Psyllid ID: psy5721
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| 307186188 | 969 | Kinesin heavy chain [Camponotus floridan | 0.848 | 0.253 | 0.805 | 1e-108 | |
| 345485732 | 990 | PREDICTED: kinesin heavy chain [Nasonia | 0.837 | 0.245 | 0.796 | 1e-107 | |
| 332017463 | 969 | Kinesin heavy chain [Acromyrmex echinati | 0.848 | 0.253 | 0.805 | 1e-107 | |
| 322799916 | 972 | hypothetical protein SINV_14443 [Solenop | 0.831 | 0.247 | 0.784 | 1e-106 | |
| 242023696 | 952 | Kinesin heavy chain, putative [Pediculus | 0.841 | 0.256 | 0.788 | 1e-105 | |
| 380029607 | 989 | PREDICTED: kinesin heavy chain-like [Api | 0.820 | 0.240 | 0.783 | 1e-102 | |
| 66520179 | 988 | PREDICTED: kinesin heavy chain isoform 1 | 0.820 | 0.240 | 0.783 | 1e-102 | |
| 383853868 | 970 | PREDICTED: kinesin heavy chain-like [Meg | 0.831 | 0.248 | 0.769 | 1e-102 | |
| 340721138 | 971 | PREDICTED: kinesin heavy chain-like [Bom | 0.837 | 0.250 | 0.786 | 1e-101 | |
| 328712810 | 979 | PREDICTED: kinesin heavy chain-like [Acy | 0.820 | 0.243 | 0.760 | 1e-101 |
| >gi|307186188|gb|EFN71894.1| Kinesin heavy chain [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 396 bits (1017), Expect = e-108, Method: Compositional matrix adjust.
Identities = 199/247 (80%), Positives = 216/247 (87%), Gaps = 1/247 (0%)
Query: 5 ACGALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKST 64
+ AL NVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKST
Sbjct: 268 SLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKST 327
Query: 65 LDFGRRAKTIKNVVTVNEELTAEEWKRRYEKEKEKSSRYKGKLEKLELELSRWRNGETVK 124
LDFG+RAKTIKNVV VNEELTAEEWKRRYE+EKEK++RYKGK++KLE ELSRWR GETVK
Sbjct: 328 LDFGKRAKTIKNVVCVNEELTAEEWKRRYEREKEKAARYKGKVDKLEAELSRWRQGETVK 387
Query: 125 EDEQVNLADPVDMAASI-APTPESAPASILPAIPGSGLMLGSLSNEERQKLEEERERLYQ 183
+EQV+L + D+ I P S +PA PG GLM+GSLSNEERQKLEEERERLYQ
Sbjct: 388 PEEQVSLVEGPDVTTPINVPVEGKLDDSPMPATPGGGLMIGSLSNEERQKLEEERERLYQ 447
Query: 184 QLDEKDEEINQQSQYAEKLKEQIMEQEELITTARRDYEQLQGEMTRLTQENESAKEEVKE 243
QLD+KDEEINQQSQY EKLKEQ+ EQEELI +ARRDYEQLQ EM R+ QENESAKEEVKE
Sbjct: 448 QLDDKDEEINQQSQYVEKLKEQMEEQEELIASARRDYEQLQQEMNRIQQENESAKEEVKE 507
Query: 244 VLQALEE 250
VLQALEE
Sbjct: 508 VLQALEE 514
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345485732|ref|XP_001606707.2| PREDICTED: kinesin heavy chain [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332017463|gb|EGI58186.1| Kinesin heavy chain [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322799916|gb|EFZ21057.1| hypothetical protein SINV_14443 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|242023696|ref|XP_002432267.1| Kinesin heavy chain, putative [Pediculus humanus corporis] gi|212517676|gb|EEB19529.1| Kinesin heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|380029607|ref|XP_003698460.1| PREDICTED: kinesin heavy chain-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66520179|ref|XP_395236.2| PREDICTED: kinesin heavy chain isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383853868|ref|XP_003702444.1| PREDICTED: kinesin heavy chain-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340721138|ref|XP_003398982.1| PREDICTED: kinesin heavy chain-like [Bombus terrestris] gi|350399421|ref|XP_003485517.1| PREDICTED: kinesin heavy chain-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328712810|ref|XP_001944740.2| PREDICTED: kinesin heavy chain-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| FB|FBgn0001308 | 975 | Khc "Kinesin heavy chain" [Dro | 0.837 | 0.249 | 0.582 | 2.6e-64 | |
| UNIPROTKB|F1NE00 | 933 | KIF5C "Uncharacterized protein | 0.803 | 0.249 | 0.514 | 6.6e-55 | |
| UNIPROTKB|F1N945 | 995 | KIF5C "Uncharacterized protein | 0.803 | 0.234 | 0.514 | 9.2e-55 | |
| UNIPROTKB|E9PET8 | 862 | KIF5C "Kinesin heavy chain iso | 0.803 | 0.270 | 0.506 | 1.3e-54 | |
| UNIPROTKB|E2RDZ9 | 957 | KIF5C "Uncharacterized protein | 0.803 | 0.243 | 0.518 | 1.6e-54 | |
| UNIPROTKB|O60282 | 957 | KIF5C "Kinesin heavy chain iso | 0.803 | 0.243 | 0.506 | 2.7e-54 | |
| UNIPROTKB|F6RAG5 | 956 | KIF5C "Uncharacterized protein | 0.803 | 0.243 | 0.506 | 9.3e-54 | |
| UNIPROTKB|I3LUB8 | 946 | KIF5C "Uncharacterized protein | 0.803 | 0.246 | 0.510 | 1.1e-53 | |
| ZFIN|ZDB-GENE-070629-2 | 968 | kif5ba "kinesin family member | 0.834 | 0.25 | 0.495 | 9e-52 | |
| MGI|MGI:1098268 | 963 | Kif5b "kinesin family member 5 | 0.820 | 0.247 | 0.510 | 8.3e-51 |
| FB|FBgn0001308 Khc "Kinesin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 659 (237.0 bits), Expect = 2.6e-64, P = 2.6e-64
Identities = 144/247 (58%), Positives = 162/247 (65%)
Query: 8 ALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDF 67
AL NVISALADGNKTHIPYRDSKLTRILQESLGGNARTTI+ICCSPASFNESETKSTLDF
Sbjct: 267 ALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETKSTLDF 326
Query: 68 GRRAKTIKNVVTVNEELTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRWRNGETVKEDE 127
GRRAKT+KNVV VNEELTA +RWR GETVK +E
Sbjct: 327 GRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNARLKGKVEKLEIELARWRAGETVKAEE 386
Query: 128 QVNLADPVDMAASIAPTPESAPASILPAIPGSGLMLGSLSNXXXXXXXXXXXXX----XX 183
Q+N+ D ++ + + A+ A+ L ++S
Sbjct: 387 QINMEDLMEASTPNLEVEAAQTAAAEAALAAQRTALANMSASVAVNEQARLATECERLYQ 446
Query: 184 XXXXKDEEINQQSQYAEKLKEQIMEQEELITTARRDYEQLQGEMTRLTQENESAKEEVKE 243
KDEEINQQSQYAE+LKEQ+MEQEELI ARR+YE LQ EM R+ QENESAKEEVKE
Sbjct: 447 QLDDKDEEINQQSQYAEQLKEQVMEQEELIANARREYETLQSEMARIQQENESAKEEVKE 506
Query: 244 VLQALEE 250
VLQALEE
Sbjct: 507 VLQALEE 513
|
|
| UNIPROTKB|F1NE00 KIF5C "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N945 KIF5C "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PET8 KIF5C "Kinesin heavy chain isoform 5C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDZ9 KIF5C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60282 KIF5C "Kinesin heavy chain isoform 5C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RAG5 KIF5C "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUB8 KIF5C "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070629-2 kif5ba "kinesin family member 5B, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098268 Kif5b "kinesin family member 5B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 3e-43 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 4e-33 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 7e-33 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-29 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-28 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 5e-27 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 1e-23 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 2e-23 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 2e-22 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 4e-22 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 1e-21 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 7e-19 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 9e-18 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 1e-16 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-14 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 7e-14 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 1e-13 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 1e-12 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 2e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| pfam03961 | 450 | pfam03961, DUF342, Protein of unknown function (DU | 0.003 | |
| pfam06785 | 401 | pfam06785, UPF0242, Uncharacterized protein family | 0.003 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 0.003 | |
| PRK04778 | 569 | PRK04778, PRK04778, septation ring formation regul | 0.004 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.004 |
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
Score = 150 bits (380), Expect = 3e-43
Identities = 54/67 (80%), Positives = 60/67 (89%)
Query: 8 ALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDF 67
AL NVI+AL DG THIPYRDSKLTRILQ+SLGGN+RTT+IICCSP+S+NESET STL F
Sbjct: 259 ALGNVINALTDGKSTHIPYRDSKLTRILQDSLGGNSRTTLIICCSPSSYNESETLSTLRF 318
Query: 68 GRRAKTI 74
G RAKTI
Sbjct: 319 GARAKTI 325
|
Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 325 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) | Back alignment and domain information |
|---|
| >gnl|CDD|219176 pfam06785, UPF0242, Uncharacterized protein family (UPF0242) | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179877 PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| KOG0240|consensus | 607 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| KOG4280|consensus | 574 | 99.95 | ||
| KOG0245|consensus | 1221 | 99.95 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 99.92 | |
| KOG0242|consensus | 675 | 99.91 | ||
| KOG0241|consensus | 1714 | 99.91 | ||
| KOG0244|consensus | 913 | 99.9 | ||
| KOG0247|consensus | 809 | 99.89 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 99.87 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 99.87 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 99.86 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 99.85 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 99.85 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 99.84 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 99.84 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 99.84 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 99.84 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 99.82 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 99.82 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 99.82 | |
| KOG0246|consensus | 676 | 99.81 | ||
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 99.81 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 99.8 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 99.8 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.79 | |
| KOG0239|consensus | 670 | 99.76 | ||
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 99.74 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.53 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.43 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.84 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 95.8 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 95.79 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.75 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.46 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.33 | |
| KOG0971|consensus | 1243 | 95.27 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 95.15 | |
| KOG0971|consensus | 1243 | 95.15 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.13 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.09 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.08 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 95.03 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 95.01 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 94.99 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 94.94 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.85 | |
| KOG1853|consensus | 333 | 94.83 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.77 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.76 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 94.76 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.66 | |
| KOG0977|consensus | 546 | 94.62 | ||
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 94.55 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.51 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.43 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 94.38 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.27 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 94.2 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 94.19 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.01 | |
| KOG0250|consensus | 1074 | 93.91 | ||
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.89 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.86 | |
| KOG0999|consensus | 772 | 93.78 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.75 | |
| KOG0977|consensus | 546 | 93.68 | ||
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 93.49 | |
| PRK09039 | 343 | hypothetical protein; Validated | 93.47 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.31 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 92.99 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 92.94 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.93 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.89 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 92.73 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.71 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 92.49 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 92.47 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.38 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 92.34 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 92.26 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 91.6 | |
| KOG1962|consensus | 216 | 91.57 | ||
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.54 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 91.43 | |
| KOG0995|consensus | 581 | 91.3 | ||
| KOG0250|consensus | 1074 | 91.26 | ||
| KOG0804|consensus | 493 | 91.23 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.23 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 91.16 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 91.08 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 91.03 | |
| KOG4673|consensus | 961 | 90.84 | ||
| KOG0161|consensus | 1930 | 90.82 | ||
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 90.67 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 90.49 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 90.49 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 90.31 | |
| KOG0161|consensus | 1930 | 90.3 | ||
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.28 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 90.23 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 90.18 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 90.17 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 90.16 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 90.1 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 90.08 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 89.9 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 89.82 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 89.78 | |
| KOG0996|consensus | 1293 | 89.74 | ||
| KOG0976|consensus | 1265 | 89.58 | ||
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 89.48 | |
| KOG0243|consensus | 1041 | 89.37 | ||
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 89.25 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 89.25 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 89.21 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 89.11 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 89.04 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 89.02 | |
| KOG4005|consensus | 292 | 88.92 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 88.91 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 88.89 | |
| KOG4657|consensus | 246 | 88.63 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 88.55 | |
| KOG2010|consensus | 405 | 88.53 | ||
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 88.36 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 88.35 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 88.34 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 88.32 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 87.9 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 87.9 | |
| PF11544 | 76 | Spc42p: Spindle pole body component Spc42p; InterP | 87.73 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 87.71 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 87.62 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 87.55 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 87.48 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 87.47 | |
| KOG0964|consensus | 1200 | 87.33 | ||
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 87.13 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 87.0 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 86.99 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 86.81 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 86.8 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 86.77 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.73 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 86.7 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 86.53 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 86.42 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 86.41 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 86.26 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 86.14 | |
| KOG0976|consensus | 1265 | 86.08 | ||
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 85.99 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 85.98 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 85.94 | |
| KOG4360|consensus | 596 | 85.93 | ||
| KOG0996|consensus | 1293 | 85.89 | ||
| PRK02119 | 73 | hypothetical protein; Provisional | 85.85 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 85.85 | |
| KOG4673|consensus | 961 | 85.85 | ||
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 85.82 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 85.74 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 85.72 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 85.64 | |
| KOG0980|consensus | 980 | 85.38 | ||
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.33 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 85.22 | |
| KOG0933|consensus | 1174 | 85.21 | ||
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 85.02 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 84.91 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 84.79 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 84.64 | |
| KOG0933|consensus | 1174 | 84.54 | ||
| KOG2991|consensus | 330 | 84.36 | ||
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 84.23 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 83.75 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 83.65 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 83.35 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 83.31 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.2 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 83.07 | |
| KOG1962|consensus | 216 | 82.73 | ||
| KOG4360|consensus | 596 | 82.7 | ||
| PRK04325 | 74 | hypothetical protein; Provisional | 82.67 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 82.66 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 82.61 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 82.3 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 82.16 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 82.16 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 82.05 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 81.85 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 81.36 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 81.24 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 81.22 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 81.18 | |
| KOG4005|consensus | 292 | 81.07 | ||
| KOG4809|consensus | 654 | 81.05 | ||
| PRK00846 | 77 | hypothetical protein; Provisional | 81.05 | |
| KOG4674|consensus | 1822 | 80.98 | ||
| KOG4643|consensus | 1195 | 80.98 | ||
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 80.8 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 80.77 | |
| KOG2129|consensus | 552 | 80.75 | ||
| PF14723 | 179 | SSFA2_C: Sperm-specific antigen 2 C-terminus | 80.7 | |
| KOG0979|consensus | 1072 | 80.7 | ||
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 80.59 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 80.58 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 80.42 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 80.4 | |
| KOG1853|consensus | 333 | 80.31 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 80.22 |
| >KOG0240|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.4e-42 Score=328.56 Aligned_cols=247 Identities=57% Similarity=0.802 Sum_probs=219.3
Q ss_pred CcchhHhHHHHHHHHHHcCCCCCCCCCCChhhhhchhhcCCCCcceEEEeeCCCCCChHhhhhhhhhhhhcccccccccc
Q psy5721 1 MNIFACGALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDFGRRAKTIKNVVTV 80 (290)
Q Consensus 1 ~IN~SL~~L~~vi~aL~~~~~~~vPyRdSkLT~lL~~~l~g~~~t~mi~~vsp~~~~~~EtlstL~fa~rak~i~~~~~~ 80 (290)
+||+||+|||+||+||++|+++|||||||||||||+|+|||||+|.+|+||+|+..+..||.+||+|+.||+.|+|.+.+
T Consensus 258 ~INkSLsaLgnvI~aLa~g~~shipYRDSKLTRILqdSLGGNsRTtlIi~csPss~n~~ET~STl~fg~rak~ikN~v~~ 337 (607)
T KOG0240|consen 258 NINKSLSALGNVINALAEGPKSHIPYRDSKLTRILQDSLGGNSRTTLIICCSPSSLNEAETKSTLRFGNRAKTIKNTVWV 337 (607)
T ss_pred hhhhhHHHHHHHHHHHhcCCCCCCcchhhHHHHHHHHHhCCCcceEEEEecCCccccccccccchhhccccccccchhhh
Confidence 59999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhhhcccCCcccccCCCCCCCCCCCCCCCCCCCcc
Q psy5721 81 NEELTAEEWKRRYEKEKEKSSRYKGKLEKLELELSRWRNGETVKEDEQVNLADPVDMAASIAPTPESAPASILPAIPGSG 160 (290)
Q Consensus 81 n~~~~~~~~~~~~~~~~~~~~~l~~~i~~L~~el~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (290)
|...+.+.|++.|+..++.+..+...+..+...|.+|++|+.++.++++.+.......... .. ........
T Consensus 338 n~e~~~e~~~r~~e~~kd~~~~~~~~~~~~~~sl~~~~~~E~~~~de~~~~~~~~k~~~~~-~~----~~~~i~~~---- 408 (607)
T KOG0240|consen 338 NLELTAEEWKRKLEKKKDKNVALKEELEKLRNSLKRWRNGEEVKEDEDFSLKEEAKMSAIL-SE----EEMSITKL---- 408 (607)
T ss_pred hhHhhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhhcccCcccchhhhhHHHHHHhhhhh-hh----hhhhhhhc----
Confidence 9999999999999999999999999999999999999999999998887654433322100 00 00011100
Q ss_pred cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy5721 161 LMLGSLSNEERQKLEEERERLYQQLDEKDEEINQQSQYAEKLKEQIMEQEELITTARRDYEQLQGEMTRLTQENESAKEE 240 (290)
Q Consensus 161 ~~~~~~~~~e~~~l~e~~~~L~~~L~ekd~ei~~~~~~~~klk~ql~~qee~~~~~~~e~~~l~~el~~lq~E~~~~~~e 240 (290)
....+.+.+.+.+++..|++|++++|.+++++++..++++.++.++++..+...+..+..+.++.++|.+++..+++
T Consensus 409 ---~~~~~~~~~~~~e~~~~L~qqlD~kd~~~n~~sqL~~~lk~q~~~qee~~s~~~~~~e~~q~e~~~~Q~~~e~~~~e 485 (607)
T KOG0240|consen 409 ---KGSLEEEEDILTERIESLYQQLDQKDDQINKQSQLMEKLKEQLLDQEELLSSTRRLYEDIQQELSEIQEENEAAKDE 485 (607)
T ss_pred ---ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 01246778899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhHHHhhhhhhh
Q psy5721 241 VKEVLQALEEPTRTLLNFF 259 (290)
Q Consensus 241 ~kel~q~LeE~~~~l~~~~ 259 (290)
++++.++|++++.+.+-..
T Consensus 486 ~~e~~~al~el~~~~~~~~ 504 (607)
T KOG0240|consen 486 VKEVLTALEELAVNYDQKS 504 (607)
T ss_pred HHHHHHHHHHHHHhhhHHH
Confidence 9999999999997765443
|
|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >KOG4005|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG4657|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2010|consensus | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4005|consensus | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >PF14723 SSFA2_C: Sperm-specific antigen 2 C-terminus | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 290 | ||||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 2e-39 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 3e-32 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-31 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 3e-30 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 4e-30 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 5e-26 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 1e-25 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-21 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-19 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 2e-16 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-15 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 2e-15 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 5e-15 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 7e-15 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 7e-15 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 7e-15 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 7e-15 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 7e-15 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 8e-15 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-14 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 1e-14 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 2e-14 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 2e-14 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 1e-13 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 9e-13 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-12 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-12 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-12 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 3e-12 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-12 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 6e-10 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 3e-09 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 3e-09 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-09 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 1e-08 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 2e-08 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-08 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 6e-08 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 6e-08 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 1e-07 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 1e-07 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-07 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-07 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 1e-07 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 7e-07 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 1e-06 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 1e-06 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 1e-06 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 1e-06 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 1e-06 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 4e-06 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 7e-06 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 9e-06 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 1e-05 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-05 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 2e-05 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-05 |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
|
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 2e-57 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 3e-55 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 4e-51 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 8e-51 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 3e-45 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-44 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 9e-44 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 7e-43 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 1e-42 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 2e-42 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 3e-42 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 9e-41 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 9e-41 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 2e-39 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 7e-39 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-38 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 1e-36 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 3e-36 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 2e-35 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 4e-35 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 1e-34 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 5e-34 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 2e-33 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 6e-33 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 1e-31 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 1e-31 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 3e-29 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-27 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 4e-05 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 2e-04 |
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
Score = 179 bits (455), Expect = 2e-57
Identities = 83/112 (74%), Positives = 99/112 (88%)
Query: 8 ALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDF 67
AL NVISALA+G KTH+PYRDSK+TRILQ+SLGGN RTTI+ICCSP+ FNE+ETKSTL F
Sbjct: 6 ALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMF 65
Query: 68 GRRAKTIKNVVTVNEELTAEEWKRRYEKEKEKSSRYKGKLEKLELELSRWRN 119
G+RAKTIKN V+VN ELTAEEWK++YEKEKEK+ K ++ LE+EL+RWRN
Sbjct: 66 GQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN 117
|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 99.96 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 99.94 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 99.94 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 99.94 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 99.93 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 99.93 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 99.93 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 99.93 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 99.92 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 99.92 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.92 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 99.92 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 99.91 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 99.91 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.91 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 99.91 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 99.91 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 99.91 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 99.91 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 99.91 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 99.9 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 99.9 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 99.9 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 99.9 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 99.9 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 99.9 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 99.9 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 99.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.74 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.18 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.47 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 95.33 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 95.17 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.11 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.04 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 94.78 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 94.6 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 93.99 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.95 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.91 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 93.85 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 93.71 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.71 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 93.69 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 93.52 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 93.46 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 93.32 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.17 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 93.13 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.06 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 92.74 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 92.62 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 92.01 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 91.87 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 91.16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 91.15 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.91 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 90.51 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 90.28 | |
| 2q6q_A | 74 | Spindle POLE BODY component SPC42; SPC42P, budding | 90.02 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 89.65 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 89.61 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 89.58 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 89.45 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 89.12 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.12 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 88.29 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 88.08 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 87.46 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 86.87 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.87 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 86.84 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 86.47 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 86.16 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 86.12 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.0 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 85.74 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 85.52 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 85.25 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.63 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 84.43 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 84.25 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 83.95 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 82.65 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 82.59 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 82.1 | |
| 1t6f_A | 37 | Geminin; coiled-coil, cell cycle; 1.47A {Synthetic | 81.98 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 81.93 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 80.31 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 80.12 |
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
Probab=100.00 E-value=5.5e-37 Score=246.55 Aligned_cols=117 Identities=71% Similarity=1.079 Sum_probs=114.7
Q ss_pred chhHhHHHHHHHHHHcCCCCCCCCCCChhhhhchhhcCCCCcceEEEeeCCCCCChHhhhhhhhhhhhccccccccccCc
Q psy5721 3 IFACGALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDFGRRAKTIKNVVTVNE 82 (290)
Q Consensus 3 N~SL~~L~~vi~aL~~~~~~~vPyRdSkLT~lL~~~l~g~~~t~mi~~vsp~~~~~~EtlstL~fa~rak~i~~~~~~n~ 82 (290)
|+||++||+||.||++++..||||||||||+||+|+|||||+|+||+||+|+..+++||++||+||+||+.|++.|.+|.
T Consensus 1 N~SL~~Lg~vi~aL~~~~~~hvPyRdSkLT~lL~dsLggn~~t~~i~~isp~~~~~~eTl~TL~fa~rak~i~n~~~~n~ 80 (117)
T 3kin_B 1 NKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNL 80 (117)
T ss_dssp CCHHHHHHHHHHHHHHSCCSSCCGGGSHHHHHTHHHHHSSSEEEEEEEECCSGGGHHHHHHHHHHHHHHTTCEEEECCCB
T ss_pred CCCHHHHHHHHHHHHhCCCCCCCCcchHHHHHHHHHcCCCccceeeeeeCCCcccHHHHHHHHHHHHHhCcccCCceecC
Confidence 89999999999999998778999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy5721 83 ELTAEEWKRRYEKEKEKSSRYKGKLEKLELELSRWRN 119 (290)
Q Consensus 83 ~~~~~~~~~~~~~~~~~~~~l~~~i~~L~~el~~~~~ 119 (290)
+++++.|.++|+++.+++..|+..|+.|+.|+.+||+
T Consensus 81 ~~~~~~l~~~~~~e~~~~~~L~~~i~~Le~el~~~R~ 117 (117)
T 3kin_B 81 ELTAEEWKKKYEKEKEKNKALKSVIQHLEVELNRWRN 117 (117)
T ss_dssp CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred cCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence 9999999999999999999999999999999999984
|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 290 | ||||
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 5e-31 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-30 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 1e-28 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 2e-28 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 7e-27 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 3e-25 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-25 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 4e-25 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-24 | |
| d1bjta_ | 760 | e.11.1.1 (A:) DNA topoisomerase II, C-terminal fra | 0.002 |
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Neurospora crassa [TaxId: 5141]
Score = 116 bits (291), Expect = 5e-31
Identities = 58/92 (63%), Positives = 71/92 (77%)
Query: 8 ALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDF 67
AL VI+AL DG +H+PYRDSKLTRILQESLGGN+RTT+II CSP+S+N++ET STL F
Sbjct: 263 ALGMVINALTDGKSSHVPYRDSKLTRILQESLGGNSRTTLIINCSPSSYNDAETLSTLRF 322
Query: 68 GRRAKTIKNVVTVNEELTAEEWKRRYEKEKEK 99
G RAK+IKN VN EL+ E K+ K K +
Sbjct: 323 GMRAKSIKNKAKVNAELSPAELKQMLAKAKTQ 354
|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 760 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 99.91 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 99.9 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 99.87 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 99.87 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 99.87 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 99.86 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 99.86 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 99.84 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=99.91 E-value=2.7e-26 Score=215.18 Aligned_cols=101 Identities=37% Similarity=0.501 Sum_probs=87.4
Q ss_pred CcchhHhHHHHHHHHHHcCCCCCCCCCCChhhhhchhhcCCCCcceEEEeeCCCCCChHhhhhhhhhhhhcccccccccc
Q psy5721 1 MNIFACGALRNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIIICCSPASFNESETKSTLDFGRRAKTIKNVVTV 80 (290)
Q Consensus 1 ~IN~SL~~L~~vi~aL~~~~~~~vPyRdSkLT~lL~~~l~g~~~t~mi~~vsp~~~~~~EtlstL~fa~rak~i~~~~~~ 80 (290)
.||+||++||+||.||+++. .|||||+||||+||+|+|||||+|+||+||||+..+++||++||+||++|+.|+|.|.+
T Consensus 250 ~iN~SL~~L~~vi~aL~~~~-~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~ 328 (364)
T d1sdma_ 250 SINKSLSALGDVISALSSGN-QHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSK 328 (364)
T ss_dssp TTCHHHHHHHHHHHHHHHTC-SCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCC
T ss_pred ccccchhhHHHHHHHHHcCC-CcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcc
Confidence 59999999999999999987 89999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy5721 81 NEELTAEEWKRRYEKEKEKSSRYKGKLEKLELELS 115 (290)
Q Consensus 81 n~~~~~~~~~~~~~~~~~~~~~l~~~i~~L~~el~ 115 (290)
|.... .+..|+.++..|+.++.
T Consensus 329 n~~~~-------------~~~~l~~~i~~l~~~~~ 350 (364)
T d1sdma_ 329 NVSSK-------------EVARLKKLVSYWKEQAG 350 (364)
T ss_dssp CEECH-------------HHHHHHTTTTCC-----
T ss_pred cCCHH-------------HHHHHHHHHHHHHHHHH
Confidence 98652 24456666666666553
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|