Psyllid ID: psy5651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840---
MEAKCQPQNNLLRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKEKESANEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYKSAECSTSRPESQCDKASDEC
cccccccccccccccccccEEEccHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEEEcccEEEEEEccccccccccHHHHHHHccccEEEEEEccHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHccccccHHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEEEccEEEEEccccccccEEEEEEEcccccccEEEEEccHHHHHHHHHHHHHHHHccccccccccccccccccEEccccEEEEcccccccccEEEEEEEccccccccEEEEccccHHHHHHHHHHHHHHccccccccccccccEEEEccEEEEEEcccccccEEEEEEEEccccccEEEEcccHHHHHHHHHHHHHHHHHHcHHHHHHHccEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEEEEEEEEccccccccccccEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEEcccccEEEEEEEEEcEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEcEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEcEEEEEEEEEcccccccEEEEEcccccHHHHHHHHHHHccccccccccccccccccccccccc
cccccccccHHHHHHHHccEEHHcHHHHHHHHHHHHcccEEEEEEccEEEccccEEEEEEEEccccEEEEEEEHHccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccEEccccHHHHHHHHHHHHcccccccccccccEcHHHHHHHHcccccHHHHHHHHHHHHcccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEEcccccHHHcHHHccHHHHcccHHHHccccccHHHHHcEEEEEcccEEEEEEcccccccEEEEEEEcccccccEEEEcHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEEcccccccEEEEEEEEccccccccEEEEcHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccEEEEEccccccEEEEEEEEEccccccEEEEcHHHHHHHHHHHHcccHHHHHHHHcEEEHHccccEEEcccccEEEEEEccccHHEHccHcccEEEEEEEEEEEcccccHHHHHHHHHHHHEHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEHEEHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHEEEEEcEEEEEHHHHHHHHHHEEEcEEEEEEEEEccEEEEEEEEEEEEccEEEEEEEEEEEEEcccccccEEEEEEEEcccEEEEcHHHHHEEEEEEEEEEcccccHEEEcccccccccccEEEEEcccccHHHHHHHHHHccccHccccccccccccccccccccc
MEAKCQPQNNLLRTLMNRTNLITDVQEAQSAMATILNESkvgldlegmdlgvdgKVSLVSLALQngkififdvyscplimfdgkLHEVLESDRILKVIHGAfgdaggllsNFNIRLknvydtqcaftalqlsdprllsqdlvphtiglnDLLKFYKISPNNFKKNIQNLyrenphiwktrpltsDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFnhvvplniRKRRQFRQNQLRRWRKDlmsskrpypyieevnsneyiwrndynvplanakllnnpinrmfhkekesaNEERIEVIDTKmyqcfnkkfyfdikqskstkFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAhqntprhryrdthtiksevLIKDTRRYFLDLKDNGRARFVTISQllpvggklssiafpaqdlgpIIGLISdlqqehscpededgapegnymrcnnkrfffnvskngkgtfmriseistpskvltnigiksniktdtnirtnninvkmKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMkmtnvvppsyrasitipersWDRFIETFHQTCdlyksaecstsrpesqcdkasdec
MEAKCQPQNNLLRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFnhvvplnirkrrqfrqnqlrrwrkdlmsskrpypyieeVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKEKESANEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTahqntprhryrdthtiksevlikdTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRiseistpskvltnigiksniktdtnirtnninvkmktniiikmkrriniittmkrsniikmkrrtniitkmkmsnikMKINTikmkmktnnitkakmktsikMKINIITKMKMEIIAKMKMNNTKmkisvttkmesvKMVNIFTRMEMKTNIIArvkrmtnvkMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTkiitkvkmktsikmkintfkvkmkisiitkmnitnikmKINVITKMNMETNNITIKMIRMTDIKMKINTitkikvaniiikvtkktnniitkmkmtnvvppsyrASITIPERSWDRFIETFHQTCDLYksaecstsrpesqcdkasdec
MEAKCQPQnnllrtlmnrtnlITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKEKESANEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRtnninvkmktniiikmkrriniittMKRSNIIKMKRRTniitkmkmsnikmkintikmkmktnnitkakmktsikmkiniitkmkmeiiakmkmNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVkmkiniiikimmAktsikmttniiikmkismimkakihiNKVKVNitkmimtkiitkvkmktsikmkiNTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMtdikmkintitkikvaniiikvtkktnniitkmkmtnVVPPSYRASITIPERSWDRFIETFHQTCDLYKSAECSTSRPESQCDKASDEC
***********LRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFH*********RIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDL*****************YMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYK********************
****************NRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVN******************L****INR***************VIDTKMYQCFNKKFYFDIKQSKSTKFIKI************HISMSVVGHLRDHLNALLTA*************************RYFLDLKDNGRARFV******************AQDLGPIIGLISDLQQ******************CNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYKS*******************
MEAKCQPQNNLLRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKEKESANEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDL************APEGNYMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYK********************
********NNLLRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKE*E**NEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPR*******TIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYKS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAKCQPQNNLLRTLMNRTNLITDVQEAQSAMATILNESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYETLFNHVVPLNIRKRRQFRQNQLRRWRKDLMSSKRPYPYIEEVNSNEYIWRNDYNVPLANAKLLNNPINRMFHKEKESANEERIEVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNIRTNNINVKMKTNIIIKMKRRINIITTMKRSNIIKMKRRTNIITKMKMSNIKMKINTIKMKMKTNNITKAKMKTSIKMKINIITKMKMEIIAKMKMNNTKMKISVTTKMESVKMVNIFTRMEMKTNIIARVKRMTNVKMKINIIIKIMMAKTSIKMTTNIIIKMKISMIMKAKIHINKVKVNITKMIMTKIITKVKMKTSIKMKINTFKVKMKISIITKMNITNIKMKINVITKMNMETNNITIKMIRMTDIKMKINTITKIKVANIIIKVTKKTNNIITKMKMTNVVPPSYRASITIPERSWDRFIETFHQTCDLYKSAECSTSRPESQCDKASDEC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query843 2.2.26 [Sep-21-2011]
Q00577322 Transcriptional activator yes N/A 0.204 0.534 0.346 4e-26
P42669321 Transcriptional activator yes N/A 0.204 0.535 0.346 4e-26
Q6PHK6297 Transcriptional activator no N/A 0.214 0.609 0.293 4e-19
Q96QR8312 Transcriptional activator no N/A 0.223 0.602 0.272 8e-19
Q6PAC9323 Transcriptional activator N/A N/A 0.218 0.569 0.270 1e-18
O35295324 Transcriptional activator no N/A 0.205 0.533 0.284 2e-18
Q8R4E6350 Purine-rich element-bindi no N/A 0.246 0.594 0.271 2e-18
Q8AVS4328 Transcriptional activator N/A N/A 0.218 0.560 0.271 2e-18
Q9UJV8347 Purine-rich element-bindi no N/A 0.246 0.599 0.256 3e-18
Q68A21315 Transcriptional activator no N/A 0.225 0.603 0.273 3e-18
>sp|Q00577|PURA_HUMAN Transcriptional activator protein Pur-alpha OS=Homo sapiens GN=PURA PE=1 SV=2 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 104/205 (50%), Gaps = 33/205 (16%)

Query: 318 NKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNAL------------ 365
           NK+FY D+KQ+   +F+KI+EV     ++++ +SMSV    RD+L               
Sbjct: 70  NKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQP 129

Query: 366 --LTAHQNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSS- 422
             L   Q+ PR        +KSE L+++ R+Y++DLK+N R RF+ I Q +  G  L S 
Sbjct: 130 PDLAQAQDEPRR------ALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGST 183

Query: 423 ----IAFPAQDLGPIIGLISDLQQEHSCPEDEDGAPEGNYMRCNNKRFFFNVSKNGKGTF 478
               IA PAQ L      ++ L  ++   E+    PEG  +  +NKRFFF+V  N  G F
Sbjct: 184 QGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVF 243

Query: 479 MRISE--------ISTPSKVLTNIG 495
           MR+SE        I+ P KV    G
Sbjct: 244 MRVSEVKPTYRNSITVPYKVWAKFG 268
This is a probable transcription activator that specifically binds the purine-rich single strand of the PUR element located upstream of the MYC gene. May play a role in the initiation of DNA replication and in recombination.
Homo sapiens (taxid: 9606)
>sp|P42669|PURA_MOUSE Transcriptional activator protein Pur-alpha OS=Mus musculus GN=Pura PE=1 SV=1 Back     alignment and function description
>sp|Q6PHK6|PURB_DANRE Transcriptional activator protein Pur-beta OS=Danio rerio GN=purb PE=2 SV=3 Back     alignment and function description
>sp|Q96QR8|PURB_HUMAN Transcriptional activator protein Pur-beta OS=Homo sapiens GN=PURB PE=1 SV=3 Back     alignment and function description
>sp|Q6PAC9|PURBA_XENLA Transcriptional activator protein Pur-beta-A OS=Xenopus laevis GN=purb-a PE=2 SV=3 Back     alignment and function description
>sp|O35295|PURB_MOUSE Transcriptional activator protein Pur-beta OS=Mus musculus GN=Purb PE=1 SV=3 Back     alignment and function description
>sp|Q8R4E6|PURG_MOUSE Purine-rich element-binding protein gamma OS=Mus musculus GN=Purg PE=1 SV=1 Back     alignment and function description
>sp|Q8AVS4|PURBB_XENLA Transcriptional activator protein Pur-beta-B OS=Xenopus laevis GN=purb-b PE=2 SV=3 Back     alignment and function description
>sp|Q9UJV8|PURG_HUMAN Purine-rich element-binding protein gamma OS=Homo sapiens GN=PURG PE=2 SV=1 Back     alignment and function description
>sp|Q68A21|PURB_RAT Transcriptional activator protein Pur-beta OS=Rattus norvegicus GN=Purb PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query843
307190558298 Transcriptional activator protein Pur-al 0.199 0.563 0.386 2e-32
156538218324 PREDICTED: transcriptional activator pro 0.199 0.518 0.391 3e-32
383864047398 PREDICTED: transcriptional activator pro 0.199 0.422 0.386 5e-32
357618157854 egalitarian [Danaus plexippus] 0.262 0.258 0.330 2e-31
91085021275 PREDICTED: similar to AGAP010564-PA [Tri 0.221 0.68 0.386 2e-31
350413401382 PREDICTED: transcriptional activator pro 0.199 0.439 0.380 3e-31
340717286382 PREDICTED: transcriptional activator pro 0.199 0.439 0.380 3e-31
328775950382 PREDICTED: transcriptional activator pro 0.199 0.439 0.380 3e-31
307200958270 Transcriptional activator protein Pur-al 0.213 0.666 0.368 7e-31
350413404305 PREDICTED: transcriptional activator pro 0.199 0.550 0.380 8e-31
>gi|307190558|gb|EFN74545.1| Transcriptional activator protein Pur-alpha [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  147 bits (371), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 114/189 (60%), Gaps = 21/189 (11%)

Query: 311 TKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAH- 369
           TKM Q  +K+FY D+KQ++  +FIK++E+  D  R+QI++++S     RDHL+     + 
Sbjct: 44  TKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSTFSDFYA 103

Query: 370 -------QNTPRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSS 422
                  +N P     D   +KSE+++KD RRY+LDLK+N R RF+ +SQ +  GG  + 
Sbjct: 104 SLGPPNPENVP-----DDGKLKSEMMVKDNRRYYLDLKENSRGRFLRVSQTITRGGPRTQ 158

Query: 423 IAFPAQDLGPIIGLISDLQQEHSCPEDEDGA-----PEGNYMRCNNKRFFFNVSKNGKGT 477
           IA PAQ +      ++DL +E      +DG      PEG YMR ++K F+F++ +N +G 
Sbjct: 159 IAIPAQGMIEFRDALTDLLEEFGT---DDGGFKGDLPEGRYMRVDSKNFYFDIGQNNRGI 215

Query: 478 FMRISEIST 486
           +MRISE+ T
Sbjct: 216 YMRISEVKT 224

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156538218|ref|XP_001601888.1| PREDICTED: transcriptional activator protein Pur-alpha-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383864047|ref|XP_003707491.1| PREDICTED: transcriptional activator protein Pur-beta-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357618157|gb|EHJ71251.1| egalitarian [Danaus plexippus] Back     alignment and taxonomy information
>gi|91085021|ref|XP_973667.1| PREDICTED: similar to AGAP010564-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350413401|ref|XP_003489984.1| PREDICTED: transcriptional activator protein Pur-alpha-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340717286|ref|XP_003397116.1| PREDICTED: transcriptional activator protein Pur-alpha-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328775950|ref|XP_001122141.2| PREDICTED: transcriptional activator protein Pur-alpha-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307200958|gb|EFN80947.1| Transcriptional activator protein Pur-alpha [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350413404|ref|XP_003489985.1| PREDICTED: transcriptional activator protein Pur-alpha-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query843
FB|FBgn0022361275 Pur-alpha "Purine-rich binding 0.206 0.632 0.383 3.6e-36
ZFIN|ZDB-GENE-040624-8287 pura "purine-rich element bind 0.219 0.644 0.328 4.9e-29
UNIPROTKB|E1BMW9322 PURA "Uncharacterized protein" 0.215 0.565 0.343 4.4e-28
UNIPROTKB|Q00577322 PURA "Transcriptional activato 0.215 0.565 0.343 4.4e-28
UNIPROTKB|I3LCN6322 PURA "Uncharacterized protein" 0.215 0.565 0.343 4.4e-28
MGI|MGI:103079321 Pura "purine rich element bind 0.215 0.566 0.343 4.4e-28
FB|FBgn00005621004 egl "egalitarian" [Drosophila 0.240 0.202 0.373 7.7e-28
UNIPROTKB|Q9MYX6321 Q9MYX6 "DNA binding protein pu 0.214 0.563 0.343 7e-27
ZFIN|ZDB-GENE-040426-1478297 purbb "purine-rich element bin 0.136 0.387 0.314 9.6e-20
UNIPROTKB|Q96QR8312 PURB "Transcriptional activato 0.148 0.400 0.294 1.9e-18
FB|FBgn0022361 Pur-alpha "Purine-rich binding protein-alpha" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 3.6e-36, Sum P(2) = 3.6e-36
 Identities = 69/180 (38%), Positives = 110/180 (61%)

Query:   311 TKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLT--A 368
             TKM Q  +K+FY D+KQ++  +FIK++E+  D  R+QI++++S     RDHL++     A
Sbjct:    46 TKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYA 105

Query:   369 HQNTPR-HRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPA 427
                 P      +   +KSE++IKD RRY+LDLK+N R RF+ +SQ +  GG  S IA PA
Sbjct:   106 SLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPA 165

Query:   428 QDLGPIIGLISDLQQEHSCPED---EDGAPEGNYMRCNNKRFFFNVSKNGKGTFMRISEI 484
             Q +      ++DL +E    +    +   PE  +M+ +NK F+F++ +N +G +MRISE+
Sbjct:   166 QGMIEFRDALTDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEV 225
GO:0003697 "single-stranded DNA binding" evidence=NAS
GO:0003677 "DNA binding" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0031935 "regulation of chromatin silencing" evidence=IMP
ZFIN|ZDB-GENE-040624-8 pura "purine-rich element binding protein A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMW9 PURA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q00577 PURA "Transcriptional activator protein Pur-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCN6 PURA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:103079 Pura "purine rich element binding protein A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0000562 egl "egalitarian" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9MYX6 Q9MYX6 "DNA binding protein pur-alpha" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1478 purbb "purine-rich element binding protein Bb" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96QR8 PURB "Transcriptional activator protein Pur-beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query843
cd06148197 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease dom 2e-42
pfam04845218 pfam04845, PurA, PurA ssDNA and RNA-binding protei 3e-37
cd06142178 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domai 3e-21
smart00474172 smart00474, 35EXOc, 3'-5' exonuclease 2e-20
pfam01612172 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease 6e-20
cd06141170 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain o 3e-16
cd06129161 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease doma 3e-15
COG0349361 COG0349, Rnd, Ribonuclease D [Translation, ribosom 1e-14
cd09018150 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' e 3e-10
cd06147192 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease d 2e-09
smart0071263 smart00712, PUR, DNA/RNA-binding repeats in PUR-al 3e-08
cd06146193 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease d 4e-07
smart0071263 smart00712, PUR, DNA/RNA-binding repeats in PUR-al 2e-06
TIGR01388367 TIGR01388, rnd, ribonuclease D 3e-05
pfam04845218 pfam04845, PurA, PurA ssDNA and RNA-binding protei 5e-04
smart0071263 smart00712, PUR, DNA/RNA-binding repeats in PUR-al 7e-04
>gnl|CDD|99851 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information 
 Score =  153 bits (388), Expect = 2e-42
 Identities = 68/181 (37%), Positives = 99/181 (54%), Gaps = 5/181 (2%)

Query: 37  NESKVGLDLEGMDLGVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILK 96
            +  +GLD EG++LG  GK+ LV +A + G+I++FD+     I+F   L ++LES +ILK
Sbjct: 9   KQKVIGLDCEGVNLGRKGKLCLVQIATRTGQIYLFDILKLGSIVFINGLKDILESKKILK 68

Query: 97  VIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPH-TIGLNDLLKFY 155
           VIH    D+  L   + I+L NV+DTQ A   LQ       +    P   I L  LL  Y
Sbjct: 69  VIHDCRRDSDALYHQYGIKLNNVFDTQVADALLQ----EQETGGFNPDRVISLVQLLDKY 124

Query: 156 KISPNNFKKNIQNLYRENPHIWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRL 215
                + K++++ L RE+P  W  RPLT DM+ YAA DV  LL L++ M      K  + 
Sbjct: 125 LYISISLKEDVKKLMREDPKFWALRPLTEDMIRYAALDVLCLLPLYYAMLDALISKFLKA 184

Query: 216 L 216
           +
Sbjct: 185 V 185

The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs. Some members of this subfamily do not have a completely conserved YX(3)D pattern at the ExoIII motif. Length = 197
>gnl|CDD|218289 pfam04845, PurA, PurA ssDNA and RNA-binding protein Back     alignment and domain information
>gnl|CDD|176654 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>gnl|CDD|214681 smart00474, 35EXOc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|216604 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|176653 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>gnl|CDD|176650 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|223426 COG0349, Rnd, Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|176656 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|99850 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>gnl|CDD|197840 smart00712, PUR, DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria Back     alignment and domain information
>gnl|CDD|176655 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>gnl|CDD|197840 smart00712, PUR, DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria Back     alignment and domain information
>gnl|CDD|130455 TIGR01388, rnd, ribonuclease D Back     alignment and domain information
>gnl|CDD|218289 pfam04845, PurA, PurA ssDNA and RNA-binding protein Back     alignment and domain information
>gnl|CDD|197840 smart00712, PUR, DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 843
PF04845218 PurA: PurA ssDNA and RNA-binding protein; InterPro 100.0
KOG3074|consensus263 100.0
PRK10829373 ribonuclease D; Provisional 100.0
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structu 100.0
TIGR01388367 rnd ribonuclease D. This model describes ribonucle 100.0
PF04845218 PurA: PurA ssDNA and RNA-binding protein; InterPro 100.0
KOG3074|consensus263 99.97
KOG2206|consensus687 99.96
cd06129161 RNaseD_like DEDDy 3'-5' exonuclease domain of RNas 99.96
cd06148197 Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro 99.96
cd06146193 mut-7_like_exo DEDDy 3'-5' exonuclease domain of C 99.96
cd06141170 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and 99.95
PF01612176 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00 99.94
cd06142178 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon 99.88
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo 99.81
smart0071263 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamm 99.79
cd06147192 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y 99.78
PRK05755880 DNA polymerase I; Provisional 99.73
cd06140178 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' 99.68
cd09018150 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease 99.66
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is res 99.66
cd06139193 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease 99.62
PRK14975553 bifunctional 3'-5' exonuclease/DNA polymerase; Pro 99.6
smart0071263 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamm 99.51
KOG2207|consensus617 99.34
TIGR00593887 pola DNA polymerase I. This family is based on the 99.31
COG0749593 PolA DNA polymerase I - 3'-5' exonuclease and poly 99.29
cd06128151 DNA_polA_exo DEDDy 3'-5' exonuclease domain of fam 98.86
KOG2405|consensus458 97.9
KOG4373|consensus319 97.76
KOG2405|consensus458 97.38
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 97.28
PRK07942232 DNA polymerase III subunit epsilon; Provisional 97.19
PRK06063313 DNA polymerase III subunit epsilon; Provisional 97.11
PRK07740244 hypothetical protein; Provisional 97.07
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 97.07
PF11680124 DUF3276: Protein of unknown function (DUF3276); In 97.06
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 96.8
PRK06310250 DNA polymerase III subunit epsilon; Validated 96.74
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 96.67
PRK05168211 ribonuclease T; Provisional 96.66
PRK05711240 DNA polymerase III subunit epsilon; Provisional 96.6
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 96.58
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 96.48
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 96.47
PRK06309232 DNA polymerase III subunit epsilon; Validated 96.46
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 96.4
PRK06807313 DNA polymerase III subunit epsilon; Validated 96.35
PRK09146239 DNA polymerase III subunit epsilon; Validated 96.33
PRK07883557 hypothetical protein; Validated 96.28
PRK06195309 DNA polymerase III subunit epsilon; Validated 96.25
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 96.17
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 96.14
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 96.11
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 96.03
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 95.98
PRK08517257 DNA polymerase III subunit epsilon; Provisional 95.96
PRK05601377 DNA polymerase III subunit epsilon; Validated 95.93
PRK09145202 DNA polymerase III subunit epsilon; Validated 95.87
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 95.85
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 95.36
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 95.36
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 95.16
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 95.14
smart0034181 HRDC Helicase and RNase D C-terminal. Hypothetical 95.03
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 94.8
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 94.33
PRK09182294 DNA polymerase III subunit epsilon; Validated 94.28
KOG2249|consensus280 94.09
PRK00448 1437 polC DNA polymerase III PolC; Validated 93.59
cd05780195 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom 93.57
PRK07983219 exodeoxyribonuclease X; Provisional 93.06
PF0057068 HRDC: HRDC domain Bloom syndrome. Werner syndrome. 92.78
PRK11779476 sbcB exonuclease I; Provisional 91.53
PRK07247195 DNA polymerase III subunit epsilon; Validated 90.92
PF11680124 DUF3276: Protein of unknown function (DUF3276); In 90.59
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 90.34
cd06133176 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o 90.28
cd05781188 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of 89.77
cd06143174 PAN2_exo DEDDh 3'-5' exonuclease domain of the euk 88.8
cd05785207 DNA_polB_like2_exo Uncharacterized bacterial subgr 88.37
cd05782208 DNA_polB_like1_exo Uncharacterized bacterial subgr 87.82
PRK06722281 exonuclease; Provisional 87.24
COG0847243 DnaQ DNA polymerase III, epsilon subunit and relat 84.62
PRK07748207 sporulation inhibitor KapD; Provisional 84.48
cd06138183 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o 81.09
PF10108209 DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate 80.45
>PF04845 PurA: PurA ssDNA and RNA-binding protein; InterPro: IPR006628 The Pur protein family consists of four known members in humans and is strongly conserved throughout evolution Back     alignment and domain information 
Probab=100.00  E-value=2e-62  Score=495.95  Aligned_cols=198  Identities=36%  Similarity=0.596  Sum_probs=122.5

Q ss_pred             ccchhhHHhhhhhHhhhhccCCccceEEeeecCCccceeEEEecchHHHHHHHHHHHHHHhcC-CC--CCCCCCcc--cc
Q psy5651         309 IDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQN-TP--RHRYRDTH--TI  383 (843)
Q Consensus       309 L~Sk~L~~l~Kr~y~DlKeN~RGrFlkI~E~~~~g~rs~I~ls~~~~~efrd~L~~lie~y~~-~~--~~~~~~~~--~l  383 (843)
                      |+||+|+.++||||+|+|||.||||+||+|++++|++|+|+||+++|+||||||++|+|+|++ +|  ++.+++++  .|
T Consensus         4 Lask~l~iq~KrfYlDVkqN~RGrfiKiaE~~~~g~ksri~lsm~~A~efrd~L~~f~~~ya~l~p~n~~~~~~~~~~~l   83 (218)
T PF04845_consen    4 LASKMLQIQNKRFYLDVKQNRRGRFIKIAEVGAGGRKSRITLSMSAAAEFRDHLGDFIEFYAQLGPSNPENLPDEGRSEL   83 (218)
T ss_dssp             EEEEEEEETTEEEEEEEEEETTEEEEEEEEE-TT--EEEEEEEHHHHHHHHHHHHHHHHHHHCS-S--SS---TT---EC
T ss_pred             hhhhheEecceEEEEEecccCcceeEEEeeccCCCCcceEEEechhHHHHHHHHHHHHHHHhccCCCCccccccccccee
Confidence            999999999999999999999999999999999999999999999999999999999999999 65  55666665  99


Q ss_pred             ccceeeecccEEEEeccCCCcceEEEEEecccCC--CCCceEEEcccCHHHHHHHHHHHHHHhCCCCC---CCCCCCCce
Q psy5651         384 KSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVG--GKLSSIAFPAQDLGPIIGLISDLQQEHSCPED---EDGAPEGNY  458 (843)
Q Consensus       384 ~Se~i~ve~KrFyfDlkeN~RGrFLRISE~~~r~--~~Rs~I~IPa~g~~~Frd~L~~l~ee~~~~~~---~~~lp~s~~  458 (843)
                      +||.|++|+|+||||||||+|||||||||..++|  |.|+||+|||+|+.+|+|||.+|+++||++++   .++||+|++
T Consensus        84 kSe~i~~e~r~yylDLKEN~RGrfLRisq~~~~~~~~~R~qIaiPa~G~~ef~~al~~lid~~g~~~~~~~~~~Lpes~~  163 (218)
T PF04845_consen   84 KSEKINVENRRYYLDLKENSRGRFLRISQTVSRGPRGRRSQIAIPAQGMIEFRDALTDLIDEFGEDDEEDEQGELPESKS  163 (218)
T ss_dssp             EEEEEEETTEEEEEEEEEETTEEEEEEEEEETTT----EEEEEEEGGGHHHHHHHHHHHHHHH-----------------
T ss_pred             eehheeeccceEEEEcccccCcceEEEEEeeccCCCCCccEEEEehHHHHHHHHHHHHHHHHhcCcccccccccCCCCcE
Confidence            9999999999999999999999999999998877  89999999999999999999999999999762   335999999


Q ss_pred             eeeeceEEEEEcCCCCceeEEEEeeecCCCCceeEEeeccccccCCcc
Q psy5651         459 MRCNNKRFFFNVSKNGKGTFMRISEISTPSKVLTNIGIKSNIKTDTNI  506 (843)
Q Consensus       459 ~r~d~K~fyFD~g~N~rG~fLRISEv~~~~r~~~~i~~~~~~~~~~~~  506 (843)
                      +++|||+||||+|+|+||+|||||||++++|+.|+||.++|++|-+-+
T Consensus       164 lrvdnK~FyFD~g~N~rG~fLrISEv~~~~Rs~ItIP~~~w~~Fr~~~  211 (218)
T PF04845_consen  164 LRVDNKRFYFDVGSNRRGVFLRISEVKSNFRSAITIPESAWSRFRDIF  211 (218)
T ss_dssp             ------------------------------------------------
T ss_pred             EEECCeEEEEECCCCCCeeEEEecccCCCCCceeeCCHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999997744

Pur-alpha is a highly conserved, sequence-specific DNA- and RNA-binding protein involved in diverse cellular and viral functions including transcription, replication, and cell growth. Pur-alpha has a modular structure with alternating three basic aromatic class I and two acidic leucine-rich class II repeats in the central region of the protein []. In addition to its involved in basic cellular function, Pur-alpha, has been implicated in the development of blood cells and cells of the central nervous system; it has also been implicated in the inhibition of oncogenic transformation and along with Pur-beta in myelodysplastic syndrome progressing to acute myelogenous leukemia. Pur-alpha can influence viral interaction through functional associations, for example with the Tat protein and TAR RNA of HIV-1, and with large T-antigen and DNA regulatory regions of JC virus. JC virus causes opportunistic infections in the brains of certain HIV-1-infected individuals [].; PDB: 3K44_A.
>KOG3074|consensus Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PF04845 PurA: PurA ssDNA and RNA-binding protein; InterPro: IPR006628 The Pur protein family consists of four known members in humans and is strongly conserved throughout evolution Back     alignment and domain information
>KOG3074|consensus Back     alignment and domain information
>KOG2206|consensus Back     alignment and domain information
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides Back     alignment and domain information
>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>smart00712 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria Back     alignment and domain information
>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases Back     alignment and domain information
>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>PRK14975 bifunctional 3'-5' exonuclease/DNA polymerase; Provisional Back     alignment and domain information
>smart00712 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria Back     alignment and domain information
>KOG2207|consensus Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06128 DNA_polA_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases Back     alignment and domain information
>KOG2405|consensus Back     alignment and domain information
>KOG4373|consensus Back     alignment and domain information
>KOG2405|consensus Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>PF11680 DUF3276: Protein of unknown function (DUF3276); InterPro: IPR021694 This bacterial family of proteins has no known function Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00341 HRDC Helicase and RNase D C-terminal Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG2249|consensus Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PRK07983 exodeoxyribonuclease X; Provisional Back     alignment and domain information
>PF00570 HRDC: HRDC domain Bloom syndrome Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF11680 DUF3276: Protein of unknown function (DUF3276); InterPro: IPR021694 This bacterial family of proteins has no known function Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins Back     alignment and domain information
>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2 Back     alignment and domain information
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>PRK06722 exonuclease; Provisional Back     alignment and domain information
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07748 sporulation inhibitor KapD; Provisional Back     alignment and domain information
>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins Back     alignment and domain information
>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query843
3k44_A146 Crystal Structure Of Drosophila Melanogaster Pur-Al 7e-23
3k44_A146 Crystal Structure Of Drosophila Melanogaster Pur-Al 5e-04
2fbt_A205 Wrn Exonuclease Length = 205 2e-07
2e6l_A208 Structure Of Mouse Wrn Exonuclease Domain Length = 7e-06
3saf_A428 Crystal Structure Of The Human Rrp6 Catalytic Domai 1e-05
3sah_A428 Crystal Structure Of The Human Rrp6 Catalytic Domai 2e-04
2hbj_A410 Structure Of The Yeast Nuclear Exosome Component, R 5e-04
>pdb|3K44|A Chain A, Crystal Structure Of Drosophila Melanogaster Pur-Alpha Length = 146 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (264), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 84/136 (61%), Gaps = 3/136 (2%)
Query: 311 TKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNAL--LTA 368
           TKM Q  +K+FY D+KQ++  +FIK++E+  D  R+QI++++S     RDHL++     A
Sbjct: 7   TKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYA 66
Query: 369 HQNTPR-HRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPA 427
               P      +   +KSE++IKD RRY+LDLK+N R RF+ +SQ +  GG  S IA PA
Sbjct: 67  SLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPA 126
Query: 428 QDLGPIIGLISDLQQE 443
           Q +      ++DL +E
Sbjct: 127 QGMIEFRDALTDLLEE 142
>pdb|3K44|A Chain A, Crystal Structure Of Drosophila Melanogaster Pur-Alpha Length = 146 Back     alignment and structure
>pdb|2FBT|A Chain A, Wrn Exonuclease Length = 205 Back     alignment and structure
>pdb|2E6L|A Chain A, Structure Of Mouse Wrn Exonuclease Domain Length = 208 Back     alignment and structure
>pdb|3SAF|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With D313n Mutation In The Active Site Length = 428 Back     alignment and structure
>pdb|3SAH|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With Y436a Mutation In The Catalytic Site Length = 428 Back     alignment and structure
>pdb|2HBJ|A Chain A, Structure Of The Yeast Nuclear Exosome Component, Rrp6p, Reveals An Interplay Between The Active Site And The Hrdc Domain Length = 410 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query843
3k44_A146 Purine-rich binding protein-alpha, isoform B; PUR- 7e-26
3k44_A146 Purine-rich binding protein-alpha, isoform B; PUR- 5e-13
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 4e-23
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 1e-20
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 1e-20
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 2e-20
3cym_A440 Uncharacterized protein BAD_0989; structural genom 2e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 4e-10
>3k44_A Purine-rich binding protein-alpha, isoform B; PUR-alpha, PUR repeat, PUR domain, whirly fold, DNA binding protein, RNA binding protein; 2.10A {Drosophila melanogaster} Length = 146 Back     alignment and structure
 Score =  103 bits (257), Expect = 7e-26
 Identities = 53/142 (37%), Positives = 86/142 (60%), Gaps = 3/142 (2%)

Query: 307 EVIDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALL 366
           + + TKM Q  +K+FY D+KQ++  +FIK++E+  D  R+QI++++S     RDHL++  
Sbjct: 3   QELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFS 62

Query: 367 TAHQNT---PRHRYRDTHTIKSEVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSI 423
             + +          +   +KSE++IKD RRY+LDLK+N R RF+ +SQ +  GG  S I
Sbjct: 63  DYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQI 122

Query: 424 AFPAQDLGPIIGLISDLQQEHS 445
           A PAQ +      ++DL +E  
Sbjct: 123 ALPAQGMIEFRDALTDLLEEFG 144
>3k44_A Purine-rich binding protein-alpha, isoform B; PUR-alpha, PUR repeat, PUR domain, whirly fold, DNA binding protein, RNA binding protein; 2.10A {Drosophila melanogaster} Length = 146 Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Length = 208 Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Length = 410 Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Length = 428 Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Length = 375 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query843
3k44_A146 Purine-rich binding protein-alpha, isoform B; PUR- 100.0
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 100.0
3k44_A146 Purine-rich binding protein-alpha, isoform B; PUR- 100.0
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 100.0
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 100.0
3cym_A440 Uncharacterized protein BAD_0989; structural genom 99.98
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 99.95
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 99.92
2kfn_A605 Klenow fragment of DNA polymerase I; complex (poly 99.8
3pv8_A592 DNA polymerase I; DNA polymerase I, protein-DNA co 99.71
1x9m_A698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 99.45
4dfk_A540 DNA polymerase I, thermostable; DNA polymerase, tr 99.27
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 98.55
1bgx_T832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 98.52
3n8b_A98 Uncharacterized protein; PUR-alpha, PUR repeat, PU 98.07
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 97.37
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 97.22
3nm7_A127 Uncharacterized protein; PUR-alpha, PUR repeat, PU 96.61
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 96.61
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 96.52
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 96.33
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 96.04
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 95.24
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 95.24
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 93.54
2qxf_A482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 92.7
1wud_A89 ATP-dependent DNA helicase RECQ; DNA-binding domai 92.44
3n8b_A98 Uncharacterized protein; PUR-alpha, PUR repeat, PU 92.37
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 91.21
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 88.41
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 87.85
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 86.9
3cg7_A308 CRN-4, cell death-related nuclease 4; hydrolase, a 86.79
2dgz_A113 Werner syndrome protein variant; HRDC domain, stru 85.54
2e1f_A103 Werner syndrome ATP-dependent helicase; HRDC domai 85.03
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 82.55
>3k44_A Purine-rich binding protein-alpha, isoform B; PUR-alpha, PUR repeat, PUR domain, whirly fold, DNA binding protein, RNA binding protein; 2.10A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.2e-44  Score=345.56  Aligned_cols=138  Identities=39%  Similarity=0.661  Sum_probs=132.4

Q ss_pred             ccchhhHHhhhhhHhhhhccCCccceEEeeecCCccceeEEEecchHHHHHHHHHHHHHHhcC-CC--CCCCCCcccccc
Q psy5651         309 IDTKMYQCFNKKFYFDIKQSKSTKFIKISEVNMDQTRNQIHISMSVVGHLRDHLNALLTAHQN-TP--RHRYRDTHTIKS  385 (843)
Q Consensus       309 L~Sk~L~~l~Kr~y~DlKeN~RGrFlkI~E~~~~g~rs~I~ls~~~~~efrd~L~~lie~y~~-~~--~~~~~~~~~l~S  385 (843)
                      |+|+.|..++|+||+|||||+|||||+|+|++.+|++++|+||+++++||+|+|++|+|+|++ ++  ++++|+++.|+|
T Consensus         5 L~S~~i~ie~KrfYlDlKeN~RGrfLkIsE~~~~g~rs~I~lp~~~~~efrd~L~~~ie~~~~~g~~~~~~~~~~~~l~s   84 (146)
T 3k44_A            5 LATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKS   84 (146)
T ss_dssp             EEEEEEEETTEEEEEEEEEETTEEEEEEEEECTTCCEEEEEECHHHHHHHHHHHHHHHHHHHTSCSCCSSCCCTTCEEEE
T ss_pred             ccceeEEEeceEEEEEecccCCeEEEEEEEecCCCcceEEEEEhhHHHHHHHHHHHHHHHHHhcCCCccccCCccccccc
Confidence            899999999999999999999999999999988899999999999999999999999999998 54  567888899999


Q ss_pred             ceeeecccEEEEeccCCCcceEEEEEecccCCCCCceEEEcccCHHHHHHHHHHHHHHhCC
Q psy5651         386 EVLIKDTRRYFLDLKDNGRARFVTISQLLPVGGKLSSIAFPAQDLGPIIGLISDLQQEHSC  446 (843)
Q Consensus       386 e~i~ve~KrFyfDlkeN~RGrFLRISE~~~r~~~Rs~I~IPa~g~~~Frd~L~~l~ee~~~  446 (843)
                      +.+++|+|+||||||+|+|||||||||+.++|++|++|+||++||.+|||+|++|+++||+
T Consensus        85 ~~i~~~~k~fyfDl~~N~RGrFLRIsE~~~~~~~R~~I~iP~~g~~~Fr~~l~~~~~~~~~  145 (146)
T 3k44_A           85 EMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  145 (146)
T ss_dssp             EEEEETTEEEEEEEEEETTEEEEEEEEEESSCCCCEEEEEEGGGHHHHHHHHHHHHHHHCC
T ss_pred             hheeccCceEEEEecccCcceEEEEEEeeccCCCcceEEecHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999778899999999999999999999999999985
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>3k44_A Purine-rich binding protein-alpha, isoform B; PUR-alpha, PUR repeat, PUR domain, whirly fold, DNA binding protein, RNA binding protein; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ... Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure
>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ... Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>3n8b_A Uncharacterized protein; PUR-alpha, PUR repeat, PUR domain, whirly fold, RNA binding, binding, nucleic acid binding protein; HET: MSE; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>3nm7_A Uncharacterized protein; PUR-alpha, PUR repeat, PUR domain, PURA, whirly fold, RNA BI DNA binding, nucleic acid binding protein; 2.20A {Borrelia burgdorferi} Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1 Back     alignment and structure
>3n8b_A Uncharacterized protein; PUR-alpha, PUR repeat, PUR domain, whirly fold, RNA binding, binding, nucleic acid binding protein; HET: MSE; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Back     alignment and structure
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Back     alignment and structure
>2dgz_A Werner syndrome protein variant; HRDC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.60.8.1 Back     alignment and structure
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 843
d1vk0a_206 c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thal 1e-12
d2hbka2292 c.55.3.5 (A:129-420) Exosome complex exonuclease R 3e-09
d1yt3a3193 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domai 8e-06
d1kfsa1195 c.55.3.5 (A:324-518) Exonuclease domain of prokary 5e-04
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Hypothetical protein AT5G06450
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 65.8 bits (160), Expect = 1e-12
 Identities = 26/201 (12%), Positives = 58/201 (28%), Gaps = 33/201 (16%)

Query: 22  ITDVQEAQSAMATILNESK------VGLDLE---------GMDLGVDGKVSLVSLALQNG 66
           +    +    ++ I  +S       V  D+                   +S V L+ +N 
Sbjct: 24  VGSSTDISPYLSLIREDSILNGNRAVIFDVYWDVGFPETETKTKTSGWSLSSVKLSTRN- 82

Query: 67  KIFIFDVYSCPLIMFDGKLHEVLESDRILKVIHGAFGDAGGLLSNFNIRLKNVYDTQCAF 126
                 +   P       L+    S  +  V      D   L  N  + ++N  +     
Sbjct: 83  LCLFLRLPK-PFHDNLKDLYRFFASKFVTFVGVQIEEDLDLLRENHGLVIRNAINVGKLA 141

Query: 127 TALQLSDPRLLSQDLVPHTIGLNDLLKFYKISPNNFKKNIQNLYRENPHIWKTRPLTSDM 186
              +          LV   +G  +L      S    + +           W+ +    + 
Sbjct: 142 AEAR--------GTLVLEFLGTRELAHRVLWSDLG-QLDSI---EAK---WE-KAGPEEQ 185

Query: 187 LLYAAADVESLLALFHRMTKE 207
           L  AA +   ++ ++ +++ E
Sbjct: 186 LEAAAIEGWLIVNVWDQLSDE 206
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 292 Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query843
d2hbka2292 Exosome complex exonuclease RRP6 {Baker's yeast (S 100.0
d1yt3a3193 Ribonuclease D, catalytic domain {Escherichia coli 100.0
d1kfsa1195 Exonuclease domain of prokaryotic DNA polymerase { 99.89
d1vk0a_206 Hypothetical protein AT5G06450 {Thale-cress (Arabi 99.89
d2hhva1171 Exonuclease domain of prokaryotic DNA polymerase { 99.79
d2hbka196 Exosome complex exonuclease RRP6 domain {Baker's y 97.47
d1yt3a1101 Ribonuclease D {Escherichia coli [TaxId: 562]} 97.38
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 97.36
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 97.01
d2cpra1113 Exosome component 10, EXOSC10 {Human (Homo sapiens 96.88
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 94.76
d2guia1174 N-terminal exonuclease domain of the epsilon subun 94.5
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 93.48
d1tgoa1347 Exonuclease domain of family B DNA polymerases {Ar 92.5
d2f96a1202 Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287 89.17
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Exosome complex exonuclease RRP6
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=9.8e-35  Score=306.53  Aligned_cols=182  Identities=24%  Similarity=0.302  Sum_probs=170.2

Q ss_pred             CcEEecCHHHHHHHHHHHhcCCeEEEEeeeeCC-CcCceEEEEEEEEeCCeEEEEeCCCCCcccchHHHHHhhcCCCceE
Q psy5651          18 RTNLITDVQEAQSAMATILNESKVGLDLEGMDL-GVDGKVSLVSLALQNGKIFIFDVYSCPLIMFDGKLHEVLESDRILK   96 (843)
Q Consensus        18 ~~~lIdT~eeLaelLe~Lk~s~~IALDtE~~~~-ty~gkL~LIQIAT~dgqvyLID~laL~~~~dLs~LkeLLEDpsIlK   96 (843)
                      .+.||+|.++|.++++.|..++.+|+|+|+++. +|.|.+||+|||+.+ ++|+||+..++.  .+..|+++|+|++|+|
T Consensus        84 ~~~~Vdt~e~L~~li~~L~~~~~iavDtE~~~~~s~~g~l~LiQiat~~-~~~iiD~~~l~~--~l~~L~~ll~d~~I~K  160 (292)
T d2hbka2          84 VPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRE-RDYLVDTLKLRE--NLHILNEVFTNPSIVK  160 (292)
T ss_dssp             CCEEECSHHHHHHHHHHHTTCSEEEEEEEEECSSSSSCEEEEEEEECSS-CEEEEETTTTTT--TGGGGHHHHTCTTSEE
T ss_pred             CcEEeCCHHHHHHHHHHHhcCCcEEEEEEeCcCcccCCeEEEEEEEeCC-ccEEEEeccccc--chHHHHHHHhccCeEE
Confidence            689999999999999999999999999999999 999999999999876 799999998864  3578999999999999


Q ss_pred             EEecccccHHHHhhhcCCccCceechHHHHHHcCCCCCCcccCCCCCCCCCHHHHHHHh-CCCCccccccccccccCCCc
Q psy5651          97 VIHGAFGDAGGLLSNFNIRLKNVYDTQCAFTALQLSDPRLLSQDLVPHTIGLNDLLKFY-KISPNNFKKNIQNLYRENPH  175 (843)
Q Consensus        97 VgHdaK~DL~~L~r~~GI~L~nVFDTQLAAyLLgp~~sG~~lp~~~~~s~SLa~Lvery-Gv~Ld~~Kd~vK~~~keq~S  175 (843)
                      ||||+++|+.+|++++|+.+.++|||++|+++|+..            .+||++|+++| |+.++  |.       +|.+
T Consensus       161 V~H~~~~Di~~L~~~~g~~~~n~fDT~~aa~~l~~~------------~~sL~~L~~~yl~~~ld--K~-------~q~S  219 (292)
T d2hbka2         161 VFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLP------------RHSLAYLLENFANFKTS--KK-------YQLA  219 (292)
T ss_dssp             EESSCHHHHHHHHHHHCCCCSSEEEHHHHHHHHTCS------------CCSHHHHHHHHHCCCCC--CT-------TTTS
T ss_pred             EeechHhhhhhhhhcccccccchHHHHHHHHHhCcc------------ccchHHHHHHhhhhccc--cc-------cccc
Confidence            999999999999999999999999999999999764            38999999999 99987  43       7899


Q ss_pred             cCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcHHHHHHHHHH
Q psy5651         176 IWKTRPLTSDMLLYAAADVESLLALFHRMTKEYALKQNRLLLDNLIYE  223 (843)
Q Consensus       176 DW~~RPLSeeQL~YAA~DA~~LL~Lyd~L~~rLee~G~~~LfeEEc~e  223 (843)
                      ||..|||+++|+.|||.||++|+.||+.|+++|.+.|...|+.++|..
T Consensus       220 dW~~RPLs~~qi~YAa~Da~~Ll~ly~~L~~~L~~~~~l~~v~~e~~~  267 (292)
T d2hbka2         220 DWRIRPLSKPMTAAARADTHFLLNIYDQLRNKLIESNKLAGVLYESRN  267 (292)
T ss_dssp             CTTCSSCCHHHHHHHHHHHHTHHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             ccccCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999874
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]} Back     information, alignment and structure
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure