Psyllid ID: psy5701

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVFD
cccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHccccccccccc
cHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHcccccHccEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHHccccccccccc
MMYYNLGiaaethghvgaDLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRyamgksspsalRETIvevpnitwediggleGVKRELQElvqpslwspskvlmNEHAMTHQVFD
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAmgksspsaLRETIVEVPNITWEDIGGLEGVKRELQELVQPslwspskvlmNEHAMTHQVFD
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVFD
**YYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKS**SALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLW******************
*MYYNLGIAAETHGHVGADLASLCSEAALQQIREKM*************ILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVF*
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVFD
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEH**T*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q7KN62 801 Transitional endoplasmic yes N/A 0.848 0.132 0.849 2e-46
P54811 809 Transitional endoplasmic yes N/A 0.848 0.131 0.792 8e-43
P54812 810 Transitional endoplasmic no N/A 0.848 0.130 0.773 2e-42
Q7ZU99 806 Transitional endoplasmic yes N/A 0.848 0.131 0.745 4e-41
Q9P3A7 815 Cell division cycle prote yes N/A 0.808 0.123 0.745 1e-40
Q6GL04 805 Transitional endoplasmic yes N/A 0.848 0.131 0.735 2e-40
Q01853 806 Transitional endoplasmic yes N/A 0.848 0.131 0.735 2e-40
P55072 806 Transitional endoplasmic yes N/A 0.848 0.131 0.735 2e-40
P46462 806 Transitional endoplasmic yes N/A 0.848 0.131 0.735 2e-40
Q3ZBT1 806 Transitional endoplasmic yes N/A 0.848 0.131 0.735 2e-40
>sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 Back     alignment and function desciption
 Score =  184 bits (466), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/106 (84%), Positives = 96/106 (90%)

Query: 8   IAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK 67
           IAAE+HGHVGADLASLCSEAALQQIREKMDLIDLEDD+IDAE+LASLAVTMENFRYAM K
Sbjct: 396 IAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTK 455

Query: 68  SSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVL 113
           SSPSALRET+VEVPN TW DIGGLE VK+ELQELVQ  +  P K L
Sbjct: 456 SSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFL 501
Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process (By similarity). Involved in the ubiquitin-proteasome system. Important for oskar mRNA localization and/or anchoring during oogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 Back     alignment and function description
>sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 Back     alignment and function description
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description
>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 Back     alignment and function description
>sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
321461136 802 hypothetical protein DAPPUDRAFT_308570 [ 0.848 0.132 0.849 9e-47
193617621 804 PREDICTED: transitional endoplasmic reti 0.848 0.131 0.886 2e-46
242008814 804 conserved hypothetical protein [Pediculu 0.848 0.131 0.849 5e-46
112983322 805 transitional endoplasmic reticulum ATPas 0.848 0.131 0.849 1e-45
194757830 801 GF11135 [Drosophila ananassae] gi|190622 0.848 0.132 0.858 2e-45
198457521 801 GA15351 [Drosophila pseudoobscura pseudo 0.848 0.132 0.858 2e-45
195379959 801 GJ21209 [Drosophila virilis] gi|19414353 0.848 0.132 0.858 2e-45
195430960 801 GK21952 [Drosophila willistoni] gi|19415 0.848 0.132 0.858 2e-45
195028018 802 GH20288 [Drosophila grimshawi] gi|193902 0.848 0.132 0.858 2e-45
195120371 801 GI19458 [Drosophila mojavensis] gi|19390 0.848 0.132 0.858 3e-45
>gi|321461136|gb|EFX72171.1| hypothetical protein DAPPUDRAFT_308570 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 90/106 (84%), Positives = 100/106 (94%)

Query: 8   IAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK 67
           +AAETHGHVGAD+A+LCSEAALQQIREKMDLIDLE+DQIDAE+LASLAVTMENFR+AMGK
Sbjct: 397 VAAETHGHVGADIAALCSEAALQQIREKMDLIDLEEDQIDAEVLASLAVTMENFRFAMGK 456

Query: 68  SSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVL 113
           S+PSALRETIVEVPN++WEDIGGLEGVKRELQELVQ  +  P K L
Sbjct: 457 STPSALRETIVEVPNVSWEDIGGLEGVKRELQELVQYPVEHPEKFL 502

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193617621|ref|XP_001949588.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242008814|ref|XP_002425193.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508909|gb|EEB12455.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|112983322|ref|NP_001037003.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|83423461|dbj|BAE54254.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] gi|95102992|gb|ABF51437.1| transitional endoplasmic reticulum ATPase TER94 [Bombyx mori] Back     alignment and taxonomy information
>gi|194757830|ref|XP_001961165.1| GF11135 [Drosophila ananassae] gi|190622463|gb|EDV37987.1| GF11135 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|198457521|ref|XP_001360696.2| GA15351 [Drosophila pseudoobscura pseudoobscura] gi|198136008|gb|EAL25271.2| GA15351 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195379959|ref|XP_002048738.1| GJ21209 [Drosophila virilis] gi|194143535|gb|EDW59931.1| GJ21209 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195430960|ref|XP_002063516.1| GK21952 [Drosophila willistoni] gi|194159601|gb|EDW74502.1| GK21952 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195028018|ref|XP_001986879.1| GH20288 [Drosophila grimshawi] gi|193902879|gb|EDW01746.1| GH20288 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195120371|ref|XP_002004702.1| GI19458 [Drosophila mojavensis] gi|193909770|gb|EDW08637.1| GI19458 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0261014 801 TER94 "TER94" [Drosophila mela 0.848 0.132 0.849 2.4e-41
WB|WBGene00007352 809 cdc-48.1 [Caenorhabditis elega 0.848 0.131 0.792 7.4e-38
UNIPROTKB|P54811 809 cdc-48.1 "Transitional endopla 0.848 0.131 0.792 7.4e-38
WB|WBGene00008053 810 cdc-48.2 [Caenorhabditis elega 0.848 0.130 0.773 2e-37
UNIPROTKB|P54812 810 cdc-48.2 "Transitional endopla 0.848 0.130 0.773 2e-37
UNIPROTKB|H9KYT1 538 LOC430766 "Uncharacterized pro 0.848 0.197 0.726 6.3e-37
ZFIN|ZDB-GENE-030131-5408 806 vcp "valosin containing protei 0.848 0.131 0.745 6.9e-37
UNIPROTKB|E1BTS8 804 LOC426240 "Uncharacterized pro 0.848 0.131 0.735 1.8e-36
UNIPROTKB|P23787 805 vcp "Transitional endoplasmic 0.848 0.131 0.735 1.9e-36
UNIPROTKB|Q6GL04 805 vcp "Transitional endoplasmic 0.848 0.131 0.735 1.9e-36
FB|FBgn0261014 TER94 "TER94" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 446 (162.1 bits), Expect = 2.4e-41, P = 2.4e-41
 Identities = 90/106 (84%), Positives = 96/106 (90%)

Query:     8 IAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK 67
             IAAE+HGHVGADLASLCSEAALQQIREKMDLIDLEDD+IDAE+LASLAVTMENFRYAM K
Sbjct:   396 IAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTK 455

Query:    68 SSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVL 113
             SSPSALRET+VEVPN TW DIGGLE VK+ELQELVQ  +  P K L
Sbjct:   456 SSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFL 501
GO:0045169 "fusome" evidence=IDA;NAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0016887 "ATPase activity" evidence=NAS
GO:0005783 "endoplasmic reticulum" evidence=NAS
GO:0007030 "Golgi organization" evidence=IMP
GO:0007317 "regulation of pole plasm oskar mRNA localization" evidence=IMP
GO:0016320 "endoplasmic reticulum membrane fusion" evidence=ISS
GO:0000226 "microtubule cytoskeleton organization" evidence=IMP
GO:0007029 "endoplasmic reticulum organization" evidence=IMP
GO:0045451 "pole plasm oskar mRNA localization" evidence=IMP
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0008104 "protein localization" evidence=IMP
GO:0042052 "rhabdomere development" evidence=IMP
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IMP
GO:0000502 "proteasome complex" evidence=NAS
GO:0006508 "proteolysis" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0030433 "ER-associated protein catabolic process" evidence=IMP
GO:0006200 "ATP catabolic process" evidence=IGI
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0043523 "regulation of neuron apoptotic process" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IMP
WB|WBGene00007352 cdc-48.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P54811 cdc-48.1 "Transitional endoplasmic reticulum ATPase homolog 1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00008053 cdc-48.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P54812 cdc-48.2 "Transitional endoplasmic reticulum ATPase homolog 2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H9KYT1 LOC430766 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTS8 LOC426240 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58556Y1156_METJANo assigned EC number0.55200.7440.1029yesN/A
P54609CD48A_ARATHNo assigned EC number0.71150.8320.1285yesN/A
P46462TERA_RATNo assigned EC number0.73580.8480.1315yesN/A
Q3ZBT1TERA_BOVINNo assigned EC number0.73580.8480.1315yesN/A
Q9P3A7CDC48_SCHPONo assigned EC number0.74500.8080.1239yesN/A
P55072TERA_HUMANNo assigned EC number0.73580.8480.1315yesN/A
Q01853TERA_MOUSENo assigned EC number0.73580.8480.1315yesN/A
Q5AWS6CDC48_EMENINo assigned EC number0.75230.8320.1263yesN/A
Q8SSJ5CDC48_ENCCUNo assigned EC number0.58330.8640.1384yesN/A
Q7KN62TERA_DROMENo assigned EC number0.84900.8480.1323yesN/A
Q9LZF6CD48E_ARATHNo assigned EC number0.71150.8320.1283yesN/A
P54811TERA1_CAEELNo assigned EC number0.79240.8480.1310yesN/A
Q7ZU99TERA_DANRENo assigned EC number0.74520.8480.1315yesN/A
Q6GL04TERA_XENTRNo assigned EC number0.73580.8480.1316yesN/A
P25694CDC48_YEASTNo assigned EC number0.66340.8320.1245yesN/A
P03974TERA_PIGNo assigned EC number0.72640.8480.1315yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-28
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-15
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-07
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-04
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 2e-04
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 7e-04
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.002
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 0.002
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 0.003
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  106 bits (267), Expect = 4e-28
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 8   IAAETHGHVGADLASLCSEAALQQIREKMDL--IDLEDDQIDAEILASLAVTMENFRYAM 65
           +A  THG VGADLA+L  EAA+  +R  +    I+ E ++I AE+L  L VTM++F  A+
Sbjct: 373 LAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPAEVLKELKVTMKDFMEAL 432

Query: 66  GKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSP 109
               PSA+RE +VEVPN+ W DIGGLE VK+EL+E V+  L  P
Sbjct: 433 KMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKHP 476

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG0733|consensus 802 99.97
KOG0730|consensus 693 99.97
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.87
KOG0735|consensus 952 99.85
KOG0736|consensus 953 99.82
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.74
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.63
KOG0738|consensus491 99.45
KOG0729|consensus 435 99.34
KOG0730|consensus693 99.26
KOG0727|consensus 408 99.24
KOG0726|consensus 440 99.23
KOG0728|consensus 404 99.23
KOG0652|consensus 424 99.17
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.17
KOG0733|consensus802 99.14
KOG0732|consensus 1080 99.11
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.05
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.02
PRK03992 389 proteasome-activating nucleotidase; Provisional 98.99
KOG0737|consensus386 98.96
KOG0739|consensus439 98.95
KOG0736|consensus953 98.95
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 98.95
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 98.87
KOG0739|consensus 439 98.86
KOG0738|consensus 491 98.84
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 98.76
PRK03992389 proteasome-activating nucleotidase; Provisional 98.72
KOG0737|consensus 386 98.71
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.67
CHL00195489 ycf46 Ycf46; Provisional 98.66
KOG0734|consensus 752 98.64
KOG0651|consensus 388 98.63
KOG0731|consensus 774 98.62
KOG0740|consensus428 98.56
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.55
KOG0741|consensus 744 98.55
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.48
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.47
CHL00206 2281 ycf2 Ycf2; Provisional 98.44
CHL00195 489 ycf46 Ycf46; Provisional 98.44
KOG0732|consensus 1080 98.39
KOG0740|consensus 428 98.3
KOG0731|consensus 774 98.29
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.29
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.25
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.17
KOG0728|consensus404 98.14
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 98.03
CHL00176 638 ftsH cell division protein; Validated 98.02
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 98.0
KOG0726|consensus440 97.98
KOG0734|consensus 752 97.9
PF0933662 Vps4_C: Vps4 C terminal oligomerisation domain; In 97.86
KOG0735|consensus952 97.81
KOG0652|consensus424 97.78
KOG0727|consensus408 97.61
CHL00176 638 ftsH cell division protein; Validated 97.59
KOG0729|consensus435 97.48
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 97.22
CHL00181 287 cbbX CbbX; Provisional 95.55
KOG0651|consensus388 95.21
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.19
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 95.1
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.0
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 93.26
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 89.22
KOG0742|consensus630 87.72
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 84.02
>KOG0733|consensus Back     alignment and domain information 
Probab=99.97  E-value=2.3e-32  Score=210.69  Aligned_cols=122  Identities=34%  Similarity=0.536  Sum_probs=107.7

Q ss_pred             hhHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHhhhcCc---------c---------c---------------------
Q psy5701           3 YYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDL---------E---------D---------------------   43 (125)
Q Consensus         3 ~~l~~lA~~T~GfsgaDL~~L~~~A~~~al~~~~~~~~~---------~---------~---------------------   43 (125)
                      |++..||+.|+||+||||.+||++|++.|++|.++....         +         .                     
T Consensus       383 ~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~  462 (802)
T KOG0733|consen  383 FDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQD  462 (802)
T ss_pred             cCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHH
Confidence            678999999999999999999999999999998763210         0         0                     


Q ss_pred             ------hhchHHhhhcccccHHHHHHHhcccCCCchhhhhcccCCcccccccchHHHHHHHHHHhhhhccChHHHhhCCC
Q psy5701          44 ------DQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEH  117 (125)
Q Consensus        44 ------~~~~~~~~~~~~i~~~Df~~Al~~~~ps~~~~~~~~~~~v~w~digGl~~~k~~l~~~i~~P~~~p~~f~~~gi  117 (125)
                            +..+.+......|+.+||+.|+..++||+.++.+.++|+|+|+|||||++++.+|..+|.||+|||++|+++|+
T Consensus       463 ~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi  542 (802)
T KOG0733|consen  463 AILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAPIKRPDLFKALGI  542 (802)
T ss_pred             HHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhhccCHHHHHHhCC
Confidence                  01112445567899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCC
Q psy5701         118 AMTHQVF  124 (125)
Q Consensus       118 ~~p~Gvl  124 (125)
                      .+|.|||
T Consensus       543 ~~PsGvL  549 (802)
T KOG0733|consen  543 DAPSGVL  549 (802)
T ss_pred             CCCCceE
Confidence            9999998

>KOG0730|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0728|consensus Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726|consensus Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0729|consensus Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-41
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-41
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 5e-34
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 5e-34
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 5e-34
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 5e-21
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 6e-12
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (414), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 93/106 (87%)
Query: 8   IAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK 67
           +A ETHGHVGADLA+LCSEAALQ IR+KMDLIDLED+ IDAE++ SLAVTM++FR+A+ +
Sbjct: 399 VANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ 458
Query: 68  SSPSALRETIVEVPNITWEDIGGLEGVKRELQELVQPSLWSPSKVL 113
           S+PSALRET+VEVP +TWEDIGGLE VKRELQELVQ  +  P K L
Sbjct: 459 SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFL 504
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-44
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-07
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-40
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-16
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 5e-08
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-14
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-14
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 3e-12
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 3e-08
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 8e-12
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 2e-10
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 2e-11
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 4e-08
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 2e-11
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 7e-08
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 5e-11
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 2e-09
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-09
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-08
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-09
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 5e-08
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-08
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-08
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 3e-08
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-05
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 2e-06
3kw6_A78 26S protease regulatory subunit 8; structural geno 2e-06
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-06
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 2e-05
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 2e-05
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-05
2r62_A268 Cell division protease FTSH homolog; ATPase domain 4e-05
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-04
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-04
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-04
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 3e-04
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 3e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
 Score =  150 bits (380), Expect = 1e-44
 Identities = 63/88 (71%), Positives = 77/88 (87%)

Query: 8   IAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK 67
           +A ETHGHVGADLA+LCSEAALQ IR+KMDLIDLED+ IDAE++ SLAVTM++FR+A+ +
Sbjct: 399 VANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ 458

Query: 68  SSPSALRETIVEVPNITWEDIGGLEGVK 95
           S+PSALRET+VEVP +TWEDIGG     
Sbjct: 459 SNPSALRETVVEVPQVTWEDIGGRSHHH 486
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 99.94
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.65
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.64
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.63
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 99.62
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 99.58
2krk_A86 26S protease regulatory subunit 8; structural geno 99.56
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.53
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.5
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 99.49
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.49
3kw6_A78 26S protease regulatory subunit 8; structural geno 99.48
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.47
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.45
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.27
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 99.24
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 99.21
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 99.18
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 99.17
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 99.16
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.13
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 99.12
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 99.11
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.1
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 99.03
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.03
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.98
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.93
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.89
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.81
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.72
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.69
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.69
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.67
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 98.58
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 98.5
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 98.41
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.2
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.12
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.08
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.08
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.08
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 98.03
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.01
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.01
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 98.0
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.98
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.91
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.88
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.87
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 97.84
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.82
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.79
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 97.77
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.58
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.52
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.4
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.03
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.4
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 89.56
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 88.45
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 83.66
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 80.73
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=99.94  E-value=2.1e-27  Score=190.85  Aligned_cols=121  Identities=65%  Similarity=0.943  Sum_probs=110.7

Q ss_pred             hHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHhhhcCccchhchHHhhhcccccHHHHHHHhcccCCCchhhhhcccCCc
Q psy5701           4 YNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGKSSPSALRETIVEVPNI   83 (125)
Q Consensus         4 ~l~~lA~~T~GfsgaDL~~L~~~A~~~al~~~~~~~~~~~~~~~~~~~~~~~i~~~Df~~Al~~~~ps~~~~~~~~~~~v   83 (125)
                      ++..||.+|+||+|+||.+||++|++.|+++.....+........+......++.+||..|++.++|+..++.....|++
T Consensus       395 dl~~lA~~T~GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~v  474 (806)
T 3cf2_A          395 DLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQV  474 (806)
T ss_dssp             CHHHHHHHCCSCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCCC
T ss_pred             CHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCCCcccccccccCCCC
Confidence            58899999999999999999999999999998776555444455555566789999999999999999999999999999


Q ss_pred             ccccccchHHHHHHHHHHhhhhccChHHHhhCCCCCCCCCC
Q psy5701          84 TWEDIGGLEGVKRELQELVQPSLWSPSKVLMNEHAMTHQVF  124 (125)
Q Consensus        84 ~w~digGl~~~k~~l~~~i~~P~~~p~~f~~~gi~~p~Gvl  124 (125)
                      +|+||||++++|++|+++|.||++||++|+++|+++|+|||
T Consensus       475 ~w~diggl~~~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvL  515 (806)
T 3cf2_A          475 TWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVL  515 (806)
T ss_dssp             CSTTCCSCHHHHHHHTTTTTTTTTCSGGGSSSCCCCCSCCE
T ss_pred             CHHHhCCHHHHHHHHHHHHHhhhhCHHHHHhcCCCCCceEE
Confidence            99999999999999999999999999999999999999997
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 7e-16
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-05
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 7e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-07
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 7e-08
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 3e-06
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-06
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 3e-06
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-05
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 69.3 bits (168), Expect = 7e-16
 Identities = 44/67 (65%), Positives = 55/67 (82%)

Query: 1   MMYYNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMEN 60
                  +A ETHGHVGADLA+LCSEAALQ IR+KMDLIDLED+ IDAE++ SLAVTM++
Sbjct: 192 DDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDD 251

Query: 61  FRYAMGK 67
           FR+A+ +
Sbjct: 252 FRWALSQ 258
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.25
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.22
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 98.97
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.96
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 98.91
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.68
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.6
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.32
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 88.03
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 87.57
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.6
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 84.85
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 82.04
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.25  E-value=6.5e-12  Score=87.64  Aligned_cols=64  Identities=69%  Similarity=1.011  Sum_probs=52.9

Q ss_pred             hHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHhhhcCccchhchHHhhhcccccHHHHHHHhcc
Q psy5701           4 YNLGIAAETHGHVGADLASLCSEAALQQIREKMDLIDLEDDQIDAEILASLAVTMENFRYAMGK   67 (125)
Q Consensus         4 ~l~~lA~~T~GfsgaDL~~L~~~A~~~al~~~~~~~~~~~~~~~~~~~~~~~i~~~Df~~Al~~   67 (125)
                      ++..||++|+||||+||.+||++|++.|+++.....+.+...+..+......|+++||+.||++
T Consensus       195 ~~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~~~~~~~~~~~~~~~~~it~~Df~~AL~~  258 (258)
T d1e32a2         195 DLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ  258 (258)
T ss_dssp             CHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCSSCCBHHHHHHCCBCHHHHHHHHTC
T ss_pred             chhhhhhcccCCCHHHHHHHHHHHHHHHHHhhccccchhhhhhhhhhhccCccCHHHHHHHhCc
Confidence            5789999999999999999999999999998766555444445555566678999999999974
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure