Psyllid ID: psy5597

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MPGKSVLDDSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLRYW
cccccccccccccEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEEcccEEEEEEccccccccEEEEcccccEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHcc
ccccccEccccccEEEEEEEccccHHHHHHHHHHHHHcccHHHEEEEEEcccccEEEEcccccEHEEEEccccccEEEEEEEcccccEEccccHHHHccEEcccccccccccccccHHHcccccccccHcccccHHHHHHccccccccccccEEcccccHHHHHHHHHHHHHHHccccccccEEEEEEHccccHHHcHHHHHHc
mpgksvlddseDNFAIVFAAMGVNMETARFFKqdfeengsmeNVCLFLnlandptiERIITFQAKYFSIYndgnnrgsficeftgdilrtpvsedmlgrvfngsgkpidkgppilaedyldiegqpinpysrtypqeMIQTGISAIDKILLQVFegtsgidakntvceftgdilrtpvsedmlgrvfngsgkpiDKAVRLLRYW
mpgksvlddseDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFngsgkpidkgpPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDIlrtpvsedmlgrvfngsgkpidkavrllryw
MPGKSVLDDSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLRYW
************NFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLL***
********DSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKA*RLLRYW
********DSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLRYW
****SVLDDSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLRYW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGKSVLDDSEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITFQAKYFSIYNDGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLRYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
P31401 494 V-type proton ATPase subu N/A N/A 0.333 0.137 0.911 4e-32
P31409 490 V-type proton ATPase subu yes N/A 0.333 0.138 0.911 4e-32
P31410 494 V-type proton ATPase subu N/A N/A 0.333 0.137 0.911 4e-32
Q619C0 491 Probable V-type proton AT N/A N/A 0.333 0.138 0.897 1e-31
Q19626 491 Probable V-type proton AT yes N/A 0.333 0.138 0.897 2e-31
P15313 513 V-type proton ATPase subu yes N/A 0.328 0.130 0.865 3e-29
P49712 453 V-type proton ATPase subu no N/A 0.328 0.147 0.865 8e-29
Q5R5V5 511 V-type proton ATPase subu no N/A 0.328 0.131 0.865 1e-28
P21281 511 V-type proton ATPase subu no N/A 0.328 0.131 0.865 1e-28
P62815 511 V-type proton ATPase subu no N/A 0.328 0.131 0.865 1e-28
>sp|P31401|VATB_MANSE V-type proton ATPase subunit B OS=Manduca sexta GN=VHA55 PE=2 SV=1 Back     alignment and function desciption
 Score =  137 bits (346), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (98%)

Query: 80  ICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI 139
           +CEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAED+LDI+GQPINP+SR YP+EMI
Sbjct: 94  LCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQPINPWSRIYPEEMI 153

Query: 140 QTGISAID 147
           QTGISAID
Sbjct: 154 QTGISAID 161
Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. The B subunit is non-catalytic but combines with other subunits to form the catalytic complex. V-ATPase is responsible for energizing electrophoretic K(+)/2H(+) antiport by generating a transmembrane voltage of more than 200mV.
Manduca sexta (taxid: 7130)
>sp|P31409|VATB_DROME V-type proton ATPase subunit B OS=Drosophila melanogaster GN=Vha55 PE=2 SV=1 Back     alignment and function description
>sp|P31410|VATB_HELVI V-type proton ATPase subunit B OS=Heliothis virescens GN=VHA55 PE=2 SV=1 Back     alignment and function description
>sp|Q619C0|VATB_CAEBR Probable V-type proton ATPase subunit B OS=Caenorhabditis briggsae GN=vha-12 PE=3 SV=1 Back     alignment and function description
>sp|Q19626|VATB_CAEEL Probable V-type proton ATPase subunit B OS=Caenorhabditis elegans GN=vha-12 PE=1 SV=1 Back     alignment and function description
>sp|P15313|VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens GN=ATP6V1B1 PE=1 SV=3 Back     alignment and function description
>sp|P49712|VATB_CHICK V-type proton ATPase subunit B OS=Gallus gallus GN=ATP6V1B PE=3 SV=1 Back     alignment and function description
>sp|Q5R5V5|VATB2_PONAB V-type proton ATPase subunit B, brain isoform OS=Pongo abelii GN=ATP6V1B2 PE=2 SV=1 Back     alignment and function description
>sp|P21281|VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens GN=ATP6V1B2 PE=1 SV=3 Back     alignment and function description
>sp|P62815|VATB2_RAT V-type proton ATPase subunit B, brain isoform OS=Rattus norvegicus GN=Atp6v1b2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
328716950 496 PREDICTED: v-type proton ATPase subunit 0.333 0.137 0.985 8e-33
332374006 492 unknown [Dendroctonus ponderosae] 0.333 0.138 0.926 6e-31
307203836 495 Vacuolar ATP synthase subunit B [Harpegn 0.328 0.135 0.940 9e-31
332024912 495 V-type proton ATPase subunit B [Acromyrm 0.328 0.135 0.940 1e-30
157111261 496 ATP synthase subunit beta vacuolar [Aede 0.333 0.137 0.911 1e-30
347968745 498 AGAP002884-PA [Anopheles gambiae str. PE 0.333 0.136 0.911 1e-30
312373433 498 hypothetical protein AND_17443 [Anophele 0.333 0.136 0.911 1e-30
170034654 492 V-type ATP synthase beta chain [Culex qu 0.333 0.138 0.911 1e-30
383847947 495 PREDICTED: V-type proton ATPase subunit 0.328 0.135 0.940 1e-30
91090031 496 PREDICTED: similar to H(+)-transporting 0.333 0.137 0.911 1e-30
>gi|328716950|ref|XP_003246082.1| PREDICTED: v-type proton ATPase subunit B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 67/68 (98%), Positives = 68/68 (100%)

Query: 80  ICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI 139
           +CEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI
Sbjct: 95  LCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI 154

Query: 140 QTGISAID 147
           QTGISAID
Sbjct: 155 QTGISAID 162

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332374006|gb|AEE62144.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307203836|gb|EFN82772.1| Vacuolar ATP synthase subunit B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332024912|gb|EGI65100.1| V-type proton ATPase subunit B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157111261|ref|XP_001651458.1| ATP synthase subunit beta vacuolar [Aedes aegypti] gi|4680480|gb|AAD27666.1|AF092934_1 vacuolar ATPase B subunit [Aedes aegypti] gi|108878452|gb|EAT42677.1| AAEL005798-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|347968745|ref|XP_312029.3| AGAP002884-PA [Anopheles gambiae str. PEST] gi|333467862|gb|EAA08175.4| AGAP002884-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312373433|gb|EFR21178.1| hypothetical protein AND_17443 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170034654|ref|XP_001845188.1| V-type ATP synthase beta chain [Culex quinquefasciatus] gi|2921502|gb|AAC04806.1| B subunit V-ATPase [Culex quinquefasciatus] gi|167876059|gb|EDS39442.1| V-type ATP synthase beta chain [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383847947|ref|XP_003699614.1| PREDICTED: V-type proton ATPase subunit B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91090031|ref|XP_967844.1| PREDICTED: similar to H(+)-transporting ATPase [Tribolium castaneum] gi|270014269|gb|EFA10717.1| hypothetical protein TcasGA2_TC012133 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
FB|FBgn0005671 490 Vha55 "Vacuolar H[+]-ATPase 55 0.333 0.138 0.911 1.4e-30
WB|WBGene00006921 491 vha-12 [Caenorhabditis elegans 0.333 0.138 0.897 2.5e-30
UNIPROTKB|Q19626 491 vha-12 "Probable V-type proton 0.333 0.138 0.897 2.5e-30
UNIPROTKB|C9J5E3248 ATP6V1B1 "V-type proton ATPase 0.328 0.270 0.865 2.4e-28
UNIPROTKB|C9JNS9249 ATP6V1B1 "V-type proton ATPase 0.328 0.269 0.865 2.4e-28
UNIPROTKB|C9JL73 496 ATP6V1B1 "V-type proton ATPase 0.328 0.135 0.865 4.8e-28
UNIPROTKB|P15313 513 ATP6V1B1 "V-type proton ATPase 0.328 0.130 0.865 6.1e-28
ZFIN|ZDB-GENE-030711-4 509 atp6v1b2 "ATPase, H+ transport 0.328 0.131 0.880 7.6e-28
UNIPROTKB|F1NID6 453 ATP6V1B2 "Uncharacterized prot 0.328 0.147 0.865 8.2e-28
UNIPROTKB|P49712 453 ATP6V1B "V-type proton ATPase 0.328 0.147 0.865 8.2e-28
FB|FBgn0005671 Vha55 "Vacuolar H[+]-ATPase 55kD subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 62/68 (91%), Positives = 67/68 (98%)

Query:    80 ICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI 139
             +CEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAED+LDI+GQPINP+SR YP+EMI
Sbjct:    90 LCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDFLDIQGQPINPWSRIYPEEMI 149

Query:   140 QTGISAID 147
             QTGISAID
Sbjct:   150 QTGISAID 157
GO:0000221 "vacuolar proton-transporting V-type ATPase, V1 domain" evidence=ISS;NAS
GO:0015992 "proton transport" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0046034 "ATP metabolic process" evidence=IEA
GO:0033181 "plasma membrane proton-transporting V-type ATPase complex" evidence=IMP
GO:0005769 "early endosome" evidence=IDA
GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IGI;IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0005903 "brush border" evidence=IDA
GO:0007035 "vacuolar acidification" evidence=IDA
GO:0015991 "ATP hydrolysis coupled proton transport" evidence=IGI
GO:0005886 "plasma membrane" evidence=IDA
WB|WBGene00006921 vha-12 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q19626 vha-12 "Probable V-type proton ATPase subunit B" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|C9J5E3 ATP6V1B1 "V-type proton ATPase subunit B, kidney isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JNS9 ATP6V1B1 "V-type proton ATPase subunit B, kidney isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JL73 ATP6V1B1 "V-type proton ATPase subunit B, kidney isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P15313 ATP6V1B1 "V-type proton ATPase subunit B, kidney isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030711-4 atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NID6 ATP6V1B2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P49712 ATP6V1B "V-type proton ATPase subunit B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SZN1VATB2_ARATHNo assigned EC number0.52670.50490.2114yesN/A
P11574VATB1_ARATHNo assigned EC number0.52670.50490.2119yesN/A
A3CK49VATB_STRSVNo assigned EC number0.52330.48520.2133yesN/A
Q8W4E2VATB3_ARATHNo assigned EC number0.51780.50490.2114yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 2e-45
TIGR01040466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 6e-38
cd01135 276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 2e-35
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 5e-35
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 3e-34
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 5e-29
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 1e-27
cd01135276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 2e-27
PRK04196460 PRK04196, PRK04196, V-type ATP synthase subunit B; 5e-22
COG1156463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 8e-22
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 2e-19
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 6e-19
TIGR01041458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 6e-17
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 5e-16
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 2e-15
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 7e-15
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 6e-14
PRK05688 451 PRK05688, fliI, flagellum-specific ATP synthase; V 3e-11
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 4e-11
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 5e-11
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 6e-10
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 6e-10
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 8e-10
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 8e-10
cd01136 326 cd01136, ATPase_flagellum-secretory_path_III, Flag 8e-10
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 1e-09
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 1e-09
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 2e-09
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-09
PRK06820 440 PRK06820, PRK06820, type III secretion system ATPa 2e-09
cd01133 274 cd01133, F1-ATPase_beta, F1 ATP synthase beta subu 8e-09
cd01132 274 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c 2e-08
PRK05922 434 PRK05922, PRK05922, type III secretion system ATPa 2e-08
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 2e-08
PRK08972 444 PRK08972, fliI, flagellum-specific ATP synthase; V 3e-08
PRK08472 434 PRK08472, fliI, flagellum-specific ATP synthase; V 3e-08
cd01135 276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 8e-08
PRK09099 441 PRK09099, PRK09099, type III secretion system ATPa 9e-08
pfam00006213 pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa 3e-07
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 3e-07
TIGR03498 418 TIGR03498, FliI_clade3, flagellar protein export A 7e-07
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 9e-07
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 1e-06
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 1e-06
PRK07960 455 PRK07960, fliI, flagellum-specific ATP synthase; V 1e-06
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 2e-06
TIGR03305 449 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, 2e-06
PRK06315 442 PRK06315, PRK06315, type III secretion system ATPa 4e-06
PRK02118436 PRK02118, PRK02118, V-type ATP synthase subunit B; 1e-05
TIGR03324 497 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, 4e-05
PRK07594 433 PRK07594, PRK07594, type III secretion system ATPa 9e-05
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 1e-04
PRK07721 438 PRK07721, fliI, flagellum-specific ATP synthase; V 1e-04
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 2e-04
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 2e-04
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 3e-04
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 7e-04
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 8e-04
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 0.001
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 0.002
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 0.003
PRK06793 432 PRK06793, fliI, flagellum-specific ATP synthase; V 0.003
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 0.004
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information 
 Score =  156 bits (395), Expect = 2e-45
 Identities = 62/68 (91%), Positives = 65/68 (95%)

Query: 80  ICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMI 139
            CEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPP+LAEDYLDI GQPINPY+R YP+EMI
Sbjct: 66  TCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPVLAEDYLDINGQPINPYARIYPEEMI 125

Query: 140 QTGISAID 147
           QTGISAID
Sbjct: 126 QTGISAID 133

This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 466
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain Back     alignment and domain information
>gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 100.0
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 100.0
PRK04196 460 V-type ATP synthase subunit B; Provisional 100.0
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 100.0
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 100.0
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 100.0
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 100.0
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 100.0
CHL00060 494 atpB ATP synthase CF1 beta subunit 100.0
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 100.0
PRK02118 436 V-type ATP synthase subunit B; Provisional 100.0
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 100.0
PRK06936 439 type III secretion system ATPase; Provisional 99.98
CHL00059 485 atpA ATP synthase CF1 alpha subunit 99.98
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 99.98
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 99.98
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 99.97
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 99.97
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 99.97
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 99.97
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 99.97
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 99.97
PRK09099 441 type III secretion system ATPase; Provisional 99.96
PRK05922 434 type III secretion system ATPase; Validated 99.96
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 99.96
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 99.96
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 99.96
PTZ00185 574 ATPase alpha subunit; Provisional 99.96
PRK04192 586 V-type ATP synthase subunit A; Provisional 99.96
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 99.96
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 99.96
KOG1350|consensus 521 99.96
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 99.96
PRK06820 440 type III secretion system ATPase; Validated 99.96
PRK06315 442 type III secretion system ATPase; Provisional 99.96
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 99.96
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 99.95
PRK07594 433 type III secretion system ATPase SsaN; Validated 99.95
PRK08149 428 ATP synthase SpaL; Validated 99.95
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 99.95
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.95
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 99.95
cd01135 276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 99.94
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 99.94
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 99.93
cd01132 274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 99.92
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 99.91
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 99.87
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 99.81
KOG1351|consensus 489 99.79
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 99.78
PRK14698 1017 V-type ATP synthase subunit A; Provisional 99.77
cd01134 369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 99.68
PRK12608 380 transcription termination factor Rho; Provisional 99.6
KOG1352|consensus 618 99.45
KOG1353|consensus 340 99.26
KOG1351|consensus489 99.1
PRK12678 672 transcription termination factor Rho; Provisional 98.68
PF00006 215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 98.61
PRK09376 416 rho transcription termination factor Rho; Provisio 98.56
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 97.44
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 96.56
cd01128 249 rho_factor Transcription termination factor rho is 96.53
TIGR00767 415 rho transcription termination factor Rho. Members 96.33
PRK02118 436 V-type ATP synthase subunit B; Provisional 90.06
PRK14698 1017 V-type ATP synthase subunit A; Provisional 88.22
PRK04192 586 V-type ATP synthase subunit A; Provisional 85.1
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 83.31
PRK06936 439 type III secretion system ATPase; Provisional 82.88
PRK09099 441 type III secretion system ATPase; Provisional 82.62
PRK07594 433 type III secretion system ATPase SsaN; Validated 81.36
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 81.15
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 80.71
COG1158 422 Rho Transcription termination factor [Transcriptio 80.56
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information 
Probab=100.00  E-value=7.6e-38  Score=285.20  Aligned_cols=170  Identities=21%  Similarity=0.331  Sum_probs=146.5

Q ss_pred             cceeeeccccccCccCEEEEEecCCC-CeEEEEeeeccceEE--EcC--CcccCCccEEEecCCeeEEeCCccccccccc
Q psy5597          28 ARFFKQDFEENGSMENVCLFLNLAND-PTIERIITFQAKYFS--IYN--DGNNRGSFICEFTGDILRTPVSEDMLGRVFN  102 (204)
Q Consensus        28 ~~~~v~~~~~~~~iGd~c~I~~~~~~-~~~aEVVg~~~~~ll--~~~--~gi~~Gg~~V~~tg~~~~Vpvg~~lLGRViD  102 (204)
                      .|..+++..+.+++|++|.|+...+. ..+||||||+...++  |+.  .|+.+| ++|.++++++++++|++|||||+|
T Consensus        32 ~G~~lea~g~~~~iGelc~i~~~~~~~~~~aEVvgf~~~~~~L~p~~~~~gv~~g-~~V~~~~~~~~v~~g~~lLGRVld  110 (441)
T COG1157          32 TGLLLEAVGPQARIGELCKIERSRGSEKVLAEVVGFNEERVLLMPFEPVEGVSPG-AEVVPTGRPLSVPVGDALLGRVLD  110 (441)
T ss_pred             eeeEEEEecCCCcccceEEEEecCCCCceeEEEEEEcCCeEEEeccCccccCCCC-CEEEecCCccccccChhhhhhhhc
Confidence            35677888889999999999986443 339999999955444  543  579999 899999999999999999999999


Q ss_pred             ccceeecCCCCCCCCcceeecCCCCCCccCCCCCcccccceeeeeeeeeeeccCeeccc----CCceehhhhhhhhcccc
Q psy5597         103 GSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGID----AKNTVCEFTGDILRTPV  178 (204)
Q Consensus       103 ~lG~PiDg~~~~~~~~~~pi~~~pp~p~~R~~i~epL~TGIraID~llp~v~~gt~Gl~----~~ktv~~l~~~~~~~~~  178 (204)
                      ++|+|||+.+.++...++|++.+||||+.|++|++||.||||+||+|+|.-.|++.|+|    .||+  +||+|+++++.
T Consensus       111 ~~G~plDg~~~~~~~~~~~l~~~pp~pm~R~~I~~~l~tGVRaIDgllT~G~GQRiGIFAgsGVGKS--tLLgMiar~t~  188 (441)
T COG1157         111 GLGRPLDGGGLPDGTERRPLDAPPPNPLKRRPIEEPLDTGVRAIDGLLTCGKGQRIGIFAGSGVGKS--TLLGMIARNTE  188 (441)
T ss_pred             cCCCcCcCCCCCCCcccccccCCCCCchhcccccccccccceeeecccccccCceeEEEecCCCcHH--HHHHHHhcccc
Confidence            99999999888888888999999999999999999999999999999995555555554    3555  79999999986


Q ss_pred             cCCCCEEEEEeeeccccccchhccc
Q psy5597         179 SEDMLGRVFNGSGKPIDKAVRLLRY  203 (204)
Q Consensus       179 s~~~~~~Vf~giGer~~e~~el~~~  203 (204)
                      .+   ++|.+.||||+||++||+++
T Consensus       189 aD---v~ViaLIGERGREVrEFIE~  210 (441)
T COG1157         189 AD---VNVIALIGERGREVREFIEK  210 (441)
T ss_pred             CC---EEEEEEeeccchhHHHHHHH
Confidence            55   99999999999999999864

>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>KOG1353|consensus Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 3e-18
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 2e-10
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 2e-17
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 3e-09
3tiv_A 460 Crystal Structure Of Subunit B Mutant N157a Of The 6e-15
3tiv_A 460 Crystal Structure Of Subunit B Mutant N157a Of The 1e-08
3tgw_A 460 Crystal Structure Of Subunit B Mutant H156a Of The 6e-15
3tgw_A 460 Crystal Structure Of Subunit B Mutant H156a Of The 1e-08
3ssa_A 460 Crystal Structure Of Subunit B Mutant N157t Of The 6e-15
3ssa_A 460 Crystal Structure Of Subunit B Mutant N157t Of The 1e-08
2c61_A 469 Crystal Structure Of The Non-Catalytic B Subunit Of 6e-15
2c61_A 469 Crystal Structure Of The Non-Catalytic B Subunit Of 1e-08
2rkw_A 469 Intermediate Position Of Atp On Its Trail To The Bi 6e-15
2rkw_A 469 Intermediate Position Of Atp On Its Trail To The Bi 1e-08
3gqb_B 464 Crystal Structure Of The A3b3 Complex From V-atpase 7e-14
3gqb_B 464 Crystal Structure Of The A3b3 Complex From V-atpase 2e-07
3a5c_D 478 Inter-Subunit Interaction And Quaternary Rearrangem 8e-14
3a5c_D 478 Inter-Subunit Interaction And Quaternary Rearrangem 2e-07
2qe7_A 502 Crystal Structure Of The F1-Atpase From The Thermoa 5e-07
1sky_B 502 Crystal Structure Of The Nucleotide Free Alpha3beta 7e-06
1fx0_A 507 Crystal Structure Of The Chloroplast F1-Atpase From 1e-05
2r9v_A 515 Crystal Structure Of Atp Synthase Subunit Alpha (Tm 1e-04
3oaa_A 513 Structure Of The E.Coli F1-Atp Synthase Inhibited B 2e-04
2xnd_D 467 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 2e-04
1cow_D 482 Bovine Mitochondrial F1-Atpase Complexed With Aurov 2e-04
1nbm_E 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 2e-04
1nbm_D 480 The Structure Of Bovine F1-Atpase Covalently Inhibi 2e-04
4asu_D 480 F1-Atpase In Which All Three Catalytic Sites Contai 2e-04
2dpy_A 438 Crystal Structure Of The Flagellar Type Iii Atpase 2e-04
2w6e_D 528 Low Resolution Structures Of Bovine Mitochondrial F 2e-04
2w6e_A 553 Low Resolution Structures Of Bovine Mitochondrial F 3e-04
2xok_D 511 Refined Structure Of Yeast F1c10 Atpase Complex To 3e-04
2jiz_A 510 The Structure Of F1-Atpase Inhibited By Resveratrol 3e-04
1cow_A 510 Bovine Mitochondrial F1-Atpase Complexed With Aurov 3e-04
2xnd_A 492 Crystal Structure Of Bovine F1-C8 Sub-Complex Of At 3e-04
1bmf_A 510 Bovine Mitochondrial F1-Atpase Length = 510 3e-04
1ohh_B 487 Bovine Mitochondrial F1-Atpase Complexed With The I 3e-04
3oeh_D 484 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 4e-04
3fks_D 484 Yeast F1 Atpase In The Absence Of Bound Nucleotides 4e-04
2hld_D 478 Crystal Structure Of Yeast Mitochondrial F1-Atpase 4e-04
4b2q_D 470 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-04
4b2q_E 473 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-04
4b2q_A 485 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-04
4b2q_B 486 Model Of The Yeast F1fo-Atp Synthase Dimer Based On 4e-04
2hld_A 510 Crystal Structure Of Yeast Mitochondrial F1-Atpase 5e-04
2xok_A 545 Refined Structure Of Yeast F1c10 Atpase Complex To 5e-04
3oee_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 5e-04
3ofn_A 510 Structure Of Four Mutant Forms Of Yeast F1 Atpase: 5e-04
1mab_B 479 Rat Liver F1-Atpase Length = 479 6e-04
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure 
Iteration: 1

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 61/105 (58%), Gaps = 8/105 (7%)
Query: 73  GNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSR 132
           G N  +    F G  L+  VSEDM+GRVF+G G+P D GP IL E YLDI G+ INP +R
Sbjct: 69  GINLKNSSVRFLGHPLQLGVSEDMIGRVFDGLGRPKDNGPEILPEKYLDINGEVINPIAR 128
Query: 133 TYPQEMIQTGISAIDKI-------LLQVFEGTSGIDAKNTVCEFT 170
            YP E IQTGISAID +        L VF G SG+  K    +  
Sbjct: 129 DYPDEFIQTGISAIDHLNTLVRGQKLPVFSG-SGLPHKELAAQIA 172
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 Back     alignment and structure
>pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 Back     alignment and structure
>pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 Back     alignment and structure
>pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 Back     alignment and structure
>pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 Back     alignment and structure
>pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 Back     alignment and structure
>pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 Back     alignment and structure
>pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 Back     alignment and structure
>pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 Back     alignment and structure
>pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 Back     alignment and structure
>pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 Back     alignment and structure
>pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 Back     alignment and structure
>pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 Back     alignment and structure
>pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 Back     alignment and structure
>pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 Back     alignment and structure
>pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 Back     alignment and structure
>pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 Back     alignment and structure
>pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 Back     alignment and structure
>pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 Back     alignment and structure
>pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 Back     alignment and structure
>pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 Back     alignment and structure
>pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 Back     alignment and structure
>pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 Back     alignment and structure
>pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 Back     alignment and structure
>pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 Back     alignment and structure
>pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 Back     alignment and structure
>pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 Back     alignment and structure
>pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 Back     alignment and structure
>pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 1e-34
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 7e-21
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 3e-20
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 8e-34
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 3e-20
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 7e-19
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 4e-14
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 8e-05
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 7e-13
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 1e-10
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 1e-04
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 1e-10
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 1e-04
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 2e-10
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 1e-04
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 2e-10
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 1e-04
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 3e-10
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 1e-04
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 4e-08
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 2e-07
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 1e-06
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 8e-04
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
 Score =  126 bits (319), Expect = 1e-34
 Identities = 37/76 (48%), Positives = 46/76 (60%)

Query: 72  DGNNRGSFICEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYS 131
            G +  +       D+ R  VS++MLGR FNG GKPID  PPI  E  L I G P+NP +
Sbjct: 64  TGLDLATTSVSLVEDVARLGVSKEMLGRRFNGIGKPIDGLPPITPEKRLPITGLPLNPVA 123

Query: 132 RTYPQEMIQTGISAID 147
           R  P++ IQTGIS ID
Sbjct: 124 RRKPEQFIQTGISTID 139
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 100.0
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 100.0
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 100.0
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 100.0
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 99.98
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 99.98
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 99.97
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 99.97
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 99.97
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 99.97
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 99.96
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 99.96
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 99.95
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 99.95
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.87
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.72
3l0o_A 427 Transcription termination factor RHO; helicase, RH 99.28
3ice_A 422 Transcription termination factor RHO; transcriptio 98.68
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 84.41
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 82.68
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 82.67
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 82.12
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 81.23
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 81.04
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
Probab=100.00  E-value=2.6e-34  Score=265.93  Aligned_cols=170  Identities=28%  Similarity=0.401  Sum_probs=149.6

Q ss_pred             eeeeccccccCccCEEEEEecCCCCeEEEEeeec--cceEEEcC--Cccc-CCccEEEecCCeeEEeCCccccccccccc
Q psy5597          30 FFKQDFEENGSMENVCLFLNLANDPTIERIITFQ--AKYFSIYN--DGNN-RGSFICEFTGDILRTPVSEDMLGRVFNGS  104 (204)
Q Consensus        30 ~~v~~~~~~~~iGd~c~I~~~~~~~~~aEVVg~~--~~~ll~~~--~gi~-~Gg~~V~~tg~~~~Vpvg~~lLGRViD~l  104 (204)
                      +.+.|+. .+++||+|+|...++....|||++|+  .+.++++.  .|+. .| ++|.+||++++||||++|||||+|++
T Consensus        19 v~v~gl~-~~~~ge~v~i~~~~g~~~~geVv~~~~~~~~~~~~~~~~gl~~~g-~~V~~tg~~~~vpvg~~lLGRV~d~l   96 (464)
T 3gqb_B           19 LFVENAK-DLAYGAIVDIKDGTGRVRGGQVIEVSEEYAVIQVFEETTGLDLAT-TSVSLVEDVARLGVSKEMLGRRFNGI   96 (464)
T ss_dssp             EEEESCT-TSCTTCEEEEECTTSCEEEEEEEEEESSEEEEEESSCCTTCCSSS-CEEEEEESSCEEEECSTTTTEEEETT
T ss_pred             EEEecCC-CCCcCCEEEEEcCCCCEEEEEEEEEeCCeEEEEEecCccccccCC-CEEEECCCCcEEEeChHhcCCEeccC
Confidence            6666665 79999999998655656899999999  45666664  5798 56 89999999999999999999999999


Q ss_pred             ceeecCCCCCCCCcceeecCCCCCCccCCCCCcccccceeeeeeeeeeeccCeeccc----CCceehhhhhhhhccccc-
Q psy5597         105 GKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGID----AKNTVCEFTGDILRTPVS-  179 (204)
Q Consensus       105 G~PiDg~~~~~~~~~~pi~~~pp~p~~R~~i~epL~TGIraID~llp~v~~gt~Gl~----~~ktv~~l~~~~~~~~~s-  179 (204)
                      |+|||+++++..++++|++++||||++|.++++||+||||+||+|+|...|++.||+    ++||  +++.++++++.. 
T Consensus        97 G~PiD~~~~i~~~~~~~i~~~~p~p~~R~~~~e~l~TGiraID~l~pigrGQr~~Ifgg~G~GKt--~L~~~Ia~~~~a~  174 (464)
T 3gqb_B           97 GKPIDGLPPITPEKRLPITGLPLNPVARRKPEQFIQTGISTIDVMNTLVRGQKLPIFSGSGLPAN--EIAAQIARQATVR  174 (464)
T ss_dssp             CCBCSSSCCCCCSEEEETTCCCBCGGGBCCCCCBCBCSCHHHHTTSCCBTTCBCCEEEETTSCHH--HHHHHHHHHCBCC
T ss_pred             CcccCCCccccCcceeeccCCCCChhhccCccccccCcceeeecccccccCCEEEEecCCCCCch--HHHHHHHHHHHhc
Confidence            999999999888888999999999999999999999999999999999999888886    5888  588889888643 


Q ss_pred             ---------CCCCEEEEEeeeccccccchhccc
Q psy5597         180 ---------EDMLGRVFNGSGKPIDKAVRLLRY  203 (204)
Q Consensus       180 ---------~~~~~~Vf~giGer~~e~~el~~~  203 (204)
                               .+.+++||++||||.+|+.||++.
T Consensus       175 ~~~~~~~~d~~~~~~V~~~iGeR~~Ev~e~~~~  207 (464)
T 3gqb_B          175 PDLSGEGEKEEPFAVVFAAMGITQRELSYFIQE  207 (464)
T ss_dssp             HHHHCCCSTTCCEEEEEEEEEECHHHHHHHHHH
T ss_pred             ccccccccCCCceEEEEEEecCchHHHHHHHHH
Confidence                     345699999999999999999863
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1fx0a3 276 c.37.1.11 (A:97-372) Central domain of alpha subun 3e-19
d1fx0a3 276 c.37.1.11 (A:97-372) Central domain of alpha subun 7e-06
d2jdid3 276 c.37.1.11 (D:82-357) Central domain of beta subuni 5e-19
d2jdid3276 c.37.1.11 (D:82-357) Central domain of beta subuni 2e-06
d2jdid3 276 c.37.1.11 (D:82-357) Central domain of beta subuni 7e-06
d2jdia3 285 c.37.1.11 (A:95-379) Central domain of alpha subun 5e-19
d2jdia3285 c.37.1.11 (A:95-379) Central domain of alpha subun 4e-07
d2jdia3 285 c.37.1.11 (A:95-379) Central domain of alpha subun 3e-05
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]

 Score = 81.1 bits (200), Expect = 3e-19
 Identities = 27/70 (38%), Positives = 32/70 (45%)

Query: 91  PVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKIL 150
           PVSE  LGRV N   KPID    I A +   IE       SR    E +QTG+ AID ++
Sbjct: 3   PVSEAYLGRVINALAKPIDGRGEITASESRLIESPAPGIMSRRSVYEPLQTGLIAIDAMI 62

Query: 151 LQVFEGTSGI 160
                    I
Sbjct: 63  PVGRGQRELI 72
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 99.94
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 99.92
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 99.92
d1xpua3 289 Transcription termination factor Rho, ATPase domai 98.64
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 97.36
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 97.26
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 97.15
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of beta subunit of F1 ATP synthase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.94  E-value=9.6e-29  Score=213.88  Aligned_cols=113  Identities=25%  Similarity=0.379  Sum_probs=105.7

Q ss_pred             eEEeCCcccccccccccceeecCCCCCCCCcceeecCCCCCCccCCCCCcccccceeeeeeeeeeeccCeeccc----CC
Q psy5597          88 LRTPVSEDMLGRVFNGSGKPIDKGPPILAEDYLDIEGQPINPYSRTYPQEMIQTGISAIDKILLQVFEGTSGID----AK  163 (204)
Q Consensus        88 ~~Vpvg~~lLGRViD~lG~PiDg~~~~~~~~~~pi~~~pp~p~~R~~i~epL~TGIraID~llp~v~~gt~Gl~----~~  163 (204)
                      ++||||++|||||+|++|+|||+++++...++||++.+||||++|+++++||+||||+||+|+|...|++.|++    +|
T Consensus         1 l~vpVG~~lLGRVid~lG~piDg~~~i~~~~~~~i~~~~p~~~~R~~i~~~l~TGIraID~l~pigkGQr~~If~~~g~G   80 (276)
T d2jdid3           1 IRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVG   80 (276)
T ss_dssp             CEEECSGGGBTCEECTTSCBCSSSCCCCCSCEEESCCCCCCGGGCCCCCCEECCSCHHHHHHSCEETTCEEEEEECTTSS
T ss_pred             CeeecCccccCCEeCCCcceeCCCCCCCCcccccccCCCCChhHhcCCCcccccCceeeeeeccccCCCEEEeeCCCCCC
Confidence            58999999999999999999999999888889999999999999999999999999999999999999999986    68


Q ss_pred             ceehhhhhhhhcccccCCCCEEEEEeeeccccccchhcc
Q psy5597         164 NTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKAVRLLR  202 (204)
Q Consensus       164 ktv~~l~~~~~~~~~s~~~~~~Vf~giGer~~e~~el~~  202 (204)
                      ||  +++.++++|....+.+++||++||||.+|+.|||+
T Consensus        81 Kt--~l~~~i~~~~~~~~~~v~V~~~iGer~~ev~~~~~  117 (276)
T d2jdid3          81 KT--VLIMELINNVAKAHGGYSVFAGVGERTREGNDLYH  117 (276)
T ss_dssp             HH--HHHHHHHHHHTTTCSSEEEEEEESCCHHHHHHHHH
T ss_pred             HH--HHHHHHHHHHHhhCCCeEEEEEeccChHHHHHHHH
Confidence            98  68899998876667789999999999999999986
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure