944375 DNA polymerase III subunit beta; Provisional 89.59
PRK07761376 DNA polymerase III subunit beta; Validated 88.58
PRK14946366 DNA polymerase III subunit beta; Provisional 88.43
PF04139252 Rad9: Rad9; InterPro: IPR007268 Rad9 is required f 86.33
PF00705127 PCNA_N: Proliferating cell nuclear antigen, N-term 85.62
PF02144275 Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IP 84.71
COG0592364 DnaN DNA polymerase sliding clamp subunit (PCNA ho 83.58
>PTZ00113 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
Probab=99.90  E-value=1.2e-23  Score=144.23  Aligned_cols=62  Identities=35%  Similarity=0.744  Sum_probs=57.8

Q ss_pred             CCCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCC----------CeEEEEEEeecCCCCCC
Q psy5572           1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDD----------IGHIRYYLAPKIESDDN   62 (62)
Q Consensus         1 ~~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~----------~g~l~~~lAPrie~e~~   62 (62)
                      ++++++++||++||++|+||+++|++|+|+|++|+||+++|++++          +|+|+||||||+++|++
T Consensus       201 v~~~~~~~ysl~YL~~f~Ka~~ls~~V~l~l~~d~Pl~ley~i~~~~~~~~~~~~~G~l~fyLAPkie~~~~  272 (275)
T PTZ00113        201 VRKPIKQSYATKYLNMFAKSGCLSDVVTLGLSDNRPIEVKYEIKDTSPDARHTHKLGEVKFFLAPKMDDDMD  272 (275)
T ss_pred             ecCceeeEEhHHHHHHhhccccCCCeEEEEEcCCCCEEEEEEeccccccccccCCccEEEEEEcCccCcccc
Confidence            368999999999999999999999999999999999999999962          59999999999998874



>PF02747 PCNA_C: Proliferating cell nuclear antigen, C-terminal domain; InterPro: IPR022649 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] Back     alignment and domain information
>PLN00057 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>PTZ00483 proliferating cell nuclear antigen; Provisional Back     alignment and domain information
>TIGR00590 pcna proliferating cell nuclear antigen (pcna) Back     alignment and domain information
>PHA03383 PCNA-like protein; Provisional Back     alignment and domain information
>KOG1636|consensus Back     alignment and domain information
>PRK01115 DNA polymerase sliding clamp; Validated Back     alignment and domain information
>cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>COG0592 DnaN DNA polymerase sliding clamp subunit (PCNA homolog) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00140 beta_clamp Beta clamp domain Back     alignment and domain information
>PRK05643 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>PF02768 DNA_pol3_beta_3: DNA polymerase III beta subunit, C-terminal domain; InterPro: IPR022635 This entry describes the C-terminal domain of the beta chain of DNA polymerase III Back     alignment and domain information
>PRK14947 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14940 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>KOG3194|consensus Back     alignment and domain information
>PRK14945 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>smart00480 POL3Bc DNA polymerase III beta subunit Back     alignment and domain information
>PF04005 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast Back     alignment and domain information
>cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea Back     alignment and domain information
>PRK14941 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14942 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK14943 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK06673 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>TIGR00663 dnan DNA polymerase III, beta subunit Back     alignment and domain information
>PRK14944 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PRK07761 DNA polymerase III subunit beta; Validated Back     alignment and domain information
>PRK14946 DNA polymerase III subunit beta; Provisional Back     alignment and domain information
>PF04139 Rad9: Rad9; InterPro: IPR007268 Rad9 is required for transient cell-cycle arrests and transcriptional induction of DNA repair in response to DNA damage Back     alignment and domain information
>PF00705 PCNA_N: Proliferating cell nuclear antigen, N-terminal domain; InterPro: IPR022648 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] Back     alignment and domain information
>PF02144 Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IPR003021 REC1 of Ustilago maydis plays a key role in regulating the genetic system of the fungus Back     alignment and domain information
>COG0592 DnaN DNA polymerase sliding clamp subunit (PCNA homolog) [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
1axc_A261 Human Pcna Length = 261 1e-18
1axc_C261 Human Pcna Length = 261 1e-18
2zvv_A276 Crystal Structure Of Proliferating Cellular Nuclear 3e-16
2zvw_A275 Crystal Structure Of Proliferating Cell Nuclear Ant 3e-15
3p91_A265 Crystal Structure Of Proliferating Cellular Nuclear 1e-06
3l0w_B169 Structure Of Split Monoubiquitinated Pcna With Ubiq 2e-06
3l0x_B94 Structure Of Split Yeast Pcna Length = 94 2e-06
3k4x_A 798 Eukaryotic Sliding Clamp Pcna Bound To Dna Length = 2e-06
3gpm_A258 Structure Of The Trimeric Form Of The E113g Pcna Mu 3e-06
3v60_B258 Structure Of S. Cerevisiae Pcna Conjugated To Sumo 3e-06
2od8_A258 Structure Of A Peptide Derived From Cdc9 Bound To P 3e-06
3f1w_A258 Crystal Structure Of A Mutant Proliferating Cell Nu 3e-06
3pge_A200 Structure Of Sumoylated Pcna Length = 200 4e-06
1sxj_F283 Crystal Structure Of The Eukaryotic Clamp Loader (R 3e-05
>pdb|1AXC|A Chain A, Human Pcna Length = 261 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 41/62 (66%), Positives = 48/62 (77%) Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60 M EPV L FA RYL F KA PLS+ V LSMS DVPLVVE+KI D+GH++YYLAPKIE + Sbjct: 199 MNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDE 258 Query: 61 DN 62 + Sbjct: 259 EG 260
>pdb|1AXC|C Chain C, Human Pcna Length = 261 Back     alignment and structure
>pdb|2ZVV|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen 1 And Short Peptide From Human P21 Length = 276 Back     alignment and structure
>pdb|2ZVW|A Chain A, Crystal Structure Of Proliferating Cell Nuclear Antigen 2 And Short Peptide From Human P21 Length = 275 Back     alignment and structure
>pdb|3P91|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen From Entamoeba Histolytica Length = 265 Back     alignment and structure
>pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 Back     alignment and structure
>pdb|3L0X|B Chain B, Structure Of Split Yeast Pcna Length = 94 Back     alignment and structure
>pdb|3K4X|A Chain A, Eukaryotic Sliding Clamp Pcna Bound To Dna Length = 798 Back     alignment and structure
>pdb|3GPM|A Chain A, Structure Of The Trimeric Form Of The E113g Pcna Mutant Protein Length = 258 Back     alignment and structure
>pdb|3V60|B Chain B, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 258 Back     alignment and structure
>pdb|2OD8|A Chain A, Structure Of A Peptide Derived From Cdc9 Bound To Pcna Length = 258 Back     alignment and structure
>pdb|3F1W|A Chain A, Crystal Structure Of A Mutant Proliferating Cell Nuclear Antigen That Blocks Translesion Synthesis Length = 258 Back     alignment and structure
>pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 Back     alignment and structure
>pdb|1SXJ|F Chain F, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna) Length = 283 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 1e-23
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 6e-23
1u7b_A261 PCNA, cyclin, proliferating cell nuclear antigen; 1e-19
3lx2_A259 DNA polymerase sliding clamp 2; PCNA, DNA processi 1e-19
1plq_A258 Proliferating cell nuclear antigen (PCNA); DNA-bin 4e-18
2zvv_A276 PCNA 1, proliferating cellular nuclear antigen 1; 8e-18
3aiz_C246 DNA polymerase sliding clamp C; protein-protein co 2e-17
3aiz_A248 DNA polymerase sliding clamp B; protein-protein co 2e-17
3k4x_A798 PCNA, proliferating cell nuclear antigen; DNA repl 2e-17
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 4e-14
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 4e-14
3p91_A265 Proliferating cell nuclear antigen; DNA binding pr 4e-17
1iz5_A249 Proliferating cell nuclear antigen; DNA, replicati 6e-17
2ijx_A244 DNA polymerase sliding clamp A; PCNA3 subunit, pro 7e-17
3ifv_A247 PCNA; processivity factor, sliding clamp, halophil 9e-17
1ud9_A245 DNA polymerase sliding clamp A; DNA-binding, DNA r 1e-16
3fds_C249 DNA polymerase sliding clamp B; protein-protein co 2e-16
1rwz_A245 DNA polymerase sliding clamp; torus, processivity 4e-16
3fds_D245 DNA polymerase sliding clamp C; protein-protein co 1e-15
3a1j_C263 Cell cycle checkpoint protein RAD1; DNA damage, DN 1e-07
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 Back     alignment and structure
 Score = 85.8 bits (212), Expect = 1e-23
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 1   MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIE 58
           M +PV L F  +YLL+  K + LS++V + +S + P + +F +   G ++++LAPK  
Sbjct: 113 MDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFN 169


>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 Back     alignment and structure
>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Length = 261 Back     alignment and structure
>3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Length = 259 Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Length = 258 Back     alignment and structure
>2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Length = 276 Back     alignment and structure
>3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Length = 246 Back     alignment and structure
>3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Length = 248 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Length = 265 Back     alignment and structure
>1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Length = 249 Back     alignment and structure
>2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Length = 244 Back     alignment and structure
>3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Length = 247 Back     alignment and structure
>1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Length = 245 Back     alignment and structure
>3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Length = 249 Back     alignment and structure
>1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Length = 245 Back     alignment and structure
>3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Length = 245 Back     alignment and structure
>3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 99.92
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.91
3fds_C249 DNA polymerase sliding clamp B; protein-protein co 99.84
3p91_A265 Proliferating cell nuclear antigen; DNA binding pr 99.84
3ifv_A247 PCNA; processivity factor, sliding clamp, halophil 99.81
3k4x_A 798 PCNA, proliferating cell nuclear antigen; DNA repl 99.8
3k4x_A798 PCNA, proliferating cell nuclear antigen; DNA repl 99.78
3lx2_A259 DNA polymerase sliding clamp 2; PCNA, DNA processi 99.77
3fds_D245 DNA polymerase sliding clamp C; protein-protein co 99.75
1plq_A258 Proliferating cell nuclear antigen (PCNA); DNA-bin 99.69
1u7b_A261 PCNA, cyclin, proliferating cell nuclear antigen; 99.68
3a1j_C263 Cell cycle checkpoint protein RAD1; DNA damage, DN 99.67
2zvv_A276 PCNA 1, proliferating cellular nuclear antigen 1; 99.61
1rwz_A245 DNA polymerase sliding clamp; torus, processivity 99.54
1iz5_A249 Proliferating cell nuclear antigen; DNA, replicati 99.53
3aiz_C246 DNA polymerase sliding clamp C; protein-protein co 99.52
1ud9_A245 DNA polymerase sliding clamp A; DNA-binding, DNA r 99.5
3aiz_A248 DNA polymerase sliding clamp B; protein-protein co 99.49
2ijx_A244 DNA polymerase sliding clamp A; PCNA3 subunit, pro 99.48
3a1j_B281 HHUS1, checkpoint protein HUS1; DNA damage, DNA re 99.21
3a1j_A266 Cell cycle checkpoint control protein RAD9A; DNA d 98.97
3g65_A296 Cell cycle checkpoint control protein RAD9A; PCNA, 98.26
1vpk_A378 DNA polymerase III, beta subunit; TM0262, structur 97.65
3d1g_A366 DNA polymerase III subunit beta; chemical probe, D 97.51
2avt_A378 DNA polymerase III beta subunit; beta clamp, slidi 97.44
3t0p_A371 DNA polymerase III, beta subunit; DNA clamp, struc 95.58
3p16_A408 DNA polymerase III subunit beta; DNA polymerase II 92.04
3p91_A 265 Proliferating cell nuclear antigen; DNA binding pr 90.78
1plq_A 258 Proliferating cell nuclear antigen (PCNA); DNA-bin 81.19
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.92  E-value=2e-25  Score=146.93  Aligned_cols=60  Identities=33%  Similarity=0.786  Sum_probs=55.2

Q ss_pred             CCCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeecCCCCC
Q psy5572           1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD   61 (62)
Q Consensus         1 ~~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~~g~l~~~lAPrie~e~   61 (62)
                      +++|++++||++||++|+||+++|++|+|+|++++||+++|+++ +|+|+|||||||++|+
T Consensus       141 ~~e~v~~~fsl~YL~~f~Ka~~ls~~V~l~l~~~~Pl~l~y~i~-~G~l~f~LAPrie~~~  200 (200)
T 3pge_A          141 MDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLK-SGFLQFFLAPKFNDEE  200 (200)
T ss_dssp             ESSCEEEEEEHHHHHHHGGGGGGCSEEEEEECSSSCEEEEEEET-TEEEEEEECCCCC---
T ss_pred             eCCcceeeEhHHHHHHHhccccCCCeEEEEEcCCCCEEEEEEEC-CEEEEEEECCccCCCC
Confidence            36899999999999999999999999999999999999999997 8999999999999875



>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Back     alignment and structure
>3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Back     alignment and structure
>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Back     alignment and structure
>3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Back     alignment and structure
>2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Back     alignment and structure
>1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Back     alignment and structure
>1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Back     alignment and structure
>3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Back     alignment and structure
>1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Back     alignment and structure
>3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Back     alignment and structure
>2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Back     alignment and structure
>3a1j_B HHUS1, checkpoint protein HUS1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_C 3ggr_B Back     alignment and structure
>3a1j_A Cell cycle checkpoint control protein RAD9A; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3ggr_A Back     alignment and structure
>3g65_A Cell cycle checkpoint control protein RAD9A; PCNA, DNA binding clamp, DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein; 2.90A {Homo sapiens} Back     alignment and structure
>1vpk_A DNA polymerase III, beta subunit; TM0262, structural genomic center for structural genomics, JCSG, protein structure INI PSI, transferase; HET: DNA; 2.00A {Thermotoga maritima} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 Back     alignment and structure
>3d1g_A DNA polymerase III subunit beta; chemical probe, DNA sliding clamp, DNA replication, rational drug design, antibiotic target, transferase; HET: DNA 322; 1.64A {Escherichia coli} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 PDB: 1mmi_A* 1unn_A* 2pol_A* 3bep_A* 3d1e_A* 3d1f_A* 1ok7_A* 3q4j_A* 3q4k_A* 3qsb_A* 3q4l_A* 2xur_A* 1jql_A* 1jqj_A* 3f1v_A* 3pwe_A* Back     alignment and structure
>2avt_A DNA polymerase III beta subunit; beta clamp, sliding clamp, replication, transferase; HET: DNA; 2.00A {Streptococcus pyogenes} PDB: 2awa_A* Back     alignment and structure
>3t0p_A DNA polymerase III, beta subunit; DNA clamp, structural genomics, joint center for structural JCSG, protein structure initiative; HET: DNA MSE; 2.26A {Eubacterium rectale} Back     alignment and structure
>3p16_A DNA polymerase III subunit beta; DNA polymerase III sliding clamp, transferase; HET: DNA; 2.89A {Mycobacterium tuberculosis} PDB: 3rb9_A* Back     alignment and structure
>3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Back     alignment and structure
>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1u7ba2129 d.131.1.2 (A:127-255) Proliferating cell nuclear a 1e-19
d1plqa2132 d.131.1.2 (A:127-258) Proliferating cell nuclear a 9e-19
d1ud9a2119 d.131.1.2 (A:127-245) Proliferating cell nuclear a 1e-18
d1rwza2122 d.131.1.2 (A:123-244) Proliferating cell nuclear a 1e-17
d1iz5a2121 d.131.1.2 (A:126-246) Proliferating cell nuclear a 1e-17
>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase processivity factor
domain: Proliferating cell nuclear antigen (PCNA)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.9 bits (181), Expect = 1e-19
 Identities = 40/57 (70%), Positives = 45/57 (78%)

Query: 1   MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI 57
           M EPV L FA RYL  F KA PLS+ V LSMS DVPLVVE+KI D+GH++YYLAPKI
Sbjct: 73  MNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI 129


>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 Back     information, alignment and structure
>d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 119 Back     information, alignment and structure
>d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 122 Back     information, alignment and structure
>d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1plqa2132 Proliferating cell nuclear antigen (PCNA) {Baker's 99.91
d1rwza2122 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.9
d1ud9a2119 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.88
d1iz5a2121 Proliferating cell nuclear antigen (PCNA) {Archaeo 99.88
d1u7ba2129 Proliferating cell nuclear antigen (PCNA) {Human ( 99.87
d1vpka3123 DNA polymerase III, beta subunit {Thermotoga marit 95.81
d1ok7a3122 DNA polymerase III, beta subunit {Escherichia coli 93.97
d1rwza1122 Proliferating cell nuclear antigen (PCNA) {Archaeo 86.02
d1ud9a1119 Proliferating cell nuclear antigen (PCNA) {Archaeo 85.01
>d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase processivity factor
domain: Proliferating cell nuclear antigen (PCNA)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91  E-value=1.9e-24  Score=130.28  Aligned_cols=59  Identities=32%  Similarity=0.789  Sum_probs=56.3

Q ss_pred             CCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeecCCCCC
Q psy5572           2 QEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD   61 (62)
Q Consensus         2 ~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~~g~l~~~lAPrie~e~   61 (62)
                      +++++++|+++||+.|+|++++|+.|+|+|++++||+++|++++ |+|+||||||+++||
T Consensus        74 ~~~~~~~ysl~yL~~~~K~~~ls~~V~i~~~~~~Pl~~~y~i~~-g~l~fyLAPkieddd  132 (132)
T d1plqa2          74 DQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFNDEE  132 (132)
T ss_dssp             SSCEEEEEEHHHHHHHGGGGGTCSEEEEEECSSSCEEEEEEETT-EEEEEEECCCSSSCC
T ss_pred             ccceeeEEEHHHHHHHhCcccCCCEEEEEEeCCCCEEEEEEeCC-EEEEEEECccCCCCC
Confidence            47789999999999999999999999999999999999999966 999999999999886



>d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure