Psyllid ID: psy5751


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCPG
cEEEEEEEccccEEEEEEccccccEEEEEccccccEEEEEcccccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEcccccccEEEEEEccccEEEEEEcccccccEEEEEccccccEEEEEcccccccEEEEEEccccEEEEEEcccccEEEEccccccEEEEEccccccEEEEEEccEEEEEEccccEEEEEEcccccccEEEEcccccccEEEEEEEcccccc
cEEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccccccEEEEccccccEEEEEEEccccEEEEEEccccccEEEEEEccccccEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEEccEEEEEEEEEccccEEEEEEEccEEEEEEccccEEEEEEccccccEEEEEcccccccEEEEEEccccccc
mligitvdcvegQVYYssvadkssikrahldgknvedvittnirspegltfdwvNRVLYWTDSQMDTIsmanlnddqpkvivskdlvnprgivvhpyyrklfwsdwnrsgpkiewsnldgtdREIFLKAAdlklpnslavdfrtdelcwvdadskslecmtirnrvrrkvysnctypfglsitdekyywtdwkTNRIESAnkegerapsiaLDMMGTTYMYGiaavpsscpg
mligitvdcvegQVYYSsvadkssikrahldgknvedvittnirspegltfdWVNRVLYWTDSQMDTISMAnlnddqpkvivskdlvnprgIVVHPYYRKlfwsdwnrsgpkiewsnldgtDREIFLKAADLKLPNSLAVDFRTDElcwvdadskslecmtirnrvrrkvysnctypfglsitdekyywTDWKTNRIesankegerapSIALDMMGTTYMYGIAAVPSSCPG
MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCPG
*LIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRI************IALDMMGTTYMYGIAAV******
MLIGITVDCVEGQVYYSSVADKSSIKRAHLD*KNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPS*C**
MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCPG
MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
P104931245 Nidogen-1 OS=Mus musculus yes N/A 0.969 0.180 0.401 8e-46
O883221403 Nidogen-2 OS=Mus musculus no N/A 0.982 0.162 0.409 8e-45
P145431247 Nidogen-1 OS=Homo sapiens yes N/A 0.982 0.182 0.389 1e-44
B5DFC91396 Nidogen-2 OS=Rattus norve no N/A 0.982 0.163 0.405 3e-44
Q141121375 Nidogen-2 OS=Homo sapiens no N/A 0.982 0.165 0.405 4e-44
Q9QYP1 1905 Low-density lipoprotein r no N/A 0.896 0.109 0.383 1e-35
Q91VN0 1614 Low-density lipoprotein r no N/A 0.849 0.122 0.383 4e-35
O75096 1905 Low-density lipoprotein r no N/A 0.896 0.109 0.379 4e-35
O75197 1615 Low-density lipoprotein r no N/A 0.849 0.121 0.378 5e-35
Q8VI56 1905 Low-density lipoprotein r no N/A 0.896 0.109 0.379 5e-35
>sp|P10493|NID1_MOUSE Nidogen-1 OS=Mus musculus GN=Nid1 PE=1 SV=2 Back     alignment and function desciption
 Score =  183 bits (465), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 94/234 (40%), Positives = 135/234 (57%), Gaps = 9/234 (3%)

Query: 1    MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYW 60
            ++IG+  DCV+  VY++ +++  SI RA L G     +I  ++ SPEG+  D + R ++W
Sbjct: 977  VIIGLAFDCVDKVVYWTDISE-PSIGRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFW 1035

Query: 61   TDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDG 120
            TDSQ+D I +A ++  Q +V+    LVNPRGIV  P    L+W+DWNR  PKIE S++DG
Sbjct: 1036 TDSQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDG 1095

Query: 121  TDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGL 180
            T+R I L   +L LPN L  D  + +LCWVDA +   EC+      RRKV     YPF +
Sbjct: 1096 TNRRI-LAQDNLGLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPGRRKVLEGLQYPFAV 1154

Query: 181  SITDEKYYWTDWKTNRIESANKEGERAPSIALDMM---GTTYMYGIAAVPSSCP 231
            +   +  Y+TDWKTN + +     + A S  +D       T +YGI    S CP
Sbjct: 1155 TSYGKNLYYTDWKTNSVIAM----DLAISKEMDTFHPHKQTRLYGITIALSQCP 1204




Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.
Mus musculus (taxid: 10090)
>sp|O88322|NID2_MOUSE Nidogen-2 OS=Mus musculus GN=Nid2 PE=1 SV=2 Back     alignment and function description
>sp|P14543|NID1_HUMAN Nidogen-1 OS=Homo sapiens GN=NID1 PE=1 SV=3 Back     alignment and function description
>sp|B5DFC9|NID2_RAT Nidogen-2 OS=Rattus norvegicus GN=Nid2 PE=2 SV=1 Back     alignment and function description
>sp|Q14112|NID2_HUMAN Nidogen-2 OS=Homo sapiens GN=NID2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus GN=Lrp4 PE=1 SV=2 Back     alignment and function description
>sp|Q91VN0|LRP5_MOUSE Low-density lipoprotein receptor-related protein 5 OS=Mus musculus GN=Lrp5 PE=1 SV=3 Back     alignment and function description
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function description
>sp|O75197|LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens GN=LRP5 PE=1 SV=2 Back     alignment and function description
>sp|Q8VI56|LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus GN=Lrp4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
242024896 1512 low density lipoprotein receptor, putati 0.982 0.150 0.519 3e-65
91080871 1320 PREDICTED: similar to nidogen [Tribolium 0.982 0.172 0.450 1e-61
157115559 1298 nidogen [Aedes aegypti] gi|108876881|gb| 0.991 0.177 0.5 1e-61
312371425 1353 hypothetical protein AND_22113 [Anophele 0.991 0.169 0.5 3e-61
383847655 1294 PREDICTED: LOW QUALITY PROTEIN: nidogen- 0.987 0.176 0.491 8e-61
158296946 1342 AGAP008193-PA [Anopheles gambiae str. PE 0.991 0.171 0.508 1e-60
195120874 1344 GI19329 [Drosophila mojavensis] gi|19391 0.991 0.171 0.469 2e-60
170036497 1307 nidogen [Culex quinquefasciatus] gi|1678 0.991 0.175 0.5 3e-60
350409208 1284 PREDICTED: nidogen-2-like [Bombus impati 0.987 0.178 0.478 1e-59
194753960 1352 GF12792 [Drosophila ananassae] gi|190620 0.991 0.170 0.491 2e-59
>gi|242024896|ref|XP_002432862.1| low density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212518371|gb|EEB20124.1| low density lipoprotein receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/231 (51%), Positives = 166/231 (71%), Gaps = 3/231 (1%)

Query: 3    IGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTD 62
            IGI +DC E +VY+S +A K  I+ A   G +V+  IT  I+S EGL  DW++R +YWTD
Sbjct: 1235 IGIDIDCTENRVYWSDIAGKK-IESATYMGTDVKKFITDGIQSVEGLAIDWLSRNIYWTD 1293

Query: 63   SQMDTISMANL-NDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGT 121
            S+ DTI +A+L N++  KV++++ LVNPRGI VHP   K+FWSDWNR+ PKIEW+NLDGT
Sbjct: 1294 SKKDTIEVAHLDNNNLRKVLINEGLVNPRGIAVHPSRGKVFWSDWNRAAPKIEWANLDGT 1353

Query: 122  DREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLS 181
             R +F++   ++LPNSLA+DF TDELCW DA +K++EC  I NR  R V  NC+YPFGL+
Sbjct: 1354 ARAVFVEGPSVQLPNSLAIDFATDELCWADAGTKAIECTGIVNRYSRTVTKNCSYPFGLA 1413

Query: 182  ITDEKYYWTDWKTNRIESANKEGERA-PSIALDMMGTTYMYGIAAVPSSCP 231
            I+   YYWTDW T +IE   +  +R   ++++ ++G+  +YGI AVP SCP
Sbjct: 1414 ISQNHYYWTDWTTRKIERFERSSQRLDKALSVPIVGSAKLYGIVAVPDSCP 1464




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91080871|ref|XP_972325.1| PREDICTED: similar to nidogen [Tribolium castaneum] gi|270005920|gb|EFA02368.1| hypothetical protein TcasGA2_TC008043 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157115559|ref|XP_001658264.1| nidogen [Aedes aegypti] gi|108876881|gb|EAT41106.1| AAEL007226-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312371425|gb|EFR19617.1| hypothetical protein AND_22113 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|383847655|ref|XP_003699468.1| PREDICTED: LOW QUALITY PROTEIN: nidogen-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|158296946|ref|XP_317275.4| AGAP008193-PA [Anopheles gambiae str. PEST] gi|157014957|gb|EAA12454.4| AGAP008193-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195120874|ref|XP_002004946.1| GI19329 [Drosophila mojavensis] gi|193910014|gb|EDW08881.1| GI19329 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|170036497|ref|XP_001846100.1| nidogen [Culex quinquefasciatus] gi|167879168|gb|EDS42551.1| nidogen [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350409208|ref|XP_003488653.1| PREDICTED: nidogen-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|194753960|ref|XP_001959273.1| GF12792 [Drosophila ananassae] gi|190620571|gb|EDV36095.1| GF12792 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
FB|FBgn00264031370 Ndg "Nidogen/entactin" [Drosop 0.991 0.167 0.461 2.5e-54
UNIPROTKB|F1NC71474 NID1 "Uncharacterized protein" 0.974 0.476 0.4 5e-44
UNIPROTKB|H0YJV3644 NID2 "Nidogen-2" [Homo sapiens 0.982 0.354 0.405 5.7e-43
UNIPROTKB|F1NP231239 NID1 "Uncharacterized protein" 0.974 0.182 0.4 9.1e-43
UNIPROTKB|F1MWN31236 F1MWN3 "Uncharacterized protei 0.982 0.184 0.393 1.9e-42
WB|WBGene000037381584 nid-1 [Caenorhabditis elegans 0.982 0.143 0.402 3e-42
MGI|MGI:12982291403 Nid2 "nidogen 2" [Mus musculus 0.982 0.162 0.409 8.3e-42
UNIPROTKB|F1PXK31244 NID1 "Uncharacterized protein" 0.982 0.183 0.380 1.1e-41
MGI|MGI:973421245 Nid1 "nidogen 1" [Mus musculus 0.969 0.180 0.401 1.1e-41
UNIPROTKB|Q141121375 NID2 "Nidogen-2" [Homo sapiens 0.982 0.165 0.405 1.3e-41
FB|FBgn0026403 Ndg "Nidogen/entactin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 573 (206.8 bits), Expect = 2.5e-54, P = 2.5e-54
 Identities = 107/232 (46%), Positives = 149/232 (64%)

Query:     1 MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYW 60
             M IG+  DCVEG+VY+  ++ K  +   + DG ++   ITT+I SPEG+  D ++R LYW
Sbjct:  1093 MAIGLDKDCVEGRVYWGDISTKKIVSTKY-DGTDLRPFITTDIESPEGIAIDVISRRLYW 1151

Query:    61 TDSQMDTISMANLNDDQPK-VIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLD 119
              DS  DTI +A+L+D   + VI++K LVNPRGI V PY  KLFWSDW+R  PKIE SNLD
Sbjct:  1152 ADSAKDTIEVASLDDPSLRAVIINKQLVNPRGIAVDPYREKLFWSDWDRESPKIEMSNLD 1211

Query:   120 GTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFG 179
             GT RE+ L   D+ LPNSL V   + E+C+ DA +K +EC+  +NR  R + +  +YPFG
Sbjct:  1212 GTGRELLLGKDDVTLPNSLVVLENSGEVCYADAGTKKVECIEPQNRQIRTISNELSYPFG 1271

Query:   180 LSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCP 231
             ++ T +++YWTDW T ++E  +  G R   I     G+  MYG+  V   CP
Sbjct:  1272 ITFTHDQFYWTDWTTKKVEIVDSLGARQTPIQPPFFGSHKMYGMTVVEQHCP 1323




GO:0005604 "basement membrane" evidence=ISS
GO:0007160 "cell-matrix adhesion" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|F1NC71 NID1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0YJV3 NID2 "Nidogen-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NP23 NID1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWN3 F1MWN3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00003738 nid-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1298229 Nid2 "nidogen 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXK3 NID1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97342 Nid1 "nidogen 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14112 NID2 "Nidogen-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 2e-09
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 4e-08
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 4e-06
pfam0005842 pfam00058, Ldl_recept_b, Low-density lipoprotein r 0.002
smart0013543 smart00135, LY, Low-density lipoprotein-receptor Y 0.003
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
 Score = 51.1 bits (123), Expect = 2e-09
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 79  KVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDR 123
           + ++S  L +P G+ V     +L+W+DW      IE +NLDGT+R
Sbjct: 1   RTLLSSGLGHPNGLAVDWIEGRLYWTDWGL--DVIEVANLDGTNR 43


Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin. Length = 43

>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|215683 pfam00058, Ldl_recept_b, Low-density lipoprotein receptor repeat class B Back     alignment and domain information
>gnl|CDD|214531 smart00135, LY, Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG1214|consensus1289 100.0
KOG1214|consensus1289 99.96
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.95
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.92
KOG1215|consensus 877 99.92
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.89
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.86
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.82
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.68
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.64
PRK11028330 6-phosphogluconolactonase; Provisional 99.64
KOG1215|consensus 877 99.63
COG3391 381 Uncharacterized conserved protein [Function unknow 99.61
PRK11028330 6-phosphogluconolactonase; Provisional 99.6
KOG4659|consensus 1899 99.59
COG3391381 Uncharacterized conserved protein [Function unknow 99.52
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 99.51
COG3386307 Gluconolactonase [Carbohydrate transport and metab 99.51
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.48
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.44
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 99.44
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.42
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 99.37
KOG4499|consensus310 99.35
KOG1520|consensus376 99.35
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 99.32
KOG1520|consensus376 99.28
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.27
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.26
KOG4659|consensus 1899 99.24
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.19
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 99.17
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.15
PRK04792448 tolB translocation protein TolB; Provisional 99.14
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 99.08
COG3204316 Uncharacterized protein conserved in bacteria [Fun 99.05
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 99.04
PRK05137435 tolB translocation protein TolB; Provisional 99.02
PRK04922433 tolB translocation protein TolB; Provisional 99.0
PRK02889427 tolB translocation protein TolB; Provisional 98.98
PRK00178430 tolB translocation protein TolB; Provisional 98.97
PRK04043419 tolB translocation protein TolB; Provisional 98.96
PRK03629429 tolB translocation protein TolB; Provisional 98.95
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.94
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.93
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.93
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 98.93
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 98.92
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.91
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.89
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 98.83
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.83
PRK01029428 tolB translocation protein TolB; Provisional 98.8
PRK05137435 tolB translocation protein TolB; Provisional 98.79
PRK04792448 tolB translocation protein TolB; Provisional 98.78
PRK02889427 tolB translocation protein TolB; Provisional 98.76
PRK04043419 tolB translocation protein TolB; Provisional 98.76
PRK03629429 tolB translocation protein TolB; Provisional 98.69
PRK04922433 tolB translocation protein TolB; Provisional 98.68
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.66
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 98.65
PRK01742429 tolB translocation protein TolB; Provisional 98.64
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 98.64
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.62
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 98.62
PRK00178430 tolB translocation protein TolB; Provisional 98.62
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.6
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 98.55
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 98.53
PRK01742429 tolB translocation protein TolB; Provisional 98.38
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 98.38
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.37
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 98.34
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.32
KOG0279|consensus315 98.3
PRK02888 635 nitrous-oxide reductase; Validated 98.28
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 98.21
PRK01029428 tolB translocation protein TolB; Provisional 98.21
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 98.21
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.19
COG2133399 Glucose/sorbosone dehydrogenases [Carbohydrate tra 98.18
COG3204316 Uncharacterized protein conserved in bacteria [Fun 98.03
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.96
KOG4499|consensus310 97.84
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 97.75
PRK02888 635 nitrous-oxide reductase; Validated 97.73
KOG0291|consensus 893 97.62
COG5276370 Uncharacterized conserved protein [Function unknow 97.61
KOG0291|consensus 893 97.54
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.46
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.39
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.38
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.36
PF05787524 DUF839: Bacterial protein of unknown function (DUF 97.29
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.24
KOG1446|consensus311 97.17
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.16
KOG0289|consensus506 97.12
PTZ00421 493 coronin; Provisional 97.06
COG4946668 Uncharacterized protein related to the periplasmic 97.05
KOG0315|consensus311 96.99
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 96.86
KOG0285|consensus 460 96.8
PLN00181793 protein SPA1-RELATED; Provisional 96.8
PF13449326 Phytase-like: Esterase-like activity of phytase 96.8
PF13449326 Phytase-like: Esterase-like activity of phytase 96.76
KOG0285|consensus460 96.66
KOG4378|consensus 673 96.58
KOG0272|consensus459 96.56
KOG4378|consensus 673 96.54
COG5276370 Uncharacterized conserved protein [Function unknow 96.49
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.4
KOG0310|consensus 487 96.29
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 96.27
KOG1446|consensus311 96.24
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 96.19
PLN00181793 protein SPA1-RELATED; Provisional 96.12
PTZ00421 493 coronin; Provisional 96.06
KOG0318|consensus 603 96.0
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 95.91
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.86
KOG0266|consensus456 95.85
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.76
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 95.74
KOG0315|consensus311 95.73
COG3823262 Glutamine cyclotransferase [Posttranslational modi 95.67
KOG4649|consensus 354 95.67
KOG4441|consensus571 95.64
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.53
COG4946 668 Uncharacterized protein related to the periplasmic 95.48
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.44
KOG0279|consensus315 95.43
KOG0266|consensus456 95.4
KOG4328|consensus498 95.38
KOG0318|consensus 603 95.33
KOG4441|consensus571 95.08
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.06
KOG0292|consensus 1202 95.04
KOG0310|consensus 487 95.03
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 94.99
KOG0281|consensus499 94.95
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.88
KOG1539|consensus 910 94.88
PTZ00420 568 coronin; Provisional 94.83
KOG0268|consensus433 94.77
PTZ00420 568 coronin; Provisional 94.74
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 94.58
PRK13616591 lipoprotein LpqB; Provisional 94.48
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 94.45
KOG0293|consensus519 94.21
KOG0289|consensus506 94.21
KOG0263|consensus707 94.09
KOG0268|consensus 433 93.91
smart00284255 OLF Olfactomedin-like domains. 93.78
KOG0292|consensus 1202 93.75
KOG2055|consensus514 93.64
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.45
KOG1274|consensus 933 93.44
KOG0263|consensus707 93.17
PRK13616591 lipoprotein LpqB; Provisional 93.13
KOG0286|consensus343 93.07
KOG4328|consensus498 93.07
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 92.98
COG3211616 PhoX Predicted phosphatase [General function predi 92.96
KOG1539|consensus 910 92.58
KOG0294|consensus362 92.55
KOG2048|consensus691 92.55
KOG0272|consensus459 92.49
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 92.49
KOG3621|consensus 726 92.35
KOG0277|consensus311 92.28
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.24
KOG0303|consensus 472 92.24
KOG0308|consensus 735 92.06
KOG0264|consensus422 92.06
KOG0639|consensus705 91.71
KOG0308|consensus 735 91.47
COG3211616 PhoX Predicted phosphatase [General function predi 91.46
KOG0276|consensus 794 91.4
KOG0273|consensus524 91.25
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 91.22
KOG0282|consensus503 91.13
KOG3914|consensus 390 91.05
PHA02713557 hypothetical protein; Provisional 90.96
KOG0286|consensus343 90.51
KOG0282|consensus 503 90.42
KOG0319|consensus 775 90.21
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 90.16
KOG0281|consensus499 89.96
KOG0646|consensus 476 89.78
KOG1517|consensus1387 89.37
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 88.79
KOG0319|consensus 775 88.52
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 88.34
KOG0306|consensus 888 88.21
smart00284255 OLF Olfactomedin-like domains. 88.18
KOG0270|consensus463 87.84
KOG0645|consensus312 87.74
KOG0641|consensus350 87.6
KOG1407|consensus313 87.11
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 86.99
KOG0639|consensus705 86.97
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 86.85
PHA02713557 hypothetical protein; Provisional 86.29
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 86.0
KOG0284|consensus464 85.26
KOG1407|consensus313 85.11
KOG2111|consensus346 84.87
KOG0640|consensus430 84.25
KOG0275|consensus508 84.04
PRK10115 686 protease 2; Provisional 83.3
KOG0307|consensus 1049 83.27
KOG2110|consensus391 83.18
KOG0973|consensus 942 83.03
KOG0649|consensus325 82.71
KOG0772|consensus 641 81.85
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 81.83
KOG2139|consensus445 81.52
COG1770 682 PtrB Protease II [Amino acid transport and metabol 80.57
KOG0918|consensus476 80.32
>KOG1214|consensus Back     alignment and domain information
Probab=100.00  E-value=1.4e-45  Score=308.93  Aligned_cols=229  Identities=42%  Similarity=0.782  Sum_probs=220.7

Q ss_pred             CeEEEEEeCCCCEEEEEEcCCCCcEEEEEcCCCceeEEEeCCCCCccEEEEeecCCeEEEEeCCCCeEEEEeCCCCCCEE
Q psy5751           1 MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKV   80 (232)
Q Consensus         1 ~~~~i~~d~~~~~ly~~d~~~~~~i~~~~~~g~~~~~~~~~~~~~p~gl~~d~~~~~ly~~d~~~~~I~~~~~~g~~~~~   80 (232)
                      +++||+||..+..+||+|+... .|.+..|+|...++++..++..|+||||||+.+++||+|+.+.+|.+..++|+.+++
T Consensus      1026 IiVGidfDC~e~mvyWtDv~g~-SI~rasL~G~Ep~ti~n~~L~SPEGiAVDh~~Rn~ywtDS~lD~IevA~LdG~~rkv 1104 (1289)
T KOG1214|consen 1026 IIVGIDFDCRERMVYWTDVAGR-SISRASLEGAEPETIVNSGLISPEGIAVDHIRRNMYWTDSVLDKIEVALLDGSERKV 1104 (1289)
T ss_pred             eeeeeecccccceEEEeecCCC-ccccccccCCCCceeecccCCCccceeeeeccceeeeeccccchhheeecCCceeeE
Confidence            4789999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCCceEEEEeCCCCeEEEEEcCCCCCcEEEEeCCCCCcEEEEEcCCCCCcceEEEeCCCCEEEEEECCCCcEEEE
Q psy5751          81 IVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECM  160 (232)
Q Consensus        81 ~~~~~~~~p~~iavd~~~~~ly~~d~~~~~~~I~~~~~~g~~~~~~~~~~~~~~p~~l~~d~~~~~Ly~~d~~~~~i~~~  160 (232)
                      ++.+.+-+|++|++|+.+|.|||+||++++++|.+.+|||++.+++++.+ +.-||||+||+..+.|.|+|.++++++++
T Consensus      1105 Lf~tdLVNPR~iv~D~~rgnLYwtDWnRenPkIets~mDG~NrRilin~D-igLPNGLtfdpfs~~LCWvDAGt~rleC~ 1183 (1289)
T KOG1214|consen 1105 LFYTDLVNPRAIVVDPIRGNLYWTDWNRENPKIETSSMDGENRRILINTD-IGLPNGLTFDPFSKLLCWVDAGTKRLECT 1183 (1289)
T ss_pred             EEeecccCcceEEeecccCceeeccccccCCcceeeccCCccceEEeecc-cCCCCCceeCcccceeeEEecCCcceeEe
Confidence            99999999999999999999999999999999999999999999999988 99999999999999999999999999999


Q ss_pred             ecCCCceEEEecCCCceEEEEEECCEEEEEeCCCCcEEEEeCCCCCcceEEeccCCcceeEEEEEEcCCCCC
Q psy5751         161 TIRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCPG  232 (232)
Q Consensus       161 ~~~g~~~~~~~~~~~~p~gla~~~~~ly~td~~~~~i~~~~~~g~~~~~i~~~~~~~~~p~gi~~~~~~~~~  232 (232)
                      .++|..|+++.+.++.|++|+-+++.+|||||+.+.|.++++.+++.+..+.+..++ +-+||+.+.++||+
T Consensus      1184 ~p~g~gRR~i~~~LqYPF~itsy~~~fY~TDWk~n~vvsv~~~~~~~td~~~p~~~s-~lyGItav~~~Cp~ 1254 (1289)
T KOG1214|consen 1184 LPDGTGRRVIQNNLQYPFSITSYADHFYHTDWKRNGVVSVNKHSGQFTDEYLPEQRS-HLYGITAVYPYCPT 1254 (1289)
T ss_pred             cCCCCcchhhhhcccCceeeeeccccceeeccccCceEEeecccccccccccccccc-ceEEEEeccccCCC
Confidence            999999999999999999999999899999999999999999999988888777666 48999999999995



>KOG1214|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG2133 Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>COG3211 PhoX Predicted phosphatase [General function prediction only] Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0918|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1npe_A267 Crystal Structure Of Nidogen/laminin Complex Length 8e-46
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 5e-34
3v64_C349 Crystal Structure Of Agrin And Lrp4 Length = 349 6e-34
4dg6_A616 Crystal Structure Of Domains 1 And 2 Of Lrp6 Length 5e-33
3s94_A619 Crystal Structure Of Lrp6-E1e2 Length = 619 7e-33
3soq_A318 The Structure Of The First Ywtd Beta Propeller Doma 6e-28
3sob_B316 The Structure Of The First Ywtd Beta Propeller Doma 7e-28
3s2k_A 629 Structural Basis Of Wnt Signaling Inhibition By Dic 5e-27
4a0p_A 628 Crystal Structure Of Lrp6p3e3p4e4 Length = 628 5e-27
3s8v_A 623 Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 5e-27
1n7d_A699 Extracellular Domain Of The Ldl Receptor Length = 6 5e-23
1ijq_A316 Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma 1e-22
3p5b_L400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 2e-22
3p5c_L440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 4e-22
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-21
>pdb|1NPE|A Chain A, Crystal Structure Of Nidogen/laminin Complex Length = 267 Back     alignment and structure

Iteration: 1

Score = 179 bits (455), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 94/234 (40%), Positives = 135/234 (57%), Gaps = 9/234 (3%) Query: 1 MLIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYW 60 ++IG+ DCV+ VY++ +++ SI RA L G +I ++ SPEG+ D + R ++W Sbjct: 37 VIIGLAFDCVDKVVYWTDISE-PSIGRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFW 95 Query: 61 TDSQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDG 120 TDSQ+D I +A ++ Q +V+ LVNPRGIV P L+W+DWNR PKIE S++DG Sbjct: 96 TDSQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDG 155 Query: 121 TDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGL 180 T+R I L +L LPN L D + +LCWVDA + EC+ RRKV YPF + Sbjct: 156 TNRRI-LAQDNLGLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPGRRKVLEGLQYPFAV 214 Query: 181 SITDEKYYWTDWKTNRIESANKEGERAPSIALDMMG---TTYMYGIAAVPSSCP 231 + + Y+TDWKTN + + + A S +D T +YGI S CP Sbjct: 215 TSYGKNLYYTDWKTNSVIAM----DLAISKEMDTFHPHKQTRLYGITIALSQCP 264
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 Back     alignment and structure
>pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 Back     alignment and structure
>pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 Back     alignment and structure
>pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 Back     alignment and structure
>pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 Back     alignment and structure
>pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 Back     alignment and structure
>pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 Back     alignment and structure
>pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 9e-78
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 3e-37
3v65_B386 Low-density lipoprotein receptor-related protein; 5e-66
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 2e-63
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 1e-23
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-08
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 2e-63
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 1e-09
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-62
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 2e-09
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-60
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 4e-33
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 2e-10
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-59
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 9e-33
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 2e-10
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 8e-58
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 4e-52
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 4e-29
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 5e-29
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 7e-12
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 5e-57
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 6e-26
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 2e-08
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 8e-57
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 2e-56
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 9e-34
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 5e-28
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 6e-09
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 3e-17
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 9e-10
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 5e-05
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 7e-04
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 7e-04
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
 Score =  234 bits (598), Expect = 9e-78
 Identities = 90/229 (39%), Positives = 130/229 (56%), Gaps = 3/229 (1%)

Query: 3   IGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTD 62
           IG+  DCV+  VY++ +++ S I RA L G     +I  ++ SPEG+  D + R ++WTD
Sbjct: 39  IGLAFDCVDKVVYWTDISEPS-IGRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFWTD 97

Query: 63  SQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTD 122
           SQ+D I +A ++  Q +V+    LVNPRGIV  P    L+W+DWNR  PKIE S++DGT+
Sbjct: 98  SQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDGTN 157

Query: 123 REIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSI 182
           R I  +  +L LPN L  D  + +LCWVDA +   EC+      RRKV     YPF ++ 
Sbjct: 158 RRILAQ-DNLGLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPGRRKVLEGLQYPFAVTS 216

Query: 183 TDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSCP 231
             +  Y+TDWKTN + + +    +           T +YGI    S CP
Sbjct: 217 YGKNLYYTDWKTNSVIAMDLAISKEMDTFHP-HKQTRLYGITIALSQCP 264


>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Length = 302 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Length = 300 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Length = 299 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 100.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 100.0
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 100.0
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 100.0
3p5b_L400 Low density lipoprotein receptor variant; B-propel 100.0
3v65_B386 Low-density lipoprotein receptor-related protein; 100.0
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 100.0
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 100.0
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 100.0
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.97
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.95
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.94
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.93
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.93
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.93
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.9
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.9
3kya_A496 Putative phosphatase; structural genomics, joint c 99.9
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.89
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.89
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.89
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.89
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.88
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.87
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.87
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.86
3kya_A496 Putative phosphatase; structural genomics, joint c 99.86
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.86
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.85
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.85
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.84
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.83
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.83
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.83
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.83
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.82
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.82
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.81
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.81
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.81
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.78
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.77
2qe8_A343 Uncharacterized protein; structural genomics, join 99.77
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.76
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.75
2qe8_A343 Uncharacterized protein; structural genomics, join 99.74
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.73
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.72
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.72
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.7
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.69
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.69
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.67
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.67
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 99.66
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.65
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 99.64
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.63
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.62
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.61
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.61
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.59
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.58
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.57
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.57
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 99.57
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.55
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 99.53
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.53
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.53
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.52
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.52
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.52
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 99.46
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.46
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.43
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 99.43
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 99.43
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.42
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.41
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.41
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.41
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 99.41
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.41
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.39
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.39
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.37
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.37
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.36
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.34
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 99.33
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.32
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.27
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.27
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.26
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.26
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.23
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.22
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.22
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.22
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.21
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 99.18
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.18
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.18
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.17
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.15
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.15
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 99.12
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.07
2ece_A462 462AA long hypothetical selenium-binding protein; 99.06
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 99.02
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.0
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 99.0
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.0
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 99.0
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.95
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 98.94
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.92
2ece_A462 462AA long hypothetical selenium-binding protein; 98.91
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 98.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.86
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.85
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.83
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.75
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.73
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.68
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.65
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.64
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.62
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.62
2ymu_A577 WD-40 repeat protein; unknown function, two domain 98.62
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.58
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.57
2xyi_A430 Probable histone-binding protein CAF1; transcripti 98.56
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.55
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.52
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.51
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.5
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.49
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.48
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.48
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.47
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.46
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.45
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.43
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.41
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.4
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.39
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.35
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.35
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.35
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.34
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 98.28
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.26
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.26
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 98.25
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.24
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.23
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.22
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.21
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.21
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.2
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.19
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.14
4e54_B435 DNA damage-binding protein 2; beta barrel, double 98.13
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.12
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 98.11
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.11
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.1
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.08
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.08
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.07
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 98.05
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.04
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.04
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.04
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 98.04
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.99
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.99
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.98
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 97.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.98
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.97
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.96
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.93
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.9
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.89
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.84
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 97.83
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.81
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.8
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.8
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.8
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.79
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.79
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.78
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 97.78
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.74
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.74
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 97.73
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.72
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.72
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.7
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.67
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.67
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.67
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.66
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.65
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.64
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.64
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.64
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.63
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.59
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.57
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.55
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 97.53
3jro_A 753 Fusion protein of protein transport protein SEC13 97.51
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.49
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.47
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 97.45
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 97.43
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.4
3jrp_A379 Fusion protein of protein transport protein SEC13 97.4
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.39
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.34
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.33
3jro_A 753 Fusion protein of protein transport protein SEC13 97.32
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.27
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 97.22
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.22
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.21
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.21
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.21
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.2
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 97.19
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.18
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.18
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.14
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.14
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.14
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 97.09
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.05
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 97.01
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 96.99
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.98
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.94
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 96.86
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.75
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.73
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.72
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 96.7
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 96.61
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.52
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 96.37
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 96.34
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.2
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.07
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.04
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.97
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 95.75
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 95.68
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.56
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 95.51
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 95.47
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.46
3ott_A 758 Two-component system sensor histidine kinase; beta 95.42
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.38
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.29
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.08
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 94.43
2pm7_B297 Protein transport protein SEC13, protein transport 94.4
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.31
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.26
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.16
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 93.92
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.89
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.55
3ott_A 758 Two-component system sensor histidine kinase; beta 93.51
2pm7_B297 Protein transport protein SEC13, protein transport 93.35
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 92.86
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 92.75
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.38
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.34
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.04
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 89.76
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 89.38
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 89.03
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 88.45
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 88.15
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 87.83
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 87.14
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 85.03
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 83.82
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 83.46
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 83.32
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 81.38
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
Probab=100.00  E-value=9.9e-42  Score=274.39  Aligned_cols=222  Identities=31%  Similarity=0.622  Sum_probs=200.3

Q ss_pred             eEEEEEeCCCCEEEEEEcCCCCcEEEEEcCCCce-eEEEeCCCCCccEEEEeecCCeEEEEeCCCCeEEEEeCCCCCCEE
Q psy5751           2 LIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNV-EDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKV   80 (232)
Q Consensus         2 ~~~i~~d~~~~~ly~~d~~~~~~i~~~~~~g~~~-~~~~~~~~~~p~gl~~d~~~~~ly~~d~~~~~I~~~~~~g~~~~~   80 (232)
                      |++++||+.++.|||+|...+ +|+++.++|... +.++..++..|.||++||.+++|||+|...++|.+++++|...+.
T Consensus        37 ~~~ld~d~~~~~lyw~D~~~~-~I~r~~~~g~~~~~~~~~~~l~~p~glavd~~~g~ly~~d~~~~~I~~~~~dG~~~~~  115 (318)
T 3sov_A           37 AAAVDFVFSHGLIYWSDVSEE-AIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKV  115 (318)
T ss_dssp             EEEEEEEGGGTEEEEEETTTT-EEEEEETTSSSCCCEEEEECCSCCCEEEEETTTTEEEEEETTTTEEEEEETTSCSCEE
T ss_pred             cEEEEEEeCCCEEEEEECCCC-cEEEEEccCCCceEEEEcCCCCCccEEEEEcCCCeEEEEECCCCEEEEEECCCCcEEE
Confidence            679999999999999999999 999999998753 456666788999999999999999999999999999999999888


Q ss_pred             EEeCCCCCceEEEEeCCCCeEEEEEcCCCCCcEEEEeCCCCCcEEEEEcCCCCCcceEEEeCCCCEEEEEECCCCcEEEE
Q psy5751          81 IVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECM  160 (232)
Q Consensus        81 ~~~~~~~~p~~iavd~~~~~ly~~d~~~~~~~I~~~~~~g~~~~~~~~~~~~~~p~~l~~d~~~~~Ly~~d~~~~~i~~~  160 (232)
                      +....+..|+++++||.+|.|||+|++ ..++|++++++|...+.++... +..|+||++|+.+++|||+|...++|+++
T Consensus       116 l~~~~~~~P~giavdp~~g~ly~td~~-~~~~I~r~~~dG~~~~~~~~~~-l~~Pnglavd~~~~~lY~aD~~~~~I~~~  193 (318)
T 3sov_A          116 LFWQELDQPRAIALDPSSGFMYWTDWG-EVPKIERAGMDGSSRFIIINSE-IYWPNGLTLDYEEQKLYWADAKLNFIHKS  193 (318)
T ss_dssp             EECSSCSSEEEEEEEGGGTEEEEEECS-SSCEEEEEETTSCSCEEEECSS-CSCEEEEEEETTTTEEEEEETTTTEEEEE
T ss_pred             EEeCCCCCccEEEEeCCCCEEEEEecC-CCCEEEEEEcCCCCeEEEEECC-CCCccEEEEeccCCEEEEEECCCCEEEEE
Confidence            887789999999999989999999986 3578999999999988888766 89999999999889999999999999999


Q ss_pred             ecCCCceEEEec-CCCceEEEEEECCEEEEEeCCCCcEEEEeCC-CCCcceEEeccCCcceeEEEEEEcCC
Q psy5751         161 TIRNRVRRKVYS-NCTYPFGLSITDEKYYWTDWKTNRIESANKE-GERAPSIALDMMGTTYMYGIAAVPSS  229 (232)
Q Consensus       161 ~~~g~~~~~~~~-~~~~p~gla~~~~~ly~td~~~~~i~~~~~~-g~~~~~i~~~~~~~~~p~gi~~~~~~  229 (232)
                      +++|..++++.+ .+.+|+|++++++.+||+|+.+++|.++++. |+..+.+..   ....|++|++++++
T Consensus       194 d~dG~~~~~~~~~~~~~P~glav~~~~lywtd~~~~~V~~~~~~~G~~~~~i~~---~~~~P~~i~v~~~~  261 (318)
T 3sov_A          194 NLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHS---DIFSPMDIHAFSQQ  261 (318)
T ss_dssp             ETTSCSCEEEECSCCSCEEEEEEETTEEEEEETTTTEEEEEETTTCCSCEEEEC---CCSSCCCEEEECGG
T ss_pred             cCCCCceEEEecCCCCCceEEEEeCCEEEEEecCCCeEEEEECCCCCceEEEeC---CCCCCcEEEEeccc
Confidence            999998888876 7899999999999999999999999999995 777776653   34689999998764



>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 6e-48
d1npea_263 b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId 3e-21
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 4e-35
d1ijqa1266 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) 2e-24
d2dg1a1319 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus 0.003
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Nidogen
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  156 bits (396), Expect = 6e-48
 Identities = 88/228 (38%), Positives = 127/228 (55%), Gaps = 3/228 (1%)

Query: 3   IGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTD 62
           IG+  DCV+  VY++ +++ S I RA L G     +I  ++ SPEG+  D + R ++WTD
Sbjct: 39  IGLAFDCVDKVVYWTDISEPS-IGRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFWTD 97

Query: 63  SQMDTISMANLNDDQPKVIVSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTD 122
           SQ+D I +A ++  Q +V+    LVNPRGIV  P    L+W+DWNR  PKIE S++DGT+
Sbjct: 98  SQLDRIEVAKMDGTQRRVLFDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDGTN 157

Query: 123 REIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMTIRNRVRRKVYSNCTYPFGLSI 182
           R I  +     LPN L  D  + +LCWVDA +   EC+      RRKV     YPF ++ 
Sbjct: 158 RRILAQDNL-GLPNGLTFDAFSSQLCWVDAGTHRAECLNPAQPGRRKVLEGLQYPFAVTS 216

Query: 183 TDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSC 230
             +  Y+TDWKTN + + +    +           T +YGI    S C
Sbjct: 217 YGKNLYYTDWKTNSVIAMDLAISKEMDT-FHPHKQTRLYGITIALSQC 263


>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Length = 319 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 100.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.94
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.94
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.93
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.91
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.89
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.89
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.84
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.84
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.82
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.82
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.71
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.53
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.51
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.51
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.36
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.33
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.3
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 99.11
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 99.1
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.01
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.92
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.82
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 98.81
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.78
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.77
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.7
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.65
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.63
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.53
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.49
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.48
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.43
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.37
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.33
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.33
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 98.32
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.27
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.13
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.1
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.02
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.99
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 97.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 97.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.93
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.79
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.53
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.46
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 97.18
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.16
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.14
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.11
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.71
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.54
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.49
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.32
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.02
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 95.72
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.44
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.36
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 95.25
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 94.31
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 93.47
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 92.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 92.03
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 90.85
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 90.38
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 86.07
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 81.68
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.47
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 80.34
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: YWTD domain
family: YWTD domain
domain: Nidogen
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=4.7e-47  Score=295.63  Aligned_cols=226  Identities=39%  Similarity=0.771  Sum_probs=207.8

Q ss_pred             eEEEEEeCCCCEEEEEEcCCCCcEEEEEcCCCceeEEEeCCCCCccEEEEeecCCeEEEEeCCCCeEEEEeCCCCCCEEE
Q psy5751           2 LIGITVDCVEGQVYYSSVADKSSIKRAHLDGKNVEDVITTNIRSPEGLTFDWVNRVLYWTDSQMDTISMANLNDDQPKVI   81 (232)
Q Consensus         2 ~~~i~~d~~~~~ly~~d~~~~~~i~~~~~~g~~~~~~~~~~~~~p~gl~~d~~~~~ly~~d~~~~~I~~~~~~g~~~~~~   81 (232)
                      +++++||+.+++|||+|...+ +|+++.++|+..+.++..++..|.+||+||.+++|||+|...++|.+++++|..++++
T Consensus        38 ~~~ld~D~~~~~iywsd~~~~-~I~~~~l~g~~~~~v~~~~~~~p~~iAvD~~~~~lY~~d~~~~~I~~~~~dg~~~~~l  116 (263)
T d1npea_          38 IIGLAFDCVDKVVYWTDISEP-SIGRASLHGGEPTTIIRQDLGSPEGIALDHLGRTIFWTDSQLDRIEVAKMDGTQRRVL  116 (263)
T ss_dssp             EEEEEEETTTTEEEEEETTTT-EEEEEESSSCCCEEEECTTCCCEEEEEEETTTTEEEEEETTTTEEEEEETTSCSCEEE
T ss_pred             EEEEEEEeCCCEEEEEECCCC-eEEEEEcccCCcEEEEEeccccccEEEEeccCCeEEEeccCCCEEEEEecCCceEEEE
Confidence            568999999999999999999 9999999999887888778889999999999999999999999999999999999888


Q ss_pred             EeCCCCCceEEEEeCCCCeEEEEEcCCCCCcEEEEeCCCCCcEEEEEcCCCCCcceEEEeCCCCEEEEEECCCCcEEEEe
Q psy5751          82 VSKDLVNPRGIVVHPYYRKLFWSDWNRSGPKIEWSNLDGTDREIFLKAADLKLPNSLAVDFRTDELCWVDADSKSLECMT  161 (232)
Q Consensus        82 ~~~~~~~p~~iavd~~~~~ly~~d~~~~~~~I~~~~~~g~~~~~~~~~~~~~~p~~l~~d~~~~~Ly~~d~~~~~i~~~~  161 (232)
                      ....+..|.++++||.+|.|||++++...++|++++++|...+.++... +..|+||++|+.+++|||+|...++|.+++
T Consensus       117 ~~~~l~~p~~l~vdp~~g~ly~t~~~~~~~~I~r~~~dG~~~~~i~~~~-~~~P~glaiD~~~~~lYw~d~~~~~I~~~~  195 (263)
T d1npea_         117 FDTGLVNPRGIVTDPVRGNLYWTDWNRDNPKIETSHMDGTNRRILAQDN-LGLPNGLTFDAFSSQLCWVDAGTHRAECLN  195 (263)
T ss_dssp             ECSSCSSEEEEEEETTTTEEEEEECCSSSCEEEEEETTSCCCEEEECTT-CSCEEEEEEETTTTEEEEEETTTTEEEEEE
T ss_pred             ecccccCCcEEEEecccCcEEEeecCCCCcEEEEecCCCCCceeeeeec-ccccceEEEeecCcEEEEEeCCCCEEEEEE
Confidence            8878899999999999999999999876778999999999999888766 899999999999999999999999999999


Q ss_pred             cCCCceEEEecCCCceEEEEEECCEEEEEeCCCCcEEEEeCCCCCcceEEeccCCcceeEEEEEEcCCC
Q psy5751         162 IRNRVRRKVYSNCTYPFGLSITDEKYYWTDWKTNRIESANKEGERAPSIALDMMGTTYMYGIAAVPSSC  230 (232)
Q Consensus       162 ~~g~~~~~~~~~~~~p~gla~~~~~ly~td~~~~~i~~~~~~g~~~~~i~~~~~~~~~p~gi~~~~~~~  230 (232)
                      ++|..++.+...+++|.||++++++|||||+.+++|.++++.+.....+..+.. ..+|+||+|.++||
T Consensus       196 ~~g~~~~~v~~~~~~P~~lav~~~~lYwtd~~~~~I~~~~~~~g~~~~~~~~~~-~~~~~gi~v~~~~~  263 (263)
T d1npea_         196 PAQPGRRKVLEGLQYPFAVTSYGKNLYYTDWKTNSVIAMDLAISKEMDTFHPHK-QTRLYGITIALSQC  263 (263)
T ss_dssp             TTEEEEEEEEECCCSEEEEEEETTEEEEEETTTTEEEEEETTTTEEEEEECCSS-CCCCCCEEEECSCC
T ss_pred             CCCCCeEEEECCCCCcEEEEEECCEEEEEECCCCEEEEEECCCCccceEECCCC-CCCcceEEEeCCCC
Confidence            999999999899999999999999999999999999999998655554554433 44799999999999



>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure