Psyllid ID: psy5573

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDLTK
ccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHcccccEEcHHHHHHccccccc
ccccccccHcHcHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccEHHHHHHcccccHHHHHHHHHHccccccHHHHHHccccHHHHHHHccccccccccEEHEEEcccccccHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccEEEEcccEEEEEEEEccc
mfsgatinVELTPLCAAVWDNNIRLVEYLLRTghdvnekmkldGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLdngadvnfksatgfTALHMACRFHDDDSIVRKLLRHGAyynvvdgktgktpllhagkgarEVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTkefgpgdynnfsLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELtkafgpgdynnfsllkvtkndaGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILegtkefgpgdynnfsLLKVAkndagetilgptmIQLSWIDLTK
mfsgatinVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTkefgpgdynNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELtkafgpgdynnFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKladanndttiLDRLDEMKSLILEGtkefgpgdyNNFSLLKVAKNdagetilgptmiqlswidltk
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPlleelekklADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDLTK
*****TINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWID***
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDL**
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDLTK
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLADANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDLTK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSGATINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDEMKSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLxxxxxxxxxxxxxxxxxxxxxDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPTMIQLSWIDLTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
O90760341 Putative ankyrin repeat p N/A N/A 0.328 0.325 0.380 2e-09
Q502K3 1071 Serine/threonine-protein no N/A 0.366 0.115 0.322 6e-09
Q5UPG5421 Putative ankyrin repeat p N/A N/A 0.340 0.273 0.363 3e-08
Q2T9K6 617 Protein fem-1 homolog C O N/A N/A 0.343 0.188 0.360 4e-08
Q9ULJ7 1429 Ankyrin repeat domain-con yes N/A 0.355 0.083 0.298 7e-08
Q59H18 835 Serine/threonine-protein no N/A 0.349 0.141 0.350 9e-08
Q5GIG6 834 Serine/threonine-protein yes N/A 0.473 0.191 0.301 1e-07
Q5RF15 618 Serine/threonine-protein no N/A 0.434 0.237 0.317 2e-07
Q7T3P8 618 Protein fem-1 homolog C O no N/A 0.334 0.182 0.360 3e-07
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.346 0.099 0.347 4e-07
>sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=4 SV=1 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 15/126 (11%)

Query: 6   TINVELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIH 65
           TI   LTPL  A   N+ +LVE LL  G  +N++    G TAL +AV  ++R        
Sbjct: 55  TIRDNLTPLMIASRFNSHQLVELLLNNGAIINQRSLTCGNTALHLAVKNDNR-------- 106

Query: 66  HGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGK--- 122
                 VD+LL +GA+ N  +  GFT LH A  ++    I++KLLR+ A  N+ D +   
Sbjct: 107 ----ITVDILLFHGANTNITNNDGFTPLHKAVIYNASIDIIKKLLRYKADVNIRDNEEEN 162

Query: 123 TGKTPL 128
           TG TPL
Sbjct: 163 TGLTPL 168

Vertebrata (taxid: 7742)
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=4 SV=1 Back     alignment and function description
>sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 Back     alignment and function description
>sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 Back     alignment and function description
>sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 Back     alignment and function description
>sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
123509077 499 hypothetical protein [Trichomonas vagina 0.369 0.250 0.407 1e-12
154421371278 ankyrin repeat protein [Trichomonas vagi 0.381 0.464 0.398 6e-12
123490071361 ankyrin repeat protein [Trichomonas vagi 0.405 0.379 0.375 2e-11
154415531 922 ankyrin repeat protein [Trichomonas vagi 0.366 0.134 0.370 4e-11
123476544 888 ankyrin repeat protein [Trichomonas vagi 0.443 0.168 0.313 4e-11
123471708 802 ankyrin repeat protein [Trichomonas vagi 0.384 0.162 0.346 5e-11
123489691 611 ankyrin repeat protein [Trichomonas vagi 0.405 0.224 0.363 7e-11
123397491 716 ankyrin repeat protein [Trichomonas vagi 0.402 0.189 0.347 7e-11
123496374 649 ankyrin repeat protein [Trichomonas vagi 0.381 0.198 0.357 8e-11
123476538 744 ankyrin repeat protein [Trichomonas vagi 0.355 0.161 0.358 8e-11
>gi|123509077|ref|XP_001329781.1| hypothetical protein [Trichomonas vaginalis G3] gi|121912829|gb|EAY17646.1| conserved hypothetical protein [Trichomonas vaginalis G3] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 81/152 (53%), Gaps = 27/152 (17%)

Query: 4   GATIN---VELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIA 60
           GA IN    E T    A++ NN  +VE LL  G ++NEK++ DG+T LF AV  N R I 
Sbjct: 260 GANINDKYNEETAFHKAIFCNNKDMVELLLLYGKNINEKVE-DGKTHLFEAVEKNRREIV 318

Query: 61  ALLIHHGA---------------------KEIVDLLLDNGADVNFKSATGFTALHMACRF 99
            LLI HGA                     K+ V+LL+ +GA +N K ATG TALH A   
Sbjct: 319 ELLISHGANINEKDDYGRTPFHFSVKYFEKDTVELLISHGASINEKDATGKTALHYAV-I 377

Query: 100 HDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHA 131
           +++ + V  L+ HGA  N  D  TGKT L +A
Sbjct: 378 NNNKATVELLISHGASINEKDA-TGKTALHYA 408

Source: Trichomonas vaginalis G3

Species: Trichomonas vaginalis

Genus: Trichomonas

Family: Trichomonadidae

Order: Trichomonadida

Class:

Phylum:

Superkingdom: Eukaryota
>gi|154421371|ref|XP_001583699.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121917942|gb|EAY22713.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123490071|ref|XP_001325527.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121908428|gb|EAY13304.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|154415531|ref|XP_001580790.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121915011|gb|EAY19804.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123476544|ref|XP_001321444.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121904270|gb|EAY09221.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123471708|ref|XP_001319052.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121901826|gb|EAY06829.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123489691|ref|XP_001325450.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121908349|gb|EAY13227.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123397491|ref|XP_001301098.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121882233|gb|EAX88168.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123496374|ref|XP_001326954.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121909876|gb|EAY14731.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information
>gi|123476538|ref|XP_001321441.1| ankyrin repeat protein [Trichomonas vaginalis G3] gi|121904267|gb|EAY09218.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
UNIPROTKB|Q59H18 835 TNNI3K "Serine/threonine-prote 0.346 0.140 0.353 1.3e-07
TAIR|locus:2091702 481 AT3G24530 [Arabidopsis thalian 0.366 0.257 0.344 2.8e-07
UNIPROTKB|F6Y5Y4 1151 TNKS2 "Uncharacterized protein 0.384 0.112 0.349 1.9e-05
MGI|MGI:1913979421 Ankrd61 "ankyrin repeat domain 0.449 0.361 0.312 7.9e-07
UNIPROTKB|F1P6V7 835 TNNI3K "Uncharacterized protei 0.346 0.140 0.345 8e-07
UNIPROTKB|E2R3B3 1166 TNKS2 "Uncharacterized protein 0.384 0.111 0.349 1.9e-05
RGD|1305026 1166 Tnks2 "tankyrase, TRF1-interac 0.384 0.111 0.342 5.4e-05
UNIPROTKB|Q9H2K2 1166 TNKS2 "Tankyrase-2" [Homo sapi 0.384 0.111 0.342 5.4e-05
UNIPROTKB|F1SCW9 1166 TNKS2 "Uncharacterized protein 0.384 0.111 0.342 5.4e-05
UNIPROTKB|F1N8D6 1100 TNKS2 "Uncharacterized protein 0.384 0.118 0.335 5.9e-05
UNIPROTKB|Q59H18 TNNI3K "Serine/threonine-protein kinase TNNI3K" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 152 (58.6 bits), Expect = 1.3e-07, P = 1.3e-07
 Identities = 47/133 (35%), Positives = 71/133 (53%)

Query:    12 TPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEI 71
             T L  AV+ +N  L+  LL +G D+ +++   G TAL         HIA +  H    E 
Sbjct:   103 TALHLAVYKDNAELITSLLHSGADI-QQVGYGGLTAL---------HIATIAGH---LEA 149

Query:    72 VDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPL-LH 130
              D+LL +GA+VN + A  FT LH+A  ++  + + R LL+ GA  NV  G+ G  PL L 
Sbjct:   150 ADVLLQHGANVNIQDAVFFTPLHIAA-YYGHEQVTRLLLKFGADVNV-SGEVGDRPLHLA 207

Query:   131 AGKGAREVNTVLL 143
             + KG   +  +L+
Sbjct:   208 SAKGFLNIAKLLM 220
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0008022 "protein C-terminus binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0004672 "protein kinase activity" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IDA
GO:0031013 "troponin I binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2091702 AT3G24530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y5Y4 TNKS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913979 Ankrd61 "ankyrin repeat domain 61" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6V7 TNNI3K "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3B3 TNKS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1305026 Tnks2 "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2K2 TNKS2 "Tankyrase-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCW9 TNKS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8D6 TNKS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-13
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-05
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 6e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 90.5 bits (225), Expect = 2e-22
 Identities = 56/133 (42%), Positives = 71/133 (53%), Gaps = 16/133 (12%)

Query: 12  TPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEI 71
           TPL  A  + ++ +V+ LL  G DVN K   DGRT L +A    H             EI
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADVNAKDN-DGRTPLHLAAKNGH------------LEI 55

Query: 72  VDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHA 131
           V LLL+ GADVN +   G T LH+A R  + D +V+ LL+HGA  N  D K G+TPL  A
Sbjct: 56  VKLLLEKGADVNARDKDGNTPLHLAARNGNLD-VVKLLLKHGADVNARD-KDGRTPLHLA 113

Query: 132 -GKGAREVNTVLL 143
              G  EV  +LL
Sbjct: 114 AKNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG4177|consensus 1143 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG4177|consensus 1143 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 99.98
KOG0509|consensus 600 99.98
KOG4412|consensus226 99.97
PHA02989 494 ankyrin repeat protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02917 661 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0509|consensus 600 99.96
PHA02878 477 ankyrin repeat protein; Provisional 99.96
KOG0508|consensus 615 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.96
PHA02798 489 ankyrin-like protein; Provisional 99.95
KOG0508|consensus 615 99.94
PHA02795 437 ankyrin-like protein; Provisional 99.94
PHA02792 631 ankyrin-like protein; Provisional 99.93
PHA02795437 ankyrin-like protein; Provisional 99.92
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02741169 hypothetical protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
KOG0505|consensus 527 99.88
KOG0507|consensus 854 99.87
KOG0502|consensus296 99.87
KOG0505|consensus527 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.86
KOG4369|consensus 2131 99.85
KOG0502|consensus296 99.85
KOG0512|consensus228 99.85
PHA02736154 Viral ankyrin protein; Provisional 99.84
KOG0514|consensus452 99.84
KOG4369|consensus 2131 99.83
KOG0195|consensus 448 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
KOG0512|consensus228 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.81
KOG0514|consensus452 99.81
PHA02884300 ankyrin repeat protein; Provisional 99.78
KOG0507|consensus 854 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.74
PHA02741169 hypothetical protein; Provisional 99.74
PHA02736154 Viral ankyrin protein; Provisional 99.74
KOG0195|consensus 448 99.73
KOG4214|consensus117 99.72
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.61
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.59
KOG3676|consensus 782 99.59
KOG3676|consensus 782 99.57
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.57
KOG4214|consensus117 99.54
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
KOG0515|consensus752 99.53
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.44
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.42
KOG1710|consensus396 99.38
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.35
KOG1710|consensus396 99.34
KOG0515|consensus752 99.33
KOG0818|consensus 669 99.04
KOG0506|consensus622 99.0
KOG0783|consensus 1267 98.96
PF1360630 Ank_3: Ankyrin repeat 98.95
KOG0782|consensus1004 98.91
PF1360630 Ank_3: Ankyrin repeat 98.9
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.86
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
KOG0783|consensus 1267 98.78
KOG0506|consensus622 98.72
KOG0818|consensus 669 98.67
KOG0522|consensus 560 98.67
KOG0521|consensus785 98.53
KOG0705|consensus749 98.53
KOG0705|consensus749 98.49
KOG0522|consensus 560 98.41
KOG0782|consensus1004 98.37
KOG0521|consensus785 98.2
KOG2384|consensus223 98.2
KOG3609|consensus 822 98.2
KOG0511|consensus 516 98.18
KOG2384|consensus223 98.17
KOG0511|consensus 516 98.07
KOG0520|consensus975 98.05
KOG3609|consensus 822 97.68
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.36
KOG0520|consensus975 97.17
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.97
KOG2505|consensus591 96.81
KOG2505|consensus591 96.6
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.22
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.02
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.97
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 83.95
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 81.33
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.7e-40  Score=298.08  Aligned_cols=297  Identities=17%  Similarity=0.155  Sum_probs=213.0

Q ss_pred             CCCCCCCCC----CCcHHHHHHHcCCHHHHHHHHhcCCCCCccccCCCCcHHHHHHHcCCHHHHHHHHHcCHHHHHHHHH
Q psy5573           1 MFSGATINV----ELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKEIVDLLL   76 (338)
Q Consensus         1 l~~g~~~n~----G~t~Lh~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~Ll   76 (338)
                      |++|+++|.    |.||||+|+..|+.++|++|+++|++++.++ ..|+||||+|+..++..          .+++++|+
T Consensus        59 l~~Gadvn~~d~~G~TpLh~Aa~~g~~eiv~lLL~~GAdin~~d-~~g~TpLh~A~~~~~~~----------~e~v~lLl  127 (446)
T PHA02946         59 LHRGYSPNETDDDGNYPLHIASKINNNRIVAMLLTHGADPNACD-KQHKTPLYYLSGTDDEV----------IERINLLV  127 (446)
T ss_pred             HHCcCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCC-CCCCCHHHHHHHcCCch----------HHHHHHHH
Confidence            467999998    9999999999999999999999999999888 89999999998876411          26677777


Q ss_pred             HCCCCCcc-cCCCCChHHHHHHHhCCCHHHHHHHHhcCCCCCccCCCCCCCHHHHHhhcCC--hhHHHHHhhhhhhhhhh
Q psy5573          77 DNGADVNF-KSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAR--EVNTVLLYFINEIFKLM  153 (338)
Q Consensus        77 ~~g~~~~~-~~~~g~tpLh~A~~~~~~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~--~~~~~ll~~~~~~~~~~  153 (338)
                      ++|++++. .|.+|.|||| |+.. ++.+++++|++.|++++..+.. |+||||+|+..+.  ..+..++...+.+++..
T Consensus       128 ~~Gadin~~~d~~g~tpL~-aa~~-~~~~vv~~Ll~~gad~~~~d~~-G~t~Lh~A~~~~~~~~~~v~~Ll~~Gadin~~  204 (446)
T PHA02946        128 QYGAKINNSVDEEGCGPLL-ACTD-PSERVFKKIMSIGFEARIVDKF-GKNHIHRHLMSDNPKASTISWMMKLGISPSKP  204 (446)
T ss_pred             HcCCCcccccCCCCCcHHH-HHHC-CChHHHHHHHhccccccccCCC-CCCHHHHHHHhcCCCHHHHHHHHHcCCCCccc
Confidence            88888885 5888999997 5555 8888999999999999888887 9999998874333  34444555556677777


Q ss_pred             cCCCccHHHHHHHH---HHHHHHHHHhcCCCCCCCcchhHHHhhcCCCCHHHHHHHhhcccchhhhhcccccc----chh
Q psy5573         154 ANNDTTILDRLDEM---KSLILEVTKEFGPGDYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMK----SIK  226 (338)
Q Consensus       154 ~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~l~~~~~~~~~~~~~~~~~~~~~~----~~~  226 (338)
                      +..|.|++|.+...   .....+.+.. + .+.       ...+..|.||||+|++.....  .+...+....    .-.
T Consensus       205 d~~G~TpLH~Aa~~~~~~~~iv~lLl~-g-adi-------n~~d~~G~TpLh~A~~~~~~~--~~~~~Ll~~g~~~~~~~  273 (446)
T PHA02946        205 DHDGNTPLHIVCSKTVKNVDIINLLLP-S-TDV-------NKQNKFGDSPLTLLIKTLSPA--HLINKLLSTSNVITDQT  273 (446)
T ss_pred             CCCCCCHHHHHHHcCCCcHHHHHHHHc-C-CCC-------CCCCCCCCCHHHHHHHhCChH--HHHHHHHhCCCCCCCcH
Confidence            88888888887754   2334454443 2 222       256778889999887653211  1111100000    000


Q ss_pred             HHHHhhcCCccchhhhhhhccccccCCCHHHHHHHhCChhHH-HHHHhhcccCCCCCCC------chHHHHHHHHHcCCC
Q psy5573         227 LELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLE-ELEKKLADANNDTTIL------DRLDEMKSLILEGTK  299 (338)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~g~TpLh~A~~~g~~~i~-~ll~~~~d~~~~~~~l------~~~~~v~~Ll~~g~~  299 (338)
                      .......+..++.+.+...  .+..|.||||+|++.|+.+++ +|+.++.   .+.|+|      ++.+++++|+++|+ 
T Consensus       274 ~~~a~~~~~~~~~e~l~~~--g~~~~~TpLh~Aa~~g~~eivk~Ll~~~~---~~~t~L~~A~~~~~~~~v~~Ll~~ga-  347 (446)
T PHA02946        274 VNICIFYDRDDVLEIINDK--GKQYDSTDFKMAVEVGSIRCVKYLLDNDI---ICEDAMYYAVLSEYETMVDYLLFNHF-  347 (446)
T ss_pred             HHHHHHcCchHHHHHHHHc--CcccCCCHHHHHHHcCCHHHHHHHHHCCC---ccccHHHHHHHhCHHHHHHHHHHCCC-
Confidence            1111112222222222111  124688999999999999999 7777654   467788      89999999999999 


Q ss_pred             CCCCCCCCCCcHHHHHHHhcCccchhhhhh
Q psy5573         300 EFGPGDYNNFSLLKVAKNDAGETILGPTMI  329 (338)
Q Consensus       300 ~~~~~d~~g~T~Lh~A~~~~~~~i~~~~~~  329 (338)
                      +++.. .+|.||||+|++..+..++..++.
T Consensus       348 ~~n~~-~~G~t~l~~a~~~~~~~~~~~ll~  376 (446)
T PHA02946        348 SVDSV-VNGHTCMSECVRLNNPVILSKLML  376 (446)
T ss_pred             CCCCc-cccccHHHHHHHcCCHHHHHHHHh
Confidence            89985 689999999999999999877665

>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 8e-04
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-10
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-10
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-09
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-09
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-09
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-08
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-08
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 9e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-06
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 8e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-06
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-05
1uoh_A226 Human Gankyrin Length = 226 2e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 4e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 5e-05
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 6e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 7e-05
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 3e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-04
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 3e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 7e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 8e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 9e-04
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 68/131 (51%), Gaps = 19/131 (14%)
Query: 1   MFSGATINVE----LTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNH 56
           M +GA +N +     TPL  A  + ++ +VE LL+ G DVN K K DG T L +A    H
Sbjct: 22  MANGADVNAKDKDGYTPLHLAAREGHLEIVEVLLKAGADVNAKDK-DGYTPLHLAAREGH 80
Query: 57  RHIAALLIHHGAKEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYY 116
                        EIV++LL  GADVN K   G+T LH+A R      IV  LL+ GA  
Sbjct: 81  L------------EIVEVLLKAGADVNAKDKDGYTPLHLAAR-EGHLEIVEVLLKAGADV 127
Query: 117 NVVDGKTGKTP 127
           N  D K GKTP
Sbjct: 128 NAQD-KFGKTP 137
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-29
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-28
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-27
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-27
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-26
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-26
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-25
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-21
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-26
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-25
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-23
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-25
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-25
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-25
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-23
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-23
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-22
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-22
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-19
2rfa_A232 Transient receptor potential cation channel subfa 1e-17
2rfa_A232 Transient receptor potential cation channel subfa 4e-11
2rfa_A232 Transient receptor potential cation channel subfa 1e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-04
2pnn_A273 Transient receptor potential cation channel subfa 2e-16
2pnn_A273 Transient receptor potential cation channel subfa 2e-13
2pnn_A273 Transient receptor potential cation channel subfa 1e-06
2pnn_A273 Transient receptor potential cation channel subfa 9e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-14
2etb_A256 Transient receptor potential cation channel subfam 2e-11
2etb_A256 Transient receptor potential cation channel subfam 1e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
2pnn_A273 Transient receptor potential cation channel subfa 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.3e-44  Score=327.22  Aligned_cols=322  Identities=24%  Similarity=0.202  Sum_probs=225.0

Q ss_pred             CCCCCCCC----CCcHHHHHHHcCCHHHHHHHHhcCCCCCccccCCCCcHHHHHHHcCCHHHHHHHHHcCH---------
Q psy5573           2 FSGATINV----ELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGA---------   68 (338)
Q Consensus         2 ~~g~~~n~----G~t~Lh~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~---------   68 (338)
                      +.|+++|.    |.||||+|+..|+.++|++|+++|++++..+ ..|.||||+|+..|+.+++++|+++|.         
T Consensus         2 ~~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~-~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g   80 (437)
T 1n11_A            2 SPGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSN-VKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD   80 (437)
T ss_dssp             -------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSS-SCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTS
T ss_pred             CCCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCC-CCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCC
Confidence            35788887    8999999999999999999999999988887 888999999999999999999988765         


Q ss_pred             ------------HHHHHHHHHCCCCCcccCCCCChHHHHHHHhCCCHHHHHHHHhcCCCCCccCCCCCCCHHHHHhhcCC
Q psy5573          69 ------------KEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAR  136 (338)
Q Consensus        69 ------------~~~~~~Ll~~g~~~~~~~~~g~tpLh~A~~~~~~~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~  136 (338)
                                  .+++++|+++|++++.++..|.||||+|+.. |+.+++++|++++++.+..+.. |.||||+|+..+.
T Consensus        81 ~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~-g~~~~v~~Ll~~~~~~~~~~~~-g~t~L~~A~~~g~  158 (437)
T 1n11_A           81 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAARE-GHVETVLALLEKEASQACMTKK-GFTPLHVAAKYGK  158 (437)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHH-TCHHHHHHHHHTTCCSCCCCTT-SCCHHHHHHHTTC
T ss_pred             CCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHc-CCHHHHHHHHhCCCCCcCCCCC-CCCHHHHHHHcCC
Confidence                        6888888888888888888888888888887 8888888888888888877777 8888888887777


Q ss_pred             hhHHHHHhhhhhhhhhhcCCCccHHHHHHHH-HHHHHHHHHhcCCC----CCCCcchhHHH-------------------
Q psy5573         137 EVNTVLLYFINEIFKLMANNDTTILDRLDEM-KSLILEVTKEFGPG----DYNNFSLLKVA-------------------  192 (338)
Q Consensus       137 ~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~----~~~~~~~~~~~-------------------  192 (338)
                      ..+..++...+...+..+..+.++++.+... ...+.+++...+..    +..+.++++.+                   
T Consensus       159 ~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~  238 (437)
T 1n11_A          159 VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA  238 (437)
T ss_dssp             HHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCT
T ss_pred             HHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCC
Confidence            6555555555556666667777777765543 34455666555432    33445555544                   


Q ss_pred             --hhcCCCCHHHHHHHhhcccchhhhh-------ccccccchhHHHHhhcCCccchhhhhh----hccccccCCCHHHHH
Q psy5573         193 --KNDAGETILDIFFELIGKNDTTILD-------RLDEMKSIKLELTKAFGPGDYNNFSLL----KVTKNDAGETILDIA  259 (338)
Q Consensus       193 --~~~~~~t~l~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~g~TpLh~A  259 (338)
                        .+..|.||||+|+..+.......+-       .........+..+...++.++++.++.    .+.+|..|+||||+|
T Consensus       239 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A  318 (437)
T 1n11_A          239 NAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVA  318 (437)
T ss_dssp             TCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHH
T ss_pred             CCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHH
Confidence              2345667777776543322222111       111223345566666666666666654    345677788888888


Q ss_pred             HHhCChhHH-HHHHhhcccC----CCCCCC------chHHHHHHHHHcCCCCCCCCCCCCCcHHHHHHHhcCccchhhh
Q psy5573         260 KKRGFPLLE-ELEKKLADAN----NDTTIL------DRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPT  327 (338)
Q Consensus       260 ~~~g~~~i~-~ll~~~~d~~----~~~~~l------~~~~~v~~Ll~~g~~~~~~~d~~g~T~Lh~A~~~~~~~i~~~~  327 (338)
                      +..|+.+++ +|++++++++    .|.|+|      |+.++|++|+++|+ +++.+|.+|+||||+|++.+...++..+
T Consensus       319 ~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga-~~~~~~~~g~t~l~~A~~~g~~~~~~~l  396 (437)
T 1n11_A          319 SHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA-SPNEVSSDGTTPLAIAKRLGYISVTDVL  396 (437)
T ss_dssp             HHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC-CSCCCCSSSCCHHHHHHHTTCHHHHHHH
T ss_pred             HHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcC-CCCCCCCCCCCHHHHHHHcCcHHHHHHH
Confidence            888887777 7777777765    466666      77888888888888 7888888888888888887776665443
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-17
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.6 bits (195), Expect = 4e-17
 Identities = 31/104 (29%), Positives = 44/104 (42%), Gaps = 14/104 (13%)

Query: 11  LTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGAKE 70
           LTPL  A +  ++ +V+ LL+ G   N        T L +A    H             E
Sbjct: 1   LTPLHVASFMGHLPIVKNLLQRGASPNVSNV-KVETPLHMAARAGH------------TE 47

Query: 71  IVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGA 114
           +   LL N A VN K+    T LH A R    + +V+ LL + A
Sbjct: 48  VAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTN-MVKLLLENNA 90
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.4e-40  Score=292.79  Aligned_cols=293  Identities=23%  Similarity=0.216  Sum_probs=211.5

Q ss_pred             CCCCCCCCC----CCcHHHHHHHcCCHHHHHHHHhcCCCCCccccCCCCcHHHHHHHcCCHHHHHHHHHcCH--------
Q psy5573           1 MFSGATINV----ELTPLCAAVWDNNIRLVEYLLRTGHDVNEKMKLDGRTALFVAVHFNHRHIAALLIHHGA--------   68 (338)
Q Consensus         1 l~~g~~~n~----G~t~Lh~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~--------   68 (338)
                      |++|+++|.    |.||||+|+..|+.+++++|+++|++++.++ ..|+||||+|+..|+.+++++|+....        
T Consensus        20 l~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~-~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~   98 (408)
T d1n11a_          20 LQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKA-KDDQTPLHCAARIGHTNMVKLLLENNANPNLATTA   98 (408)
T ss_dssp             HHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCC-TTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTT
T ss_pred             HHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCC-CCCCCHHHHHHHcCCHHHHHHHHHhhhcccccccc
Confidence            357888887    8999999999999999999999999998888 889999999999999999998886533        


Q ss_pred             ----------------------------------------------HHHHHHHHHCCCCCcccCCCCChHHHHHHHhCCC
Q psy5573          69 ----------------------------------------------KEIVDLLLDNGADVNFKSATGFTALHMACRFHDD  102 (338)
Q Consensus        69 ----------------------------------------------~~~~~~Ll~~g~~~~~~~~~g~tpLh~A~~~~~~  102 (338)
                                                                    .++++.|+++|++++..+.+|.+|||+|+.. ++
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~~-~~  177 (408)
T d1n11a_          99 GHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHH-NN  177 (408)
T ss_dssp             CCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHT-TC
T ss_pred             ccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHHc-CC
Confidence                                                          4667777777777777777777777777776 77


Q ss_pred             HHHHHHHHhcCCCCCccCCCCCCCHHHHHhhcCChhHHHHHhhhhhhhhhhcCCCccHHHHHHH-HHHHHHHHHHhcCCC
Q psy5573         103 DSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFINEIFKLMANNDTTILDRLDE-MKSLILEVTKEFGPG  181 (338)
Q Consensus       103 ~~~v~~Ll~~g~~~~~~~~~~g~tpL~~A~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~  181 (338)
                      .+++++|+.+|++++..+.. |.||+|+++..........+..........+..+.++++.+.. ......+........
T Consensus       178 ~~~~~~Ll~~g~~~~~~~~~-~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~  256 (408)
T d1n11a_         178 LDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN  256 (408)
T ss_dssp             HHHHHHHGGGTCCSCCCCTT-CCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCC
T ss_pred             HHHHHHHHhcCCcccccCCC-CCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhccccc
Confidence            77777777777777777666 7777777776555444444433333333444445555544332 223333333333322


Q ss_pred             CCCCcchhHHHhhcCCCCHHHHHHHhhcccchhhhhccccccchhHHHHhhcCCccchhhhhhhccccccCCCHHHHHHH
Q psy5573         182 DYNNFSLLKVAKNDAGETILDIFFELIGKNDTTILDRLDEMKSIKLELTKAFGPGDYNNFSLLKVTKNDAGETILDIAKK  261 (338)
Q Consensus       182 ~~~~~~~~~~~~~~~~~t~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~TpLh~A~~  261 (338)
                      ..        ..+..|.+|++.+++..            ....++.++..+....          ..+..+.||||.|+.
T Consensus       257 ~~--------~~~~~g~~~l~~a~~~~------------~~~i~~~Ll~~g~~~~----------~~~~~~~t~L~~~~~  306 (408)
T d1n11a_         257 GN--------LGNKSGLTPLHLVAQEG------------HVPVADVLIKHGVMVD----------ATTRMGYTPLHVASH  306 (408)
T ss_dssp             TT--------CCCTTCCCHHHHHHHHT------------CHHHHHHHHHHTCCTT----------CCCSSCCCHHHHHHH
T ss_pred             cc--------cccCCCCChhhhhhhcC------------cHHHHHHHHHCCCccc----------cccccccccchhhcc
Confidence            11        23556677777776552            2233334444443332          567788999999999


Q ss_pred             hCChhHH-HHHHhhcccC----CCCCCC------chHHHHHHHHHcCCCCCCCCCCCCCcHHHHHHHhcCccchhhh
Q psy5573         262 RGFPLLE-ELEKKLADAN----NDTTIL------DRLDEMKSLILEGTKEFGPGDYNNFSLLKVAKNDAGETILGPT  327 (338)
Q Consensus       262 ~g~~~i~-~ll~~~~d~~----~~~~~l------~~~~~v~~Ll~~g~~~~~~~d~~g~T~Lh~A~~~~~~~i~~~~  327 (338)
                      .++.+++ .++..+++.+    .|.|+|      |+.++|++|+++|+ +++.+|.+|+||||+|++.++.+|+..+
T Consensus       307 ~~~~~~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GA-d~n~~d~~G~t~L~~A~~~~~~~iv~~L  382 (408)
T d1n11a_         307 YGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGA-SPNEVSSDGTTPLAIAKRLGYISVTDVL  382 (408)
T ss_dssp             SSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC-CSCCCCSSSCCHHHHHHHTTCHHHHHHH
T ss_pred             cCcceeeeeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCC-CCCCCCCCCCCHHHHHHHcCCHHHHHHH
Confidence            9998887 8888888865    678887      89999999999999 9999999999999999999998888755
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure