Psyllid ID: psy5623


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK
ccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcHHHHHHHccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccc
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALpkaesfanskyykggfepkmtKREASLILGVSQSANRMKIKEAHKRIITlnhpdrggspylAAKINEAKDLLEQSK
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIItlnhpdrggspylaAKINEAKDLLEQSK
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK
****AILTGLGLAAVGYAGRYILKAAPMASARLNEAL*************YYK*************LIL****************RIIT***************************
**STAILTGLGLAAVGYAGRYILKAAPMASAR*****************************KREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLE***
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK
**STAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQ**
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
Q9VTJ8118 Mitochondrial import inne yes N/A 1.0 0.983 0.677 5e-41
Q5RF34116 Mitochondrial import inne yes N/A 0.956 0.956 0.610 8e-35
Q96DA6116 Mitochondrial import inne yes N/A 0.956 0.956 0.610 8e-35
Q3ZBN8116 Mitochondrial import inne yes N/A 0.956 0.956 0.610 3e-34
Q6PBT7115 Mitochondrial import inne yes N/A 0.948 0.956 0.592 2e-32
Q9CQV7116 Mitochondrial import inne yes N/A 0.956 0.956 0.610 3e-30
P91454112 Mitochondrial import inne yes N/A 0.956 0.991 0.560 5e-29
Q78YY6149 DnaJ homolog subfamily C no N/A 0.870 0.677 0.594 3e-28
Q9Y5T4150 DnaJ homolog subfamily C no N/A 0.965 0.746 0.539 1e-27
Q617M0111 Mitochondrial import inne N/A N/A 0.948 0.990 0.525 1e-27
>sp|Q9VTJ8|TIM14_DROME Mitochondrial import inner membrane translocase subunit TIM14 OS=Drosophila melanogaster GN=Tim14 PE=3 SV=2 Back     alignment and function desciption
 Score =  166 bits (419), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 100/118 (84%), Gaps = 2/118 (1%)

Query: 1   MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPK--AESFANSKYYKGGFEP 58
           MAS+ IL GL +AAVG+AG+++++  P  + + NEALK LPK  AES A SKYYKGGF+P
Sbjct: 1   MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDP 60

Query: 59  KMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK 116
           KM KREASLILGVS SA+++KIK+AHK+I+ LNHPDRGGSPYLAAKINEAKD L+++K
Sbjct: 61  KMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDKAK 118




Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity.
Drosophila melanogaster (taxid: 7227)
>sp|Q5RF34|TIM14_PONAB Mitochondrial import inner membrane translocase subunit TIM14 OS=Pongo abelii GN=DNAJC19 PE=3 SV=3 Back     alignment and function description
>sp|Q96DA6|TIM14_HUMAN Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens GN=DNAJC19 PE=1 SV=3 Back     alignment and function description
>sp|Q3ZBN8|TIM14_BOVIN Mitochondrial import inner membrane translocase subunit TIM14 OS=Bos taurus GN=DNAJC19 PE=3 SV=3 Back     alignment and function description
>sp|Q6PBT7|TIM14_DANRE Mitochondrial import inner membrane translocase subunit TIM14 OS=Danio rerio GN=dnajc19 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQV7|TIM14_MOUSE Mitochondrial import inner membrane translocase subunit TIM14 OS=Mus musculus GN=Dnajc19 PE=2 SV=3 Back     alignment and function description
>sp|P91454|TIM14_CAEEL Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis elegans GN=dnj-21 PE=3 SV=1 Back     alignment and function description
>sp|Q78YY6|DJC15_MOUSE DnaJ homolog subfamily C member 15 OS=Mus musculus GN=Dnajc15 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5T4|DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens GN=DNAJC15 PE=1 SV=2 Back     alignment and function description
>sp|Q617M0|TIM14_CAEBR Mitochondrial import inner membrane translocase subunit TIM14 OS=Caenorhabditis briggsae GN=dnj-21 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
195427395139 GK17173 [Drosophila willistoni] gi|19415 0.991 0.827 0.692 1e-40
195128765134 GI13707 [Drosophila mojavensis] gi|19392 0.982 0.850 0.689 5e-40
114052917119 DnaJ domain-containing protein [Bombyx m 1.0 0.974 0.694 5e-40
195589527128 GD14312 [Drosophila simulans] gi|1941965 0.991 0.898 0.683 2e-39
195493469128 GE21822 [Drosophila yakuba] gi|194180533 0.991 0.898 0.683 2e-39
24662741118 CG7394, isoform A [Drosophila melanogast 1.0 0.983 0.677 2e-39
194748224130 GF25273 [Drosophila ananassae] gi|190623 0.991 0.884 0.683 3e-39
195326826128 GM25281 [Drosophila sechellia] gi|194119 0.991 0.898 0.675 4e-39
195379638132 GJ14049 [Drosophila virilis] gi|19415574 0.982 0.863 0.672 5e-39
195018218130 GH14855 [Drosophila grimshawi] gi|193898 0.982 0.876 0.672 6e-39
>gi|195427395|ref|XP_002061762.1| GK17173 [Drosophila willistoni] gi|194157847|gb|EDW72748.1| GK17173 [Drosophila willistoni] Back     alignment and taxonomy information
 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 101/117 (86%), Gaps = 2/117 (1%)

Query: 2   ASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPK--AESFANSKYYKGGFEPK 59
           AS+ IL GLG+AAVG+AG+++++  P  + ++NEALK LPK  AES ANSKYYKGGFEPK
Sbjct: 23  ASSLILAGLGVAAVGFAGKHLVRRMPQMTTKINEALKNLPKFDAESMANSKYYKGGFEPK 82

Query: 60  MTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK 116
           M+KREA+LILGV+ SAN++KIK+AHK+I+ LNHPDRGGSPYLAAKINEAKD L+  K
Sbjct: 83  MSKREAALILGVNPSANKLKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDSGK 139




Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195128765|ref|XP_002008832.1| GI13707 [Drosophila mojavensis] gi|193920441|gb|EDW19308.1| GI13707 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|114052917|ref|NP_001040116.1| DnaJ domain-containing protein [Bombyx mori] gi|87248103|gb|ABD36104.1| DnaJ domain-containing protein [Bombyx mori] Back     alignment and taxonomy information
>gi|195589527|ref|XP_002084503.1| GD14312 [Drosophila simulans] gi|194196512|gb|EDX10088.1| GD14312 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195493469|ref|XP_002094432.1| GE21822 [Drosophila yakuba] gi|194180533|gb|EDW94144.1| GE21822 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24662741|ref|NP_648475.1| CG7394, isoform A [Drosophila melanogaster] gi|386770961|ref|NP_001246717.1| CG7394, isoform C [Drosophila melanogaster] gi|442631714|ref|NP_001261714.1| CG7394, isoform D [Drosophila melanogaster] gi|74870877|sp|Q9VTJ8.2|TIM14_DROME RecName: Full=Mitochondrial import inner membrane translocase subunit TIM14 gi|17946034|gb|AAL49060.1| RE52392p [Drosophila melanogaster] gi|23093624|gb|AAF50050.2| CG7394, isoform A [Drosophila melanogaster] gi|220948952|gb|ACL87019.1| CG7394-PA [synthetic construct] gi|220957726|gb|ACL91406.1| CG7394-PA [synthetic construct] gi|383291872|gb|AFH04388.1| CG7394, isoform C [Drosophila melanogaster] gi|440215637|gb|AGB94408.1| CG7394, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194748224|ref|XP_001956549.1| GF25273 [Drosophila ananassae] gi|190623831|gb|EDV39355.1| GF25273 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195326826|ref|XP_002030126.1| GM25281 [Drosophila sechellia] gi|194119069|gb|EDW41112.1| GM25281 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195379638|ref|XP_002048585.1| GJ14049 [Drosophila virilis] gi|194155743|gb|EDW70927.1| GJ14049 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195018218|ref|XP_001984743.1| GH14855 [Drosophila grimshawi] gi|193898225|gb|EDV97091.1| GH14855 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
FB|FBgn0036173118 CG7394 [Drosophila melanogaste 1.0 0.983 0.677 1.3e-38
UNIPROTKB|Q96DA6116 DNAJC19 "Mitochondrial import 0.982 0.982 0.606 2.5e-33
UNIPROTKB|Q3ZBN8116 DNAJC19 "Mitochondrial import 0.982 0.982 0.606 5.2e-33
UNIPROTKB|F1SGA9116 DNAJC19 "Uncharacterized prote 0.982 0.982 0.606 6.7e-33
ZFIN|ZDB-GENE-040426-1730115 dnajc19 "DnaJ (Hsp40) homolog, 0.974 0.982 0.589 3.3e-31
ZFIN|ZDB-GENE-040801-216149 dnajc15 "DnaJ (Hsp40) homolog, 0.939 0.731 0.570 7.1e-29
UNIPROTKB|A1A4R3149 DNAJC15 "Uncharacterized prote 0.939 0.731 0.587 1.2e-28
WB|WBGene00001039112 dnj-21 [Caenorhabditis elegans 0.956 0.991 0.560 1.5e-28
MGI|MGI:1913398149 Dnajc15 "DnaJ (Hsp40) homolog, 0.913 0.711 0.612 8.2e-28
RGD|1307154149 Dnajc15 "DnaJ (Hsp40) homolog, 0.913 0.711 0.603 1.3e-27
FB|FBgn0036173 CG7394 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 413 (150.4 bits), Expect = 1.3e-38, P = 1.3e-38
 Identities = 80/118 (67%), Positives = 100/118 (84%)

Query:     1 MASTAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPK--AESFANSKYYKGGFEP 58
             MAS+ IL GL +AAVG+AG+++++  P  + + NEALK LPK  AES A SKYYKGGF+P
Sbjct:     1 MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDP 60

Query:    59 KMTKREASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQSK 116
             KM KREASLILGVS SA+++KIK+AHK+I+ LNHPDRGGSPYLAAKINEAKD L+++K
Sbjct:    61 KMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDKAK 118




GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q96DA6 DNAJC19 "Mitochondrial import inner membrane translocase subunit TIM14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBN8 DNAJC19 "Mitochondrial import inner membrane translocase subunit TIM14" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGA9 DNAJC19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1730 dnajc19 "DnaJ (Hsp40) homolog, subfamily C, member 19" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-216 dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A1A4R3 DNAJC15 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00001039 dnj-21 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1913398 Dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307154 Dnajc15 "DnaJ (Hsp40) homolog, subfamily C, member 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q617M0TIM14_CAEBRNo assigned EC number0.52580.94820.9909N/AN/A
Q5RF34TIM14_PONABNo assigned EC number0.61060.95680.9568yesN/A
Q07914TIM14_YEASTNo assigned EC number0.53840.55170.3809yesN/A
Q759D2TIM14_ASHGONo assigned EC number0.53730.56890.4177yesN/A
Q6FPU1TIM14_CANGANo assigned EC number0.40860.87930.6666yesN/A
Q96DA6TIM14_HUMANNo assigned EC number0.61060.95680.9568yesN/A
P91454TIM14_CAEELNo assigned EC number0.56030.95680.9910yesN/A
Q9UT37TIM14_SCHPONo assigned EC number0.45210.87930.7285yesN/A
Q5B4H1TIM14_EMENINo assigned EC number0.45130.87060.9619yesN/A
Q3ZBN8TIM14_BOVINNo assigned EC number0.61060.95680.9568yesN/A
Q4WI88TIM14_ASPFUNo assigned EC number0.46950.87930.9714yesN/A
Q54QN1TIM14_DICDINo assigned EC number0.36360.91370.9380yesN/A
Q4I7T5TIM14_GIBZENo assigned EC number0.57570.56030.6190yesN/A
Q6CNW2TIM14_KLULANo assigned EC number0.43100.87060.6196yesN/A
Q8RV04TI141_ARATHNo assigned EC number0.47270.86200.8928yesN/A
Q6PBT7TIM14_DANRENo assigned EC number0.59290.94820.9565yesN/A
Q9CQV7TIM14_MOUSENo assigned EC number0.61060.95680.9568yesN/A
Q9VTJ8TIM14_DROMENo assigned EC number0.67791.00.9830yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
PTZ00100116 PTZ00100, PTZ00100, DnaJ chaperone protein; Provis 3e-23
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 6e-06
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 8e-06
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 5e-05
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 8e-05
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 1e-04
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-04
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-04
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 3e-04
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-04
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 6e-04
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 0.001
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 0.001
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 0.002
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 0.004
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 0.004
>gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional Back     alignment and domain information
 Score = 86.4 bits (214), Expect = 3e-23
 Identities = 44/108 (40%), Positives = 63/108 (58%)

Query: 5   AILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKRE 64
           A+  G G+ AV Y  RY+       S  ++  L     +      K    GFE  M+K E
Sbjct: 7   ALTFGGGVLAVRYGYRYLKNQKIFGSNNMSFPLSGFNPSLGSLFLKNDLKGFENPMSKSE 66

Query: 65  ASLILGVSQSANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLL 112
           A  IL +S +A++ +I+EAHK+++  NHPD GGS Y+A+K+NEAKDLL
Sbjct: 67  AYKILNISPTASKERIREAHKQLMLRNHPDNGGSTYIASKVNEAKDLL 114


Length = 116

>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG0723|consensus112 99.97
PTZ00100116 DnaJ chaperone protein; Provisional 99.94
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 99.94
KOG3442|consensus132 99.89
PHA03102153 Small T antigen; Reviewed 99.65
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.64
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.6
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.59
KOG0713|consensus 336 99.55
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.53
PRK14296 372 chaperone protein DnaJ; Provisional 99.5
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.47
PRK14288 369 chaperone protein DnaJ; Provisional 99.47
PRK14299 291 chaperone protein DnaJ; Provisional 99.47
PRK14286 372 chaperone protein DnaJ; Provisional 99.46
PRK14287 371 chaperone protein DnaJ; Provisional 99.44
PRK14279 392 chaperone protein DnaJ; Provisional 99.44
KOG0712|consensus 337 99.43
PRK14282 369 chaperone protein DnaJ; Provisional 99.42
PRK14285 365 chaperone protein DnaJ; Provisional 99.42
PRK10767 371 chaperone protein DnaJ; Provisional 99.42
PRK14294 366 chaperone protein DnaJ; Provisional 99.41
PRK14276 380 chaperone protein DnaJ; Provisional 99.41
PRK14280 376 chaperone protein DnaJ; Provisional 99.41
PRK14283 378 chaperone protein DnaJ; Provisional 99.4
PRK14298 377 chaperone protein DnaJ; Provisional 99.4
PHA02624 647 large T antigen; Provisional 99.4
PRK14301 373 chaperone protein DnaJ; Provisional 99.4
PRK14278 378 chaperone protein DnaJ; Provisional 99.39
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.38
PRK14295 389 chaperone protein DnaJ; Provisional 99.38
PRK14297 380 chaperone protein DnaJ; Provisional 99.38
KOG0721|consensus230 99.38
PRK14277 386 chaperone protein DnaJ; Provisional 99.37
PRK14281 397 chaperone protein DnaJ; Provisional 99.37
PRK14291 382 chaperone protein DnaJ; Provisional 99.34
PRK14300 372 chaperone protein DnaJ; Provisional 99.34
KOG0717|consensus 508 99.33
KOG0716|consensus 279 99.33
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.31
PRK14284 391 chaperone protein DnaJ; Provisional 99.3
PRK14289 386 chaperone protein DnaJ; Provisional 99.3
PRK14290 365 chaperone protein DnaJ; Provisional 99.3
PRK14292 371 chaperone protein DnaJ; Provisional 99.3
KOG0715|consensus 288 99.26
KOG0718|consensus 546 99.25
PRK14293 374 chaperone protein DnaJ; Provisional 99.25
KOG0691|consensus 296 99.19
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.17
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.12
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.09
PRK01356 166 hscB co-chaperone HscB; Provisional 99.05
PRK05014 171 hscB co-chaperone HscB; Provisional 99.05
KOG0719|consensus 264 98.99
KOG0722|consensus 329 98.99
PRK03578 176 hscB co-chaperone HscB; Provisional 98.97
PRK00294 173 hscB co-chaperone HscB; Provisional 98.96
KOG1789|consensus 2235 98.86
KOG0720|consensus 490 98.84
PRK01773 173 hscB co-chaperone HscB; Provisional 98.64
KOG1150|consensus 250 98.63
KOG0568|consensus 342 98.63
KOG0624|consensus504 98.61
KOG0714|consensus 306 98.58
TIGR00714 157 hscB Fe-S protein assembly co-chaperone HscB. This 98.5
KOG0550|consensus486 98.5
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.48
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 97.71
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.63
PF1344662 RPT: A repeated domain in UCH-protein 97.28
KOG0431|consensus453 96.92
PF11833 194 DUF3353: Protein of unknown function (DUF3353); In 95.71
KOG3192|consensus168 95.16
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 91.79
PF14687112 DUF4460: Domain of unknown function (DUF4460) 87.79
>KOG0723|consensus Back     alignment and domain information
Probab=99.97  E-value=1.9e-30  Score=171.56  Aligned_cols=107  Identities=61%  Similarity=0.968  Sum_probs=91.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCChhhhhhhcccccCCCCCCCCHHHHHHHhCCCCCCCHHHHHH
Q psy5623           3 STAILTGLGLAAVGYAGRYILKAAPMASARLNEALKALPKAESFANSKYYKGGFEPKMTKREASLILGVSQSANRMKIKE   82 (116)
Q Consensus         3 ~~~i~~~~~v~~~~~~gra~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~~~eA~~iLgl~~~~~~~~ik~   82 (116)
                      +++|++|++|+++++.||++++-+..+    .++++..+.  ....++||+|+|++.||+.||..||||++.++.+.||+
T Consensus         2 ~~~i~~G~gvaa~a~ag~~gl~~~~~~----~qa~~~~~~--~~~~~~~y~GGF~~kMsr~EA~lIL~v~~s~~k~Kike   75 (112)
T KOG0723|consen    2 VSPIIAGLGVAALAFAGRYGLWMKTLA----KQAFKTLPK--GPFFGAFYKGGFEPKMSRREAALILGVTPSLDKDKIKE   75 (112)
T ss_pred             chhHHHhHHHHHHHHhchhhhhchhHH----HHHHHHcCC--CcchhhhhhcccccccchHHHHHHhCCCccccHHHHHH
Confidence            347889999999999999999933222    233444443  33356899999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCCCHHHHHHHHHHHHHhccC
Q psy5623          83 AHKRIITLNHPDRGGSPYLAAKINEAKDLLEQS  115 (116)
Q Consensus        83 ~yr~l~~~~HPDk~gs~~~~~~i~~Ay~~L~~~  115 (116)
                      +||+++..||||+|||||+.++|||||++|...
T Consensus        76 aHrriM~~NHPD~GGSPYlAsKINEAKdlLe~~  108 (112)
T KOG0723|consen   76 AHRRIMLANHPDRGGSPYLASKINEAKDLLEGT  108 (112)
T ss_pred             HHHHHHHcCCCcCCCCHHHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999999864



>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG3442|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
2guz_A71 Structure Of The Tim14-tim16 Complex Of The Mitocho 2e-16
>pdb|2GUZ|A Chain A, Structure Of The Tim14-tim16 Complex Of The Mitochondrial Protein Import Motor Length = 71 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 35/65 (53%), Positives = 50/65 (76%), Gaps = 1/65 (1%) Query: 51 YYKGGFEPKMTKREASLILGVSQSA-NRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAK 109 + KGGF+PKM +EA IL ++++ + K+KE H++I+ NHPD+GGSP+LA KINEAK Sbjct: 2 FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAK 61 Query: 110 DLLEQ 114 D LE+ Sbjct: 62 DFLEK 66

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
2guz_A71 Mitochondrial import inner membrane translocase su 5e-29
2guz_B65 Mitochondrial import inner membrane translocase su 2e-17
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-07
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-06
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 3e-06
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 6e-05
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 4e-04
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 7e-04
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 7e-04
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
 Score = 99.0 bits (247), Expect = 5e-29
 Identities = 35/64 (54%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 51  YYKGGFEPKMTKREASLILGVSQSA-NRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAK 109
           + KGGF+PKM  +EA  IL ++++   + K+KE H++I+  NHPD+GGSP+LA KINEAK
Sbjct: 2   FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAK 61

Query: 110 DLLE 113
           D LE
Sbjct: 62  DFLE 65


>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 65 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
2guz_A71 Mitochondrial import inner membrane translocase su 99.9
2guz_B65 Mitochondrial import inner membrane translocase su 99.89
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.76
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.71
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.64
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.64
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.64
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.64
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.62
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.62
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.61
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.61
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.6
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.59
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.58
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.58
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.57
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.56
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.56
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.54
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.52
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.52
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.52
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.49
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.49
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.4
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.4
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.38
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 99.37
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 99.33
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.3
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.29
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.14
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.1
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.90  E-value=5.2e-24  Score=132.08  Aligned_cols=66  Identities=53%  Similarity=0.960  Sum_probs=63.1

Q ss_pred             ccccCCCCCCCCHHHHHHHhCCCC-CCCHHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhccC
Q psy5623          50 KYYKGGFEPKMTKREASLILGVSQ-SANRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQS  115 (116)
Q Consensus        50 ~~~~~~~~~~m~~~eA~~iLgl~~-~~~~~~ik~~yr~l~~~~HPDk~gs~~~~~~i~~Ay~~L~~~  115 (116)
                      .||.++|...|+.+++|+||||++ +++.++|+++||+|++++|||++|+++.|++|++||++|.++
T Consensus         1 ~~~~g~~~~~m~~~~~y~iLgl~~~~a~~~eIk~ayr~l~~~~HPDk~g~~~~f~~i~~Aye~L~~~   67 (71)
T 2guz_A            1 GFLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKR   67 (71)
T ss_dssp             CCCCSCCCSSCCHHHHHHHTTCCTTTCCHHHHHHHHHHHHHHHCGGGTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCcCCCCCCCCCHHHHHHHcCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHhhh
Confidence            378899999999999999999999 799999999999999999999999999999999999999874



>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.68
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.58
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.58
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.49
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.36
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.33
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]
Probab=99.76  E-value=2.9e-19  Score=111.42  Aligned_cols=54  Identities=24%  Similarity=0.327  Sum_probs=50.8

Q ss_pred             HHHHHHHhCCCCCC--CHHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhccC
Q psy5623          62 KREASLILGVSQSA--NRMKIKEAHKRIITLNHPDRGGSPYLAAKINEAKDLLEQS  115 (116)
Q Consensus        62 ~~eA~~iLgl~~~~--~~~~ik~~yr~l~~~~HPDk~gs~~~~~~i~~Ay~~L~~~  115 (116)
                      .+++|+||||++++  |.++|+++||++++.+|||+||+++.|++||+||++|.++
T Consensus        10 ~~~~y~iLgl~~~~~~~~~~IkkaYr~l~~~~HPDk~g~~e~~~~in~Ay~~L~d~   65 (79)
T d1fafa_          10 KERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTE   65 (79)
T ss_dssp             HHHHHHHHTCCSSSTTCHHHHHHHHHHHHHHSSGGGSCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhCCCCCCCCCHHHHHHHHHHHHHHhCcccCCCHHHHHHHHHHHHHHCCH
Confidence            47899999999987  8999999999999999999999999999999999999864



>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure