Psyllid ID: psy5572
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 62 | ||||||
| 170046021 | 260 | proliferating cell nuclear antigen [Cule | 1.0 | 0.238 | 0.790 | 1e-21 | |
| 157167857 | 260 | proliferating cell nuclear antigen [Aede | 1.0 | 0.238 | 0.774 | 4e-21 | |
| 67866971 | 260 | proliferating cell nuclear antigen [Aede | 1.0 | 0.238 | 0.774 | 4e-21 | |
| 58392487 | 260 | AGAP010220-PA [Anopheles gambiae str. PE | 1.0 | 0.238 | 0.758 | 3e-20 | |
| 312379886 | 260 | hypothetical protein AND_08153 [Anophele | 1.0 | 0.238 | 0.741 | 9e-20 | |
| 289742701 | 260 | DNA polymerase delta processivity factor | 1.0 | 0.238 | 0.725 | 7e-19 | |
| 349501993 | 261 | proliferating cell nuclear antigen [Lito | 1.0 | 0.237 | 0.725 | 3e-18 | |
| 122831052 | 260 | proliferating cell nuclear antigen [Fenn | 1.0 | 0.238 | 0.725 | 3e-18 | |
| 17136790 | 260 | mutagen-sensitive 209, isoform A [Drosop | 1.0 | 0.238 | 0.709 | 4e-18 | |
| 195124095 | 260 | GI18526 [Drosophila mojavensis] gi|19391 | 1.0 | 0.238 | 0.709 | 4e-18 |
| >gi|170046021|ref|XP_001850584.1| proliferating cell nuclear antigen [Culex quinquefasciatus] gi|167868946|gb|EDS32329.1| proliferating cell nuclear antigen [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 107 bits (266), Expect = 1e-21, Method: Compositional matrix adjust.
Identities = 49/62 (79%), Positives = 54/62 (87%)
Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
MQEPV+L FACRYL +F KA PLSNQV LSMS DVPLVVE+KI D+GHIRYYLAPKIE D
Sbjct: 199 MQEPVTLTFACRYLNSFTKATPLSNQVQLSMSADVPLVVEYKIQDLGHIRYYLAPKIEDD 258
Query: 61 DN 62
+N
Sbjct: 259 EN 260
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157167857|ref|XP_001662644.1| proliferating cell nuclear antigen [Aedes aegypti] gi|67866973|gb|AAY82461.1| proliferating cell nuclear antigen [Aedes aegypti] gi|108871048|gb|EAT35273.1| AAEL012545-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|67866971|gb|AAY82460.1| proliferating cell nuclear antigen [Aedes albopictus] | Back alignment and taxonomy information |
|---|
| >gi|58392487|ref|XP_319407.2| AGAP010220-PA [Anopheles gambiae str. PEST] gi|55236432|gb|EAA13806.2| AGAP010220-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312379886|gb|EFR26039.1| hypothetical protein AND_08153 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|289742701|gb|ADD20098.1| DNA polymerase delta processivity factor [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|349501993|gb|AEP83535.1| proliferating cell nuclear antigen [Litopenaeus vannamei] | Back alignment and taxonomy information |
|---|
| >gi|122831052|gb|ABM66815.1| proliferating cell nuclear antigen [Fenneropenaeus chinensis] | Back alignment and taxonomy information |
|---|
| >gi|17136790|ref|NP_476905.1| mutagen-sensitive 209, isoform A [Drosophila melanogaster] gi|45552759|ref|NP_995904.1| mutagen-sensitive 209, isoform B [Drosophila melanogaster] gi|194753480|ref|XP_001959040.1| mus209 [Drosophila ananassae] gi|194881527|ref|XP_001974882.1| mus209 [Drosophila erecta] gi|195486939|ref|XP_002091715.1| mus209 [Drosophila yakuba] gi|129693|sp|P17917.2|PCNA_DROME RecName: Full=Proliferating cell nuclear antigen; Short=PCNA; AltName: Full=Cyclin; AltName: Full=Mutagen-sensitive 209 protein gi|158038|gb|AAA28746.1| proliferating cell nuclear antigen [Drosophila melanogaster] gi|7302405|gb|AAF57493.1| mutagen-sensitive 209, isoform A [Drosophila melanogaster] gi|21483468|gb|AAM52709.1| LD45889p [Drosophila melanogaster] gi|45445452|gb|AAS64796.1| mutagen-sensitive 209, isoform B [Drosophila melanogaster] gi|190620338|gb|EDV35862.1| mus209 [Drosophila ananassae] gi|190658069|gb|EDV55282.1| mus209 [Drosophila erecta] gi|194177816|gb|EDW91427.1| mus209 [Drosophila yakuba] gi|220954336|gb|ACL89711.1| mus209-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195124095|ref|XP_002006529.1| GI18526 [Drosophila mojavensis] gi|193911597|gb|EDW10464.1| GI18526 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 62 | ||||||
| FB|FBgn0005655 | 260 | mus209 "mutagen-sensitive 209" | 0.983 | 0.234 | 0.721 | 1.4e-18 | |
| UNIPROTKB|P12004 | 261 | PCNA "Proliferating cell nucle | 0.983 | 0.233 | 0.672 | 5.3e-17 | |
| UNIPROTKB|P61258 | 261 | PCNA "Proliferating cell nucle | 0.983 | 0.233 | 0.672 | 5.3e-17 | |
| UNIPROTKB|P57761 | 261 | PCNA "Proliferating cell nucle | 0.983 | 0.233 | 0.672 | 6.7e-17 | |
| UNIPROTKB|Q3ZBW4 | 261 | PCNA "Proliferating cell nucle | 0.983 | 0.233 | 0.672 | 1.1e-16 | |
| UNIPROTKB|E2R0D6 | 261 | PCNA "Uncharacterized protein" | 0.983 | 0.233 | 0.672 | 1.1e-16 | |
| UNIPROTKB|I3L813 | 261 | PCNA "Proliferating cell nucle | 0.983 | 0.233 | 0.672 | 1.1e-16 | |
| RGD|3269 | 261 | Pcna "proliferating cell nucle | 0.983 | 0.233 | 0.672 | 1.1e-16 | |
| MGI|MGI:97503 | 261 | Pcna "proliferating cell nucle | 0.983 | 0.233 | 0.672 | 1.4e-16 | |
| UNIPROTKB|F1NLS0 | 263 | PCNA "Proliferating cell nucle | 0.935 | 0.220 | 0.706 | 2.9e-16 |
| FB|FBgn0005655 mus209 "mutagen-sensitive 209" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
Identities = 44/61 (72%), Positives = 49/61 (80%)
Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
MQEPV+L FACRYL F KA PLS QV LSM DVPLVVE+ I D+GHIRYYLAPKIE +
Sbjct: 199 MQEPVTLTFACRYLNAFTKATPLSTQVQLSMCADVPLVVEYAIKDLGHIRYYLAPKIEDN 258
Query: 61 D 61
+
Sbjct: 259 E 259
|
|
| UNIPROTKB|P12004 PCNA "Proliferating cell nuclear antigen" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61258 PCNA "Proliferating cell nuclear antigen" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P57761 PCNA "Proliferating cell nuclear antigen" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBW4 PCNA "Proliferating cell nuclear antigen" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0D6 PCNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L813 PCNA "Proliferating cell nuclear antigen" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|3269 Pcna "proliferating cell nuclear antigen" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97503 Pcna "proliferating cell nuclear antigen" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLS0 PCNA "Proliferating cell nuclear antigen" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 62 | |||
| PLN00057 | 263 | PLN00057, PLN00057, proliferating cell nuclear ant | 2e-29 | |
| TIGR00590 | 259 | TIGR00590, pcna, proliferating cell nuclear antige | 4e-28 | |
| pfam02747 | 128 | pfam02747, PCNA_C, Proliferating cell nuclear anti | 5e-27 | |
| cd00577 | 248 | cd00577, PCNA, Proliferating Cell Nuclear Antigen | 5e-20 | |
| PTZ00483 | 264 | PTZ00483, PTZ00483, proliferating cell nuclear ant | 5e-11 | |
| PTZ00113 | 275 | PTZ00113, PTZ00113, proliferating cell nuclear ant | 1e-09 | |
| PRK01115 | 247 | PRK01115, PRK01115, DNA polymerase sliding clamp; | 1e-08 | |
| PHA03383 | 262 | PHA03383, PHA03383, PCNA-like protein; Provisional | 3e-06 |
| >gnl|CDD|177688 PLN00057, PLN00057, proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
Score = 103 bits (259), Expect = 2e-29
Identities = 40/62 (64%), Positives = 52/62 (83%)
Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESD 60
MQEPVSL FA RYL +F KA PLS+ V LS+S ++P+VVE+KI ++G+IRYYLAPKIE D
Sbjct: 199 MQEPVSLTFALRYLNSFTKATPLSDTVTLSLSKELPVVVEYKIAEMGYIRYYLAPKIEED 258
Query: 61 DN 62
++
Sbjct: 259 ED 260
|
Length = 263 |
| >gnl|CDD|188067 TIGR00590, pcna, proliferating cell nuclear antigen (pcna) | Back alignment and domain information |
|---|
| >gnl|CDD|202372 pfam02747, PCNA_C, Proliferating cell nuclear antigen, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238322 cd00577, PCNA, Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|185661 PTZ00483, PTZ00483, proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240275 PTZ00113, PTZ00113, proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234903 PRK01115, PRK01115, DNA polymerase sliding clamp; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177619 PHA03383, PHA03383, PCNA-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| PTZ00113 | 275 | proliferating cell nuclear antigen; Provisional | 99.9 | |
| PF02747 | 128 | PCNA_C: Proliferating cell nuclear antigen, C-term | 99.9 | |
| PLN00057 | 263 | proliferating cell nuclear antigen; Provisional | 99.89 | |
| PTZ00483 | 264 | proliferating cell nuclear antigen; Provisional | 99.89 | |
| TIGR00590 | 259 | pcna proliferating cell nuclear antigen (pcna). Al | 99.89 | |
| PHA03383 | 262 | PCNA-like protein; Provisional | 99.87 | |
| KOG1636|consensus | 260 | 99.87 | ||
| PRK01115 | 247 | DNA polymerase sliding clamp; Validated | 99.5 | |
| cd00577 | 248 | PCNA Proliferating Cell Nuclear Antigen (PCNA) dom | 99.3 | |
| COG0592 | 364 | DnaN DNA polymerase sliding clamp subunit (PCNA ho | 98.12 | |
| cd00140 | 365 | beta_clamp Beta clamp domain. The beta subunit (pr | 97.77 | |
| PRK05643 | 367 | DNA polymerase III subunit beta; Validated | 97.46 | |
| PF02768 | 121 | DNA_pol3_beta_3: DNA polymerase III beta subunit, | 96.24 | |
| PRK14947 | 384 | DNA polymerase III subunit beta; Provisional | 95.11 | |
| PRK14940 | 367 | DNA polymerase III subunit beta; Provisional | 93.99 | |
| KOG3194|consensus | 279 | 93.82 | ||
| PRK14945 | 362 | DNA polymerase III subunit beta; Provisional | 93.46 | |
| smart00480 | 345 | POL3Bc DNA polymerase III beta subunit. | 92.97 | |
| PF04005 | 292 | Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, | 92.76 | |
| cd00577 | 248 | PCNA Proliferating Cell Nuclear Antigen (PCNA) dom | 92.05 | |
| PRK14941 | 374 | DNA polymerase III subunit beta; Provisional | 91.78 | |
| PRK14942 | 373 | DNA polymerase III subunit beta; Provisional | 90.66 | |
| PRK14943 | 374 | DNA polymerase III subunit beta; Provisional | 90.6 | |
| PRK06673 | 376 | DNA polymerase III subunit beta; Validated | 90.55 | |
| TIGR00663 | 367 | dnan DNA polymerase III, beta subunit. University) | 90.02 | |
| PRK14944 | 375 | DNA polymerase III subunit beta; Provisional | 89.59 | |
| PRK07761 | 376 | DNA polymerase III subunit beta; Validated | 88.58 | |
| PRK14946 | 366 | DNA polymerase III subunit beta; Provisional | 88.43 | |
| PF04139 | 252 | Rad9: Rad9; InterPro: IPR007268 Rad9 is required f | 86.33 | |
| PF00705 | 127 | PCNA_N: Proliferating cell nuclear antigen, N-term | 85.62 | |
| PF02144 | 275 | Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IP | 84.71 | |
| COG0592 | 364 | DnaN DNA polymerase sliding clamp subunit (PCNA ho | 83.58 |
| >PTZ00113 proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.2e-23 Score=144.23 Aligned_cols=62 Identities=35% Similarity=0.744 Sum_probs=57.8
Q ss_pred CCCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCC----------CeEEEEEEeecCCCCCC
Q psy5572 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDD----------IGHIRYYLAPKIESDDN 62 (62)
Q Consensus 1 ~~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~----------~g~l~~~lAPrie~e~~ 62 (62)
++++++++||++||++|+||+++|++|+|+|++|+||+++|++++ +|+|+||||||+++|++
T Consensus 201 v~~~~~~~ysl~YL~~f~Ka~~ls~~V~l~l~~d~Pl~ley~i~~~~~~~~~~~~~G~l~fyLAPkie~~~~ 272 (275)
T PTZ00113 201 VRKPIKQSYATKYLNMFAKSGCLSDVVTLGLSDNRPIEVKYEIKDTSPDARHTHKLGEVKFFLAPKMDDDMD 272 (275)
T ss_pred ecCceeeEEhHHHHHHhhccccCCCeEEEEEcCCCCEEEEEEeccccccccccCCccEEEEEEcCccCcccc
Confidence 368999999999999999999999999999999999999999962 59999999999998874
|
|
| >PF02747 PCNA_C: Proliferating cell nuclear antigen, C-terminal domain; InterPro: IPR022649 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] | Back alignment and domain information |
|---|
| >PLN00057 proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
| >PTZ00483 proliferating cell nuclear antigen; Provisional | Back alignment and domain information |
|---|
| >TIGR00590 pcna proliferating cell nuclear antigen (pcna) | Back alignment and domain information |
|---|
| >PHA03383 PCNA-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1636|consensus | Back alignment and domain information |
|---|
| >PRK01115 DNA polymerase sliding clamp; Validated | Back alignment and domain information |
|---|
| >cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea | Back alignment and domain information |
|---|
| >COG0592 DnaN DNA polymerase sliding clamp subunit (PCNA homolog) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00140 beta_clamp Beta clamp domain | Back alignment and domain information |
|---|
| >PRK05643 DNA polymerase III subunit beta; Validated | Back alignment and domain information |
|---|
| >PF02768 DNA_pol3_beta_3: DNA polymerase III beta subunit, C-terminal domain; InterPro: IPR022635 This entry describes the C-terminal domain of the beta chain of DNA polymerase III | Back alignment and domain information |
|---|
| >PRK14947 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14940 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG3194|consensus | Back alignment and domain information |
|---|
| >PRK14945 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >smart00480 POL3Bc DNA polymerase III beta subunit | Back alignment and domain information |
|---|
| >PF04005 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast | Back alignment and domain information |
|---|
| >cd00577 PCNA Proliferating Cell Nuclear Antigen (PCNA) domain found in eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK14941 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14942 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14943 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06673 DNA polymerase III subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR00663 dnan DNA polymerase III, beta subunit | Back alignment and domain information |
|---|
| >PRK14944 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK07761 DNA polymerase III subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK14946 DNA polymerase III subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF04139 Rad9: Rad9; InterPro: IPR007268 Rad9 is required for transient cell-cycle arrests and transcriptional induction of DNA repair in response to DNA damage | Back alignment and domain information |
|---|
| >PF00705 PCNA_N: Proliferating cell nuclear antigen, N-terminal domain; InterPro: IPR022648 Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [] that plays a key role in the control of eukaryotic DNA replication [] | Back alignment and domain information |
|---|
| >PF02144 Rad1: Repair protein Rad1/Rec1/Rad17; InterPro: IPR003021 REC1 of Ustilago maydis plays a key role in regulating the genetic system of the fungus | Back alignment and domain information |
|---|
| >COG0592 DnaN DNA polymerase sliding clamp subunit (PCNA homolog) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 62 | ||||
| 1axc_A | 261 | Human Pcna Length = 261 | 1e-18 | ||
| 1axc_C | 261 | Human Pcna Length = 261 | 1e-18 | ||
| 2zvv_A | 276 | Crystal Structure Of Proliferating Cellular Nuclear | 3e-16 | ||
| 2zvw_A | 275 | Crystal Structure Of Proliferating Cell Nuclear Ant | 3e-15 | ||
| 3p91_A | 265 | Crystal Structure Of Proliferating Cellular Nuclear | 1e-06 | ||
| 3l0w_B | 169 | Structure Of Split Monoubiquitinated Pcna With Ubiq | 2e-06 | ||
| 3l0x_B | 94 | Structure Of Split Yeast Pcna Length = 94 | 2e-06 | ||
| 3k4x_A | 798 | Eukaryotic Sliding Clamp Pcna Bound To Dna Length = | 2e-06 | ||
| 3gpm_A | 258 | Structure Of The Trimeric Form Of The E113g Pcna Mu | 3e-06 | ||
| 3v60_B | 258 | Structure Of S. Cerevisiae Pcna Conjugated To Sumo | 3e-06 | ||
| 2od8_A | 258 | Structure Of A Peptide Derived From Cdc9 Bound To P | 3e-06 | ||
| 3f1w_A | 258 | Crystal Structure Of A Mutant Proliferating Cell Nu | 3e-06 | ||
| 3pge_A | 200 | Structure Of Sumoylated Pcna Length = 200 | 4e-06 | ||
| 1sxj_F | 283 | Crystal Structure Of The Eukaryotic Clamp Loader (R | 3e-05 |
| >pdb|1AXC|A Chain A, Human Pcna Length = 261 | Back alignment and structure |
|
| >pdb|1AXC|C Chain C, Human Pcna Length = 261 | Back alignment and structure |
| >pdb|2ZVV|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen 1 And Short Peptide From Human P21 Length = 276 | Back alignment and structure |
| >pdb|2ZVW|A Chain A, Crystal Structure Of Proliferating Cell Nuclear Antigen 2 And Short Peptide From Human P21 Length = 275 | Back alignment and structure |
| >pdb|3P91|A Chain A, Crystal Structure Of Proliferating Cellular Nuclear Antigen From Entamoeba Histolytica Length = 265 | Back alignment and structure |
| >pdb|3L0W|B Chain B, Structure Of Split Monoubiquitinated Pcna With Ubiquitin In Position Two Length = 169 | Back alignment and structure |
| >pdb|3L0X|B Chain B, Structure Of Split Yeast Pcna Length = 94 | Back alignment and structure |
| >pdb|3K4X|A Chain A, Eukaryotic Sliding Clamp Pcna Bound To Dna Length = 798 | Back alignment and structure |
| >pdb|3GPM|A Chain A, Structure Of The Trimeric Form Of The E113g Pcna Mutant Protein Length = 258 | Back alignment and structure |
| >pdb|3V60|B Chain B, Structure Of S. Cerevisiae Pcna Conjugated To Sumo On Lysine 164 Length = 258 | Back alignment and structure |
| >pdb|2OD8|A Chain A, Structure Of A Peptide Derived From Cdc9 Bound To Pcna Length = 258 | Back alignment and structure |
| >pdb|3F1W|A Chain A, Crystal Structure Of A Mutant Proliferating Cell Nuclear Antigen That Blocks Translesion Synthesis Length = 258 | Back alignment and structure |
| >pdb|3PGE|A Chain A, Structure Of Sumoylated Pcna Length = 200 | Back alignment and structure |
| >pdb|1SXJ|F Chain F, Crystal Structure Of The Eukaryotic Clamp Loader (Replication Factor C, Rfc) Bound To The Dna Sliding Clamp (Proliferating Cell Nuclear Antigen, Pcna) Length = 283 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 62 | |||
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 1e-23 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 6e-23 | |
| 1u7b_A | 261 | PCNA, cyclin, proliferating cell nuclear antigen; | 1e-19 | |
| 3lx2_A | 259 | DNA polymerase sliding clamp 2; PCNA, DNA processi | 1e-19 | |
| 1plq_A | 258 | Proliferating cell nuclear antigen (PCNA); DNA-bin | 4e-18 | |
| 2zvv_A | 276 | PCNA 1, proliferating cellular nuclear antigen 1; | 8e-18 | |
| 3aiz_C | 246 | DNA polymerase sliding clamp C; protein-protein co | 2e-17 | |
| 3aiz_A | 248 | DNA polymerase sliding clamp B; protein-protein co | 2e-17 | |
| 3k4x_A | 798 | PCNA, proliferating cell nuclear antigen; DNA repl | 2e-17 | |
| 3k4x_A | 798 | PCNA, proliferating cell nuclear antigen; DNA repl | 4e-14 | |
| 3k4x_A | 798 | PCNA, proliferating cell nuclear antigen; DNA repl | 4e-14 | |
| 3p91_A | 265 | Proliferating cell nuclear antigen; DNA binding pr | 4e-17 | |
| 1iz5_A | 249 | Proliferating cell nuclear antigen; DNA, replicati | 6e-17 | |
| 2ijx_A | 244 | DNA polymerase sliding clamp A; PCNA3 subunit, pro | 7e-17 | |
| 3ifv_A | 247 | PCNA; processivity factor, sliding clamp, halophil | 9e-17 | |
| 1ud9_A | 245 | DNA polymerase sliding clamp A; DNA-binding, DNA r | 1e-16 | |
| 3fds_C | 249 | DNA polymerase sliding clamp B; protein-protein co | 2e-16 | |
| 1rwz_A | 245 | DNA polymerase sliding clamp; torus, processivity | 4e-16 | |
| 3fds_D | 245 | DNA polymerase sliding clamp C; protein-protein co | 1e-15 | |
| 3a1j_C | 263 | Cell cycle checkpoint protein RAD1; DNA damage, DN | 1e-07 |
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Length = 169 | Back alignment and structure |
|---|
Score = 85.8 bits (212), Expect = 1e-23
Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIE 58
M +PV L F +YLL+ K + LS++V + +S + P + +F + G ++++LAPK
Sbjct: 113 MDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFN 169
|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Length = 200 | Back alignment and structure |
|---|
| >1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* Length = 261 | Back alignment and structure |
|---|
| >3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} Length = 259 | Back alignment and structure |
|---|
| >1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B Length = 258 | Back alignment and structure |
|---|
| >2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A Length = 276 | Back alignment and structure |
|---|
| >3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* Length = 246 | Back alignment and structure |
|---|
| >3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* Length = 248 | Back alignment and structure |
|---|
| >3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 | Back alignment and structure |
|---|
| >3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 | Back alignment and structure |
|---|
| >3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} Length = 798 | Back alignment and structure |
|---|
| >3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} Length = 265 | Back alignment and structure |
|---|
| >1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* Length = 249 | Back alignment and structure |
|---|
| >2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* Length = 244 | Back alignment and structure |
|---|
| >3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A Length = 247 | Back alignment and structure |
|---|
| >1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 Length = 245 | Back alignment and structure |
|---|
| >3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* Length = 249 | Back alignment and structure |
|---|
| >1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* Length = 245 | Back alignment and structure |
|---|
| >3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* Length = 245 | Back alignment and structure |
|---|
| >3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C Length = 263 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 99.92 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.91 | |
| 3fds_C | 249 | DNA polymerase sliding clamp B; protein-protein co | 99.84 | |
| 3p91_A | 265 | Proliferating cell nuclear antigen; DNA binding pr | 99.84 | |
| 3ifv_A | 247 | PCNA; processivity factor, sliding clamp, halophil | 99.81 | |
| 3k4x_A | 798 | PCNA, proliferating cell nuclear antigen; DNA repl | 99.8 | |
| 3k4x_A | 798 | PCNA, proliferating cell nuclear antigen; DNA repl | 99.78 | |
| 3lx2_A | 259 | DNA polymerase sliding clamp 2; PCNA, DNA processi | 99.77 | |
| 3fds_D | 245 | DNA polymerase sliding clamp C; protein-protein co | 99.75 | |
| 1plq_A | 258 | Proliferating cell nuclear antigen (PCNA); DNA-bin | 99.69 | |
| 1u7b_A | 261 | PCNA, cyclin, proliferating cell nuclear antigen; | 99.68 | |
| 3a1j_C | 263 | Cell cycle checkpoint protein RAD1; DNA damage, DN | 99.67 | |
| 2zvv_A | 276 | PCNA 1, proliferating cellular nuclear antigen 1; | 99.61 | |
| 1rwz_A | 245 | DNA polymerase sliding clamp; torus, processivity | 99.54 | |
| 1iz5_A | 249 | Proliferating cell nuclear antigen; DNA, replicati | 99.53 | |
| 3aiz_C | 246 | DNA polymerase sliding clamp C; protein-protein co | 99.52 | |
| 1ud9_A | 245 | DNA polymerase sliding clamp A; DNA-binding, DNA r | 99.5 | |
| 3aiz_A | 248 | DNA polymerase sliding clamp B; protein-protein co | 99.49 | |
| 2ijx_A | 244 | DNA polymerase sliding clamp A; PCNA3 subunit, pro | 99.48 | |
| 3a1j_B | 281 | HHUS1, checkpoint protein HUS1; DNA damage, DNA re | 99.21 | |
| 3a1j_A | 266 | Cell cycle checkpoint control protein RAD9A; DNA d | 98.97 | |
| 3g65_A | 296 | Cell cycle checkpoint control protein RAD9A; PCNA, | 98.26 | |
| 1vpk_A | 378 | DNA polymerase III, beta subunit; TM0262, structur | 97.65 | |
| 3d1g_A | 366 | DNA polymerase III subunit beta; chemical probe, D | 97.51 | |
| 2avt_A | 378 | DNA polymerase III beta subunit; beta clamp, slidi | 97.44 | |
| 3t0p_A | 371 | DNA polymerase III, beta subunit; DNA clamp, struc | 95.58 | |
| 3p16_A | 408 | DNA polymerase III subunit beta; DNA polymerase II | 92.04 | |
| 3p91_A | 265 | Proliferating cell nuclear antigen; DNA binding pr | 90.78 | |
| 1plq_A | 258 | Proliferating cell nuclear antigen (PCNA); DNA-bin | 81.19 |
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.92 E-value=2e-25 Score=146.93 Aligned_cols=60 Identities=33% Similarity=0.786 Sum_probs=55.2
Q ss_pred CCCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeecCCCCC
Q psy5572 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD 61 (62)
Q Consensus 1 ~~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~~g~l~~~lAPrie~e~ 61 (62)
+++|++++||++||++|+||+++|++|+|+|++++||+++|+++ +|+|+|||||||++|+
T Consensus 141 ~~e~v~~~fsl~YL~~f~Ka~~ls~~V~l~l~~~~Pl~l~y~i~-~G~l~f~LAPrie~~~ 200 (200)
T 3pge_A 141 MDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLK-SGFLQFFLAPKFNDEE 200 (200)
T ss_dssp ESSCEEEEEEHHHHHHHGGGGGGCSEEEEEECSSSCEEEEEEET-TEEEEEEECCCCC---
T ss_pred eCCcceeeEhHHHHHHHhccccCCCeEEEEEcCCCCEEEEEEEC-CEEEEEEECCccCCCC
Confidence 36899999999999999999999999999999999999999997 8999999999999875
|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >3fds_C DNA polymerase sliding clamp B; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C* | Back alignment and structure |
|---|
| >3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3ifv_A PCNA; processivity factor, sliding clamp, halophilic, replication; 2.00A {Haloferax volcanii} PDB: 3hi8_A | Back alignment and structure |
|---|
| >3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k4x_A PCNA, proliferating cell nuclear antigen; DNA replication, DNA-binding; HET: DNA; 2.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lx2_A DNA polymerase sliding clamp 2; PCNA, DNA processivity factor, trimer, toroidal, DNA replica DNA-binding, DNA binding protein; HET: DNA; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >3fds_D DNA polymerase sliding clamp C; protein-protein complex, DNA damage, DNA repair, DNA replica DNA-binding, DNA-directed DNA polymerase; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2nti_E* 2io4_B* 2ix2_B* 2hik_B 2hii_B* 2izo_B* | Back alignment and structure |
|---|
| >1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B | Back alignment and structure |
|---|
| >1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A* 3p87_A 3vkx_A* | Back alignment and structure |
|---|
| >3a1j_C Cell cycle checkpoint protein RAD1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_B 3ggr_C | Back alignment and structure |
|---|
| >2zvv_A PCNA 1, proliferating cellular nuclear antigen 1; protein-peptide complex, DNA replication, DNA-binding, nucleus, DNA binding protein; 2.00A {Arabidopsis thaliana} PDB: 2zvw_A | Back alignment and structure |
|---|
| >1rwz_A DNA polymerase sliding clamp; torus, processivity factor, replication; HET: DNA; 1.80A {Archaeoglobus fulgidus} SCOP: d.131.1.2 d.131.1.2 PDB: 1rxm_A* 1rxz_A* 3p83_A* | Back alignment and structure |
|---|
| >1iz5_A Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus} SCOP: d.131.1.2 d.131.1.2 PDB: 3a2f_B* 1iz4_A 1ge8_A 1isq_A 3lx1_A* | Back alignment and structure |
|---|
| >3aiz_C DNA polymerase sliding clamp C; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_A* | Back alignment and structure |
|---|
| >1ud9_A DNA polymerase sliding clamp A; DNA-binding, DNA replication, DNA binding protein; HET: DNA; 1.68A {Sulfolobus tokodaii} SCOP: d.131.1.2 d.131.1.2 | Back alignment and structure |
|---|
| >3aiz_A DNA polymerase sliding clamp B; protein-protein complex, replication; HET: DNA; 2.80A {Sulfolobus tokodaii} PDB: 3aix_B* | Back alignment and structure |
|---|
| >2ijx_A DNA polymerase sliding clamp A; PCNA3 subunit, protein-protein interaction, PCNA123 heterotr binding protein; HET: DNA; 1.90A {Sulfolobus solfataricus} PDB: 2nti_F* 2hii_C 2hik_C 2ix2_C* | Back alignment and structure |
|---|
| >3a1j_B HHUS1, checkpoint protein HUS1; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3g65_C 3ggr_B | Back alignment and structure |
|---|
| >3a1j_A Cell cycle checkpoint control protein RAD9A; DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein, polymorphism, cytoplasm; HET: SUC; 2.50A {Homo sapiens} PDB: 3ggr_A | Back alignment and structure |
|---|
| >3g65_A Cell cycle checkpoint control protein RAD9A; PCNA, DNA binding clamp, DNA damage, DNA repair, exonuclease, hydrolase, nuclease, nucleus, phosphoprotein; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1vpk_A DNA polymerase III, beta subunit; TM0262, structural genomic center for structural genomics, JCSG, protein structure INI PSI, transferase; HET: DNA; 2.00A {Thermotoga maritima} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 | Back alignment and structure |
|---|
| >3d1g_A DNA polymerase III subunit beta; chemical probe, DNA sliding clamp, DNA replication, rational drug design, antibiotic target, transferase; HET: DNA 322; 1.64A {Escherichia coli} SCOP: d.131.1.1 d.131.1.1 d.131.1.1 PDB: 1mmi_A* 1unn_A* 2pol_A* 3bep_A* 3d1e_A* 3d1f_A* 1ok7_A* 3q4j_A* 3q4k_A* 3qsb_A* 3q4l_A* 2xur_A* 1jql_A* 1jqj_A* 3f1v_A* 3pwe_A* | Back alignment and structure |
|---|
| >2avt_A DNA polymerase III beta subunit; beta clamp, sliding clamp, replication, transferase; HET: DNA; 2.00A {Streptococcus pyogenes} PDB: 2awa_A* | Back alignment and structure |
|---|
| >3t0p_A DNA polymerase III, beta subunit; DNA clamp, structural genomics, joint center for structural JCSG, protein structure initiative; HET: DNA MSE; 2.26A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3p16_A DNA polymerase III subunit beta; DNA polymerase III sliding clamp, transferase; HET: DNA; 2.89A {Mycobacterium tuberculosis} PDB: 3rb9_A* | Back alignment and structure |
|---|
| >3p91_A Proliferating cell nuclear antigen; DNA binding protein, DNA replication, processivity, sliding; 2.40A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3v60_B 3v61_B 3v62_B* 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3pge_B 3l0x_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 62 | ||||
| d1u7ba2 | 129 | d.131.1.2 (A:127-255) Proliferating cell nuclear a | 1e-19 | |
| d1plqa2 | 132 | d.131.1.2 (A:127-258) Proliferating cell nuclear a | 9e-19 | |
| d1ud9a2 | 119 | d.131.1.2 (A:127-245) Proliferating cell nuclear a | 1e-18 | |
| d1rwza2 | 122 | d.131.1.2 (A:123-244) Proliferating cell nuclear a | 1e-17 | |
| d1iz5a2 | 121 | d.131.1.2 (A:126-246) Proliferating cell nuclear a | 1e-17 |
| >d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: DNA clamp superfamily: DNA clamp family: DNA polymerase processivity factor domain: Proliferating cell nuclear antigen (PCNA) species: Human (Homo sapiens) [TaxId: 9606]
Score = 73.9 bits (181), Expect = 1e-19
Identities = 40/57 (70%), Positives = 45/57 (78%)
Query: 1 MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKI 57
M EPV L FA RYL F KA PLS+ V LSMS DVPLVVE+KI D+GH++YYLAPKI
Sbjct: 73 MNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKI 129
|
| >d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 | Back information, alignment and structure |
|---|
| >d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 119 | Back information, alignment and structure |
|---|
| >d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 122 | Back information, alignment and structure |
|---|
| >d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 62 | |||
| d1plqa2 | 132 | Proliferating cell nuclear antigen (PCNA) {Baker's | 99.91 | |
| d1rwza2 | 122 | Proliferating cell nuclear antigen (PCNA) {Archaeo | 99.9 | |
| d1ud9a2 | 119 | Proliferating cell nuclear antigen (PCNA) {Archaeo | 99.88 | |
| d1iz5a2 | 121 | Proliferating cell nuclear antigen (PCNA) {Archaeo | 99.88 | |
| d1u7ba2 | 129 | Proliferating cell nuclear antigen (PCNA) {Human ( | 99.87 | |
| d1vpka3 | 123 | DNA polymerase III, beta subunit {Thermotoga marit | 95.81 | |
| d1ok7a3 | 122 | DNA polymerase III, beta subunit {Escherichia coli | 93.97 | |
| d1rwza1 | 122 | Proliferating cell nuclear antigen (PCNA) {Archaeo | 86.02 | |
| d1ud9a1 | 119 | Proliferating cell nuclear antigen (PCNA) {Archaeo | 85.01 |
| >d1plqa2 d.131.1.2 (A:127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: DNA clamp superfamily: DNA clamp family: DNA polymerase processivity factor domain: Proliferating cell nuclear antigen (PCNA) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91 E-value=1.9e-24 Score=130.28 Aligned_cols=59 Identities=32% Similarity=0.789 Sum_probs=56.3
Q ss_pred CCceeeEEehHHHHhhhcccCCCceEEEEeeCCCcEEEEEEeCCCeEEEEEEeecCCCCC
Q psy5572 2 QEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD 61 (62)
Q Consensus 2 ~~~~~~~ysl~YL~~~~Ka~~ls~~V~l~l~~~~Pl~l~~~l~~~g~l~~~lAPrie~e~ 61 (62)
+++++++|+++||+.|+|++++|+.|+|+|++++||+++|++++ |+|+||||||+++||
T Consensus 74 ~~~~~~~ysl~yL~~~~K~~~ls~~V~i~~~~~~Pl~~~y~i~~-g~l~fyLAPkieddd 132 (132)
T d1plqa2 74 DQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKS-GFLQFFLAPKFNDEE 132 (132)
T ss_dssp SSCEEEEEEHHHHHHHGGGGGTCSEEEEEECSSSCEEEEEEETT-EEEEEEECCCSSSCC
T ss_pred ccceeeEEEHHHHHHHhCcccCCCEEEEEEeCCCCEEEEEEeCC-EEEEEEECccCCCCC
Confidence 47789999999999999999999999999999999999999966 999999999999886
|
| >d1rwza2 d.131.1.2 (A:123-244) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ud9a2 d.131.1.2 (A:127-245) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1iz5a2 d.131.1.2 (A:126-246) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u7ba2 d.131.1.2 (A:127-255) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpka3 d.131.1.1 (A:244-366) DNA polymerase III, beta subunit {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rwza1 d.131.1.2 (A:1-122) Proliferating cell nuclear antigen (PCNA) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|