Psyllid ID: psy5772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650----
MTLGPLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCDTESESSLNVSNKSDKILNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGNSSTPGATSNSDSMSDPGSDLHLRFIDEPLYQFYNACIAELQFNEGSVENGYEEIGSSPMRTSMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLHPVAG
ccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccccEEEccccHHHHHHccccccccEEEEEEcccEEEEEEEcccccEEEEEcccccccEEEEEcccccccccccEEEEEEcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccEEEccccccHHHccccccccccEEEEEcccEEEccc
cccccccccccccccHcccccHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccHHHHHcccEEEEcccccccccccccccccccEEEEEEEccEEEEEEccccccEEEEEccccccEEEEEcccccccccccEEEEEEEccccccEEEEEEEcccHHHHHHHHHHcccccccccccHHcccccccccccccEEEEEccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHccccccccccccccccccccccEccccccccccHHHcHHHHccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHcccHHcccccHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEccccEccccHHHHHcccEEEEcccccccccccccccccccEEEEEEEccEEEEEc
mtlgplwfplesdpvcqslslhsflmlpmqrvtrlplLFDAILtrlrpnhseyetcHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSlkevkclpvisssrwlvrsgsmnfvnvdsKMTFARKLNKTHFYAKLNLFLFTDLLVITkkksngsysVIDYCTRAMMQMAAIedsvpptnKYLILLTILENHEQKTVEIVLSCdtesesslnvsnksdkilnspswysdcslfdptanvpafvdsgtypvqenpKIVAVFLLEGIhqikhlppqgsaywdnlwdsgnsstpgatsnsdsmsdpgsdlhlrfidEPLYQFYNACIAELqfnegsvengyeeigsspmrtsmleiiapphmnrslwcqlpevidsgvldtLDAGERKLQEAKFELITSEASYFKSLTVLEKHfiaspllddvnilskndrkhlfGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTelesdpvcqslslhsflmlpmqrvtrlplLFDAILtrlrpnhseyetcHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSlkevkclpvisssrwlvrsgsmnfvnvdsKMTFARKLNKTHFYAKLNLFLftdlhpvag
mtlgplwfplesdPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLpvisssrwlvrsgsMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVItkkksngsySVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCDtesesslnvsnksdkilNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGNSSTPGATSNSDSMSDPGSDLHLRFIDEPLYQFYNACIAELQFNEGSVENGYEEIGSSPMRTSMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLpvisssrwlvrsgsMNFVNVDSKMTFARKLNKTHFYAKLNLflftdlhpvag
MTLGPLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCDTESESSLNVSNKSDKILNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGNSSTPGATSNSDSMSDPGSDLHLRFIDEPLYQFYNACIAELQFNEGSVENGYEEIGSSPMRTSMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLHPVAG
****PLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCD****************LNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLW***********************LHLRFIDEPLYQFYNACIAELQFNEGSVENGYE*********SMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLH****
*TLGPLWFPLES*****SLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEE*R**ERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDS**********THFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAM****************LILLTILENHEQKTVEIVLSCDTESESSLNVSNKSDKILNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGNS**************PGSDLHLRFIDEPLY******************************************************************RKLQEAKFELITSEASYFKSLTVLEKHFIA**************RKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESD****SLSLHSFLMLPMQRVTRLPLLFDAILT******SEYETCHTTLATLNKIVHECNE*****ERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNF****************HFYAKLNLFLFTDLHPVAG
MTLGPLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCD***********KSDKILNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGN****************GSDLHLRFIDEPLYQFYNACIAELQFNEGSVENGYEEIGSSPMRTSMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLHPVAG
*TLGPLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCDTESESSLNVSNKSDK****PSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQI*****************************************RFIDEPLYQFYNACIAE**********************************RSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDS*MTFARKLNKTHFYAKLNLFLFTDLHPVAG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLGPLWFPLESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLLVITKKKSNGSYSVIDYCTRAMMQMAAIEDSVPPTNKYLILLTILENHEQKTVEIVLSCDTESESSLNVSNKSDKILNSPSWYSDCSLFDPTANVPAFVDSGTYPVQENPKIVAVFLLEGIHQIKHLPPQGSAYWDNLWDSGNSSTPGATSNSDSMSDPGSDLHLRFIDEPLYQFYNACIAELQFNEGSVENGYEEIGSSPMRTSMLEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLHPVAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query654 2.2.26 [Sep-21-2011]
Q96DR7 871 Rho guanine nucleotide ex yes N/A 0.420 0.315 0.416 2e-53
Q5BKC9 701 Ephexin-1 OS=Rattus norve no N/A 0.478 0.446 0.383 5e-53
Q8CHT1 710 Ephexin-1 OS=Mus musculus no N/A 0.454 0.418 0.392 5e-52
Q5VV41 709 Rho guanine nucleotide ex no N/A 0.415 0.383 0.406 4e-51
Q8N5V2 710 Ephexin-1 OS=Homo sapiens no N/A 0.452 0.416 0.390 2e-50
Q3U5C8 713 Rho guanine nucleotide ex no N/A 0.415 0.381 0.399 3e-50
Q5RDX5 709 Ephexin-1 OS=Pongo abelii yes N/A 0.435 0.401 0.394 8e-50
Q12774 1597 Rho guanine nucleotide ex no N/A 0.418 0.171 0.397 2e-47
Q8BWA8 802 Rho guanine nucleotide ex no N/A 0.484 0.395 0.375 3e-47
Q8IW93 802 Rho guanine nucleotide ex no N/A 0.376 0.306 0.421 1e-45
>sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 Back     alignment and function desciption
 Score =  211 bits (537), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 173/286 (60%), Gaps = 11/286 (3%)

Query: 364 RSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDV 423
           RS W QL  V   G+  T+   ERK QEA FE+I+SE SY  SL +L + F  S  L D 
Sbjct: 415 RSTWSQLSAVKRKGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDT 474

Query: 424 NILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIK 483
             ++K +R HLF N+T V + S++    LE   Q++I + +I +IV +H T  +F+ Y+K
Sbjct: 475 --MTKTERHHLFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKH-TASTFDPYVK 531

Query: 484 YCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDA 543
           YC+N+ +  RTL+ L  TNP F E L+ +ES   C++L + SFL+LPMQRVTRLPLL D 
Sbjct: 532 YCTNEVYQQRTLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDT 591

Query: 544 ILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLP 603
           I  +   +  +YE C   L  ++K+V  CNE ARKMER   M  ++  ++F   ++K  P
Sbjct: 592 ICQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEF---KIKPFP 648

Query: 604 VISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDL 649
           ++SSSRWLV+ G +    V+  + F+R+ +K   Y     FLF D+
Sbjct: 649 LVSSSRWLVKRGELT-AYVEDTVLFSRRTSKQQVY----FFLFNDV 689
Activates RhoG GTPase by promoting the exchange of GDP by GTP. Required for the formation of membrane ruffles during macropinocytosis. Required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB, which induces cytoskeleton rearrangements and promotes bacterial entry.
Homo sapiens (taxid: 9606)
>sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 Back     alignment and function description
>sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 Back     alignment and function description
>sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 Back     alignment and function description
>sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=2 SV=2 Back     alignment and function description
>sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 Back     alignment and function description
>sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 Back     alignment and function description
>sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 Back     alignment and function description
>sp|Q8BWA8|ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus GN=Arhgef19 PE=1 SV=1 Back     alignment and function description
>sp|Q8IW93|ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens GN=ARHGEF19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
328714644 1514 PREDICTED: hypothetical protein LOC10016 0.550 0.237 0.596 1e-111
270013299 1480 hypothetical protein TcasGA2_TC011886 [T 0.548 0.242 0.462 8e-87
189241164 1545 PREDICTED: similar to guanine nucleotide 0.548 0.232 0.462 8e-87
321476721495 hypothetical protein DAPPUDRAFT_43086 [D 0.434 0.573 0.533 2e-83
242023295 1020 guanine nucleotide exchange factor, puta 0.484 0.310 0.465 7e-82
157118595 867 guanine nucleotide exchange factor [Aede 0.509 0.384 0.436 8e-74
170065517 1017 guanine nucleotide exchange factor [Cule 0.608 0.391 0.372 2e-73
240973852 1373 guanine nucleotide exchange factor, puta 0.489 0.233 0.461 3e-73
194750560 1049 GF23948 [Drosophila ananassae] gi|190624 0.651 0.406 0.366 3e-72
195169850 1074 GL20865 [Drosophila persimilis] gi|19410 0.515 0.313 0.417 6e-71
>gi|328714644|ref|XP_001945953.2| PREDICTED: hypothetical protein LOC100168852 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  410 bits (1054), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 226/379 (59%), Positives = 280/379 (73%), Gaps = 19/379 (5%)

Query: 289  GNSSTPGAT-SNSDSMSDPGSDLHLRFIDEPLYQFYNACIAELQ---FNEGSVEN--GYE 342
            GNS    +T S S++ S+ GSDL++RF DEPLYQFY A I+E     F    +E+  GYE
Sbjct: 951  GNSLDKSSTESASENGSNQGSDLYMRFADEPLYQFYAADISERTKSVFAGDMMEDCDGYE 1010

Query: 343  EIGSSPMRTSMLEIIAP----PHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELIT 398
            EI S   R S LE+I P       +RSLWC++PEV +SG++D+L   ERKLQEAKFELIT
Sbjct: 1011 EISSITSRPSALELITPCTSGHGQHRSLWCEVPEVKNSGIIDSLTPRERKLQEAKFELIT 1070

Query: 399  SEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQD 458
            SEASYFKSLT+LEKHFI S  ++D  ILSK D+K LFGNV  VRKCSE+LLAALE+CWQD
Sbjct: 1071 SEASYFKSLTILEKHFINSHSMNDDTILSKKDQKILFGNVNPVRKCSEKLLAALEKCWQD 1130

Query: 459  SILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVC 518
            +ILL+ + EI+Y H + ++F+I++KYCSNQ +IDRTLK LRE N KF EAL  LESDP C
Sbjct: 1131 NILLSGLSEILYTH-SKENFDIFVKYCSNQIYIDRTLKCLRE-NQKFNEALQRLESDPKC 1188

Query: 519  QSLSLHSFLMLPMQRVTRLPLLFDAILTRL--RPNHSEYETCHTTLATLNKIVHECNEEA 576
            QSLSLHSFLMLPMQR+TRLPLL DAIL+++  + N  EY+ C  TLA+LN IV  CNE  
Sbjct: 1189 QSLSLHSFLMLPMQRITRLPLLVDAILSQMDSKENSLEYQMCELTLASLNAIVQNCNEST 1248

Query: 577  RKMERYYEMLLLSRLIKF-SLKEVKCLPVISSSRWLVRSGSMNFVNV-DSKMTFARKLNK 634
            RK+ERY EMLLLS+ ++F S KE+K + V SSSRWLVRSGSM  + V D K+TF+RK+ +
Sbjct: 1249 RKLERYEEMLLLSQQLEFSSKKEMKAMSVASSSRWLVRSGSMLHLTVPDGKLTFSRKMIR 1308

Query: 635  THFYAKLNLFLFTDLHPVA 653
                 KL  FLF D+  +A
Sbjct: 1309 P---TKLYFFLFNDMFFIA 1324

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270013299|gb|EFA09747.1| hypothetical protein TcasGA2_TC011886 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189241164|ref|XP_974773.2| PREDICTED: similar to guanine nucleotide exchange factor [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321476721|gb|EFX87681.1| hypothetical protein DAPPUDRAFT_43086 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242023295|ref|XP_002432070.1| guanine nucleotide exchange factor, putative [Pediculus humanus corporis] gi|212517437|gb|EEB19332.1| guanine nucleotide exchange factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157118595|ref|XP_001659169.1| guanine nucleotide exchange factor [Aedes aegypti] gi|108883231|gb|EAT47456.1| AAEL001398-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|170065517|ref|XP_001867972.1| guanine nucleotide exchange factor [Culex quinquefasciatus] gi|167862491|gb|EDS25874.1| guanine nucleotide exchange factor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|240973852|ref|XP_002401602.1| guanine nucleotide exchange factor, putative [Ixodes scapularis] gi|215491045|gb|EEC00686.1| guanine nucleotide exchange factor, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|194750560|ref|XP_001957598.1| GF23948 [Drosophila ananassae] gi|190624880|gb|EDV40404.1| GF23948 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195169850|ref|XP_002025727.1| GL20865 [Drosophila persimilis] gi|194109220|gb|EDW31263.1| GL20865 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query654
WB|WBGene00019487 1136 ephx-1 [Caenorhabditis elegans 0.429 0.247 0.460 1.1e-60
RGD|1309055 701 Ngef "neuronal guanine nucleot 0.470 0.439 0.398 9.9e-56
UNIPROTKB|F1PFV4 675 NGEF "Uncharacterized protein" 0.467 0.453 0.404 1.3e-55
MGI|MGI:1858414 710 Ngef "neuronal guanine nucleot 0.469 0.432 0.393 1.1e-54
UNIPROTKB|Q8N5V2 710 NGEF "Ephexin-1" [Homo sapiens 0.467 0.430 0.398 7.8e-54
UNIPROTKB|Q5RDX5 709 NGEF "Ephexin-1" [Pongo abelii 0.467 0.431 0.398 7.8e-54
UNIPROTKB|F1SM48 622 NGEF "Uncharacterized protein" 0.469 0.493 0.396 2.4e-53
UNIPROTKB|G3V856 616 Ngef "Neuronal guanine nucleot 0.470 0.5 0.398 4.9e-53
UNIPROTKB|F1MVZ8 581 NGEF "Uncharacterized protein" 0.463 0.521 0.401 1.7e-52
UNIPROTKB|F1NRN1 600 NGEF "Uncharacterized protein" 0.422 0.46 0.417 3.5e-52
WB|WBGene00019487 ephx-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 630 (226.8 bits), Expect = 1.1e-60, P = 1.1e-60
 Identities = 134/291 (46%), Positives = 191/291 (65%)

Query:   364 RSLWCQLPEVIDSGVLDTLDAGERKL-QEAKFELITSEASYFKSLTVLEKHFIASPLL-- 420
             RSLWC+LPEV  +G+L+ LD  E KL QEA FE+ITSEASY +SL VL  HF+ASP +  
Sbjct:   634 RSLWCELPEVRAAGLLEKLD-DECKLRQEAYFEVITSEASYLRSLNVLITHFMASPQMLG 692

Query:   421 --DDVNILSKNDRKHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSF 478
                 +++LS +DRKHLF N+ AVR CSERLL  LE   +++++L +IC+I+  H  +K F
Sbjct:   693 SKSALSVLSDSDRKHLFSNIFAVRDCSERLLCDLETRLEENLILDDICDILSDHF-DKHF 751

Query:   479 NIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLP 538
              +YIKYCSNQ + DRTL+ L+  NP F+ A+  LE +  CQ L + SFLMLPMQRVTR P
Sbjct:   752 EVYIKYCSNQVYQDRTLRRLKTENPGFLSAVQRLEENKQCQGLDMRSFLMLPMQRVTRYP 811

Query:   539 LLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKE 598
             LL  AIL R+      Y+T    L + N++V +CNE AR+MER  ++L + R + +   +
Sbjct:   812 LLLYAILDRITTTDDRYKTATDALTSSNRVVRDCNEGARRMERTEQLLDIDRRLIYKDAD 871

Query:   599 VKCLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDL 649
             +K +P++S+SR+LV+ G +  +         +   K      L++FLF+D+
Sbjct:   872 LKRIPLVSNSRYLVKKGVLTQLVERRSSNILQSRQKAR---TLHVFLFSDM 919
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0000003 "reproduction" evidence=IMP
RGD|1309055 Ngef "neuronal guanine nucleotide exchange factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFV4 NGEF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1858414 Ngef "neuronal guanine nucleotide exchange factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N5V2 NGEF "Ephexin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RDX5 NGEF "Ephexin-1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1SM48 NGEF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3V856 Ngef "Neuronal guanine nucleotide exchange factor (Predicted)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVZ8 NGEF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRN1 NGEF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 1e-43
cd01221130 cd01221, PH_ephexin, Ephexin Pleckstrin homology ( 3e-37
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 2e-36
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 4e-31
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 1e-13
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 1e-13
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 4e-10
cd01221130 cd01221, PH_ephexin, Ephexin Pleckstrin homology ( 1e-07
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 3e-07
>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information 
 Score =  154 bits (391), Expect = 1e-43
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 4/181 (2%)

Query: 394 FELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCSERLLAALE 453
            EL+ +E SY + L +L + F+    L +  ILS+ + K +F N+  + +  +  L  LE
Sbjct: 3   QELLQTERSYVRDLKILVEVFLKP--LRESPILSEEEIKTIFSNIEEILELHQEFLEELE 60

Query: 454 QCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELE 513
           +  ++   +  I +I  +      F +Y  YCSN       LK LR+ NP+F + L E E
Sbjct: 61  ERLEEWPDIQRIGDIFLKFAPF--FKVYSTYCSNYPRALELLKKLRKKNPRFAKFLKECE 118

Query: 514 SDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECN 573
           + P+C+ L L+SFL+ P+QR+ R PLL   +L    P+H +YE     L  + ++  + N
Sbjct: 119 ASPLCRGLDLNSFLIKPVQRIPRYPLLLKELLKHTPPDHPDYEDLKKALEAIKEVASQIN 178

Query: 574 E 574
           E
Sbjct: 179 E 179

Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Also called Dbl-homologous (DH) domain. It appears that pfam00169 domains invariably occur C-terminal to RhoGEF/DH domains. Length = 179
>gnl|CDD|241256 cd01221, PH_ephexin, Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|241256 cd01221, PH_ephexin, Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 654
KOG3523|consensus 695 100.0
KOG3523|consensus695 100.0
KOG4424|consensus 623 100.0
KOG4305|consensus 1029 100.0
KOG3520|consensus 1167 100.0
KOG3521|consensus 846 100.0
KOG4424|consensus623 100.0
KOG2070|consensus 661 100.0
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.98
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.98
KOG3518|consensus 521 99.97
KOG2996|consensus 865 99.96
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 99.96
COG5422 1175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 99.94
KOG3522|consensus 925 99.9
KOG3520|consensus1167 99.9
KOG2996|consensus865 99.88
KOG3521|consensus846 99.87
KOG3519|consensus 756 99.87
KOG4305|consensus1029 99.84
KOG3518|consensus521 99.83
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 99.83
KOG4240|consensus 1025 99.78
KOG3531|consensus 1036 99.76
KOG0689|consensus 448 99.75
KOG3524|consensus 850 99.73
KOG0689|consensus448 99.62
KOG4240|consensus1025 99.61
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.55
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 99.55
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 99.54
COG54221175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 99.52
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 99.49
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 99.47
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.47
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 99.45
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.45
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 99.42
KOG3524|consensus850 99.4
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.37
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 99.32
KOG3531|consensus1036 99.3
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 99.24
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 99.21
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 99.15
KOG3522|consensus 925 99.11
KOG3519|consensus756 98.73
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 98.71
KOG4269|consensus 1112 98.59
KOG2070|consensus661 98.57
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 98.23
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 97.99
PF15411116 PH_10: Pleckstrin homology domain 97.99
KOG0931|consensus627 97.91
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 97.88
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 97.67
cd01229129 PH_etc2 Epithelial cell transforming 2 (ECT2) plec 97.29
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.18
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 97.15
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 97.06
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 97.03
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 96.99
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 96.9
KOG4269|consensus1112 96.89
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 96.83
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 96.69
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 96.62
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 96.57
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 96.44
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 96.4
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 96.32
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 96.05
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 96.0
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 95.93
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 95.78
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 95.75
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 95.54
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 95.51
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 95.37
KOG0931|consensus 627 94.97
KOG0930|consensus395 94.63
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 93.53
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 93.49
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 92.98
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 92.67
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 91.66
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 91.6
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 91.19
KOG1729|consensus288 90.39
KOG0690|consensus516 90.16
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 90.08
PF1540989 PH_8: Pleckstrin homology domain 87.79
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 87.28
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 86.79
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 86.69
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 85.11
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 80.14
>KOG3523|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-63  Score=514.38  Aligned_cols=291  Identities=47%  Similarity=0.778  Sum_probs=273.9

Q ss_pred             ccccCCCCCCCcccccCccccChhhhccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCCCCcCCCCChhhhhh
Q psy5772         354 LEIIAPPHMNRSLWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKH  433 (654)
Q Consensus       354 ~~~~~~~~~~~~~w~~~p~v~~~~~~~~l~~~~~krq~~i~ELi~TE~~Yv~~L~~l~~~f~~~~~l~~~~~l~~~~~~~  433 (654)
                      +..+++..+..++|+++|+|+.+|++++|+++++|+|+++||+|++|++|+++|++++++|+.+..+  ..+|++.|.++
T Consensus       223 ~~~~~~~gs~~sLWqelP~Vr~sglL~tls~eerklQEa~FEviTSEaSYl~SLnllv~hF~~s~~l--~~~Ls~~d~~~  300 (695)
T KOG3523|consen  223 PTGLSNPGSRRSLWQELPEVRASGLLETLSPEERKLQEAKFEVITSEASYLRSLNLLVDHFMNSKEL--RSTLSASDRHH  300 (695)
T ss_pred             cccCCCCCcccchhhhhHHHHhcccccccCHHHHHHHhhhheeehhhHHHHHHHHHHHHHHhhhHHH--HHhcChHHHHH
Confidence            3445667789999999999999999999999999999999999999999999999999999997666  88999999999


Q ss_pred             hcCCHHHHHHHHHHHHHHHHHHHhcCcccccHHHHHHHhcccchhhhHHHhhhcHHHHHHHHHHHHhcChhHHHHHHHHh
Q psy5772         434 LFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELE  513 (654)
Q Consensus       434 lF~ni~~I~~~h~~fl~~Le~~~~~~~~~~~i~~if~~~~~~~~~~~Y~~Y~~n~~~~~~~l~~~~~~~~~f~~~l~~~~  513 (654)
                      ||+||.++.+++++||.+|+.++++++.+.+||||+.+|++ .+|.+|+.||+|+.++.+++++++.+|+.|.+.+.+++
T Consensus       301 LFSni~~V~~~Serfl~dLE~r~e~ni~i~dicDiv~~ha~-~~f~vYv~Y~tNQ~YQeRT~qrL~~~n~~F~e~l~rLE  379 (695)
T KOG3523|consen  301 LFSNIQDVREVSERFLCDLEARLEENIFIDDICDIVEDHAA-KHFSVYVKYCTNQVYQERTLQRLLTENPAFREVLERLE  379 (695)
T ss_pred             HHhhhHHHHHHHHHHHHHHHHHHHhCchhhHHHHHHHHhcc-cccceeehhccchHHHHHHHHHHHhcChHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999 99999999999999999999999999999999999999


Q ss_pred             cCCCCCCcCchhhhcccchhhccHHHHHHHHHHhCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Q psy5772         514 SDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIK  593 (654)
Q Consensus       514 ~~~~~~~l~L~s~Li~PvQRi~rY~lLL~~llk~t~~~~~d~~~l~~al~~i~~l~~~~n~~~~~~e~~~~l~~l~~~i~  593 (654)
                      .+|.|++++|.||||+||||||||||||++|++.|++++++|+.+++|+.++++++..||+++++|+++++|+.|.++|+
T Consensus       380 ~~p~C~~Lpl~SFLiLPmQRITRL~LLl~nIl~rt~~~ser~~~a~~Al~av~klVr~CNe~a~rMertEeli~i~~~le  459 (695)
T KOG3523|consen  380 SSPKCQGLPLRSFLILPMQRITRLPLLLDNILKRTEEGSERYETATKALKAVSKLVRDCNEGARRMERTEELIRISRQLE  459 (695)
T ss_pred             cCccccCCCchhhhhchHHHHHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccccCCceEEEEeeeEEEecc-ccchhhcccccccccceEEEEecCCeeecc
Q psy5772         594 FSLKEVKCLPVISSSRWLVRSGSMNFVNVD-SKMTFARKLNKTHFYAKLNLFLFTDLHPVA  653 (654)
Q Consensus       594 ~~~~~~~~~~l~~~~R~Li~~G~l~~~~~~-~~~~~~~k~~~~~~~~~~~lfLFnD~Llit  653 (654)
                      |++  +|.+||++.+|||+++|+|+.+... ++..+..|...+    ++|+|||||+||||
T Consensus       460 F~k--vK~~PLiS~sRwLvk~GELt~l~~~~~s~~l~~k~~~~----~vylfLFnD~Llit  514 (695)
T KOG3523|consen  460 FKK--VKAFPLVSQSRWLVKRGELTQLVERRASPLLFSKRLSK----TVYLFLFNDLLLIT  514 (695)
T ss_pred             ccc--cceeeeccchhhhhhccccceeecccccchhhcccccc----eeeeeeecceeeEe
Confidence            964  9999999999999999999888622 233333444444    99999999999998

>KOG3523|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>KOG4269|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>PF15411 PH_10: Pleckstrin homology domain Back     alignment and domain information
>KOG0931|consensus Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01229 PH_etc2 Epithelial cell transforming 2 (ECT2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4269|consensus Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0931|consensus Back     alignment and domain information
>KOG0930|consensus Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1729|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
3gf9_A295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 2e-16
1ki1_B352 Guanine Nucleotide Exchange Region Of Intersectin I 4e-16
3jv3_A283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 8e-16
3jzy_A 510 Crystal Structure Of Human Intersectin 2 C2 Domain 3e-15
3qbv_B351 Structure Of Designed Orthogonal Interaction Betwee 6e-15
3odw_A536 Crystal Structure Of The Linker-DhPH DOMAINS OF P11 1e-11
2pz1_A466 Crystal Structure Of Auto-Inhibited Asef Length = 4 2e-09
3eo2_A231 Crystal Structure Of The Rhogef Domain Of Human Neu 2e-09
3t06_A418 Crystal Structure Of The DhPH FRAGMENT OF PDZRHOGEF 6e-09
2dx1_A482 Crystal Structure Of Rhogef Protein Asef Length = 4 6e-09
3kz1_A383 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 9e-09
3odx_A417 Crystal Structure Of An N-Terminally Truncated Link 1e-08
1xcg_A368 Crystal Structure Of Human Rhoa In Complex With DhP 1e-08
1txd_A385 Crystal Structure Of The Dh/ph Domains Of Leukemia- 2e-08
3p6a_A377 Crystal Structure Of The DhPH DOMAINS OF P115-Rhoge 2e-08
3odo_A375 Crystal Structure Of The DhPH DOMAINS OF P115-Rhoge 2e-08
2z0q_A352 Crystal Structure Of Dh-Ph Domain Of Rhogef3(Xpln) 7e-08
2dfk_A402 Crystal Structure Of The Cdc42-Collybistin Ii Compl 1e-07
1foe_A377 Crystal Structure Of Rac1 In Complex With The Guani 6e-05
1rj2_A353 Crystal Structure Of The DhPH FRAGMENT OF DBS WITHO 4e-04
1lb1_A353 Crystal Structure Of The Dbl And Pleckstrin Homolog 4e-04
1kzg_A353 Dbscdc42(Y889f) Length = 353 4e-04
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure 
Iteration: 1

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 106/217 (48%), Gaps = 12/217 (5%)
Query: 367 WCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNIL 426
           WC      D   LDT+   ERK Q    ELI +E  Y   L ++ + F     + +   L
Sbjct: 82  WC-----ADLQTLDTMQPIERKRQGYIHELIQTEERYMADLQLVVEVF--QKRMAESGFL 134
Query: 427 SKNDRKHLFGNVTAVRKCSERLLAAL---EQCWQDSILLTNICEIVYQHVTNKSFNIYIK 483
           ++ +   +F N   +   + +LL AL   ++   + + +  I +I+   +++     YI+
Sbjct: 135 TEGEMALIFVNWKELIMSNTKLLKALRVRKKTGGEKMPVQMIGDILAAELSH--MQAYIR 192
Query: 484 YCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDA 543
           +CS Q +    L+   + +  F E L +L SDP C+ + L SFL+ PMQR+TR PLL  +
Sbjct: 193 FCSCQLNGAALLQQKTDEDTDFKEFLKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRS 252
Query: 544 ILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKME 580
           IL     +H+++ +    L    ++  + NE  R+ E
Sbjct: 253 ILENTPESHADHSSLKLALERAEELCSQVNEGVREKE 289
>pdb|1KI1|B Chain B, Guanine Nucleotide Exchange Region Of Intersectin In Complex With Cdc42 Length = 352 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 Back     alignment and structure
>pdb|3QBV|B Chain B, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 351 Back     alignment and structure
>pdb|3ODW|A Chain A, Crystal Structure Of The Linker-DhPH DOMAINS OF P115-Rhogef Length = 536 Back     alignment and structure
>pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 Back     alignment and structure
>pdb|3EO2|A Chain A, Crystal Structure Of The Rhogef Domain Of Human Neuroepithelial Cell- Transforming Gene 1 Protein Length = 231 Back     alignment and structure
>pdb|3T06|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF PDZRHOGEF WITH N-Terminal Regulatory Elements In Complex With Human Rhoa Length = 418 Back     alignment and structure
>pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 Back     alignment and structure
>pdb|3KZ1|A Chain A, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 383 Back     alignment and structure
>pdb|3ODX|A Chain A, Crystal Structure Of An N-Terminally Truncated Linker-DhPH DOMAINS OF P115-Rhogef Length = 417 Back     alignment and structure
>pdb|1XCG|A Chain A, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 368 Back     alignment and structure
>pdb|1TXD|A Chain A, Crystal Structure Of The Dh/ph Domains Of Leukemia-associated Rhogef Length = 385 Back     alignment and structure
>pdb|3P6A|A Chain A, Crystal Structure Of The DhPH DOMAINS OF P115-Rhogef (R399e Mutant) Length = 377 Back     alignment and structure
>pdb|3ODO|A Chain A, Crystal Structure Of The DhPH DOMAINS OF P115-Rhogef Length = 375 Back     alignment and structure
>pdb|2Z0Q|A Chain A, Crystal Structure Of Dh-Ph Domain Of Rhogef3(Xpln) Length = 352 Back     alignment and structure
>pdb|2DFK|A Chain A, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 402 Back     alignment and structure
>pdb|1FOE|A Chain A, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 377 Back     alignment and structure
>pdb|1RJ2|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF DBS WITHOUT Bound Gtpase Length = 353 Back     alignment and structure
>pdb|1LB1|A Chain A, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 353 Back     alignment and structure
>pdb|1KZG|A Chain A, Dbscdc42(Y889f) Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query654
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-71
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 7e-33
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-67
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-31
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 9e-64
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 1e-29
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 9e-63
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 2e-28
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 2e-62
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 6e-29
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 7e-60
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 1e-26
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 2e-59
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 7e-29
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 5e-58
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 3e-18
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 4e-42
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 2e-20
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 6e-41
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 3e-23
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 3e-38
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 2e-19
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 1e-33
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 6e-18
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 1e-33
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 6e-18
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 4e-33
1foe_A377 T-lymphoma invasion and metastasis inducing protei 9e-17
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 3e-31
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 1e-08
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 9e-27
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 1e-10
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 1e-21
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 3e-12
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 8e-19
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 4e-08
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 3e-17
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 1e-13
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 7e-06
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
 Score =  233 bits (597), Expect = 4e-71
 Identities = 56/289 (19%), Positives = 117/289 (40%), Gaps = 25/289 (8%)

Query: 372 EVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDR 431
             +   V+  L   E   QE   EL  +EAS+ ++L VL+  F     +   N++ + + 
Sbjct: 5   HTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQR--MKKENLMPREEL 62

Query: 432 KHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKS----FNIYIKYCSN 487
             LF N+  + +       A+++  ++  ++  I +++       +      +  ++CS 
Sbjct: 63  ARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSY 122

Query: 488 QFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTR 547
           Q      +K+ +    +F   + E ES P C+ L L   ++  MQR+T+ PLL ++I+  
Sbjct: 123 QSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKH 182

Query: 548 LRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVKCLPVI-- 605
                SE+E          +I+   NE  ++ E  + +    + +  +  E    P+   
Sbjct: 183 TEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAE 242

Query: 606 -----SSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDL 649
                 ++R ++  G + +     K               L++ L  DL
Sbjct: 243 FKSLDLTTRKMIHEGPLTWRISKDKTL------------DLHVLLLEDL 279
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 100.0
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 100.0
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 100.0
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 100.0
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 100.0
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 100.0
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 100.0
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 100.0
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 100.0
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 100.0
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 100.0
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 100.0
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 100.0
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 100.0
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 100.0
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 100.0
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 100.0
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 100.0
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 100.0
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 100.0
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 99.98
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.97
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 99.97
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.97
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 99.97
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.97
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 99.97
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 99.97
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 99.97
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 99.96
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 99.96
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 99.96
1foe_A377 T-lymphoma invasion and metastasis inducing protei 99.96
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 99.95
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 99.95
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.94
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 99.93
3ksy_A1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.92
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 99.76
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.7
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 99.63
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 99.48
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 99.47
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 99.27
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 99.16
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 98.82
4gou_A518 EHRGS-rhogef; RGS domain, DH domain, PH domain, RH 98.3
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 97.66
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 97.52
2d9y_A117 Pleckstrin homology domain-containing protein fami 97.49
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.42
2dkp_A128 Pleckstrin homology domain-containing family A mem 97.19
2yry_A122 Pleckstrin homology domain-containing family A mem 97.18
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 97.17
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 97.06
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 97.03
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 97.03
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 97.01
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 96.95
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 96.94
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 96.92
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 96.91
3rcp_A103 Pleckstrin homology domain-containing family A ME; 96.89
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 96.88
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 96.87
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 96.81
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 96.79
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 96.68
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 96.65
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 96.59
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 96.53
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 96.5
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 96.5
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 96.39
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 96.35
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 96.22
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 96.21
2d9v_A130 Pleckstrin homology domain-containing protein fami 96.2
1v5p_A126 Pleckstrin homology domain-containing, family A; T 96.02
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 95.98
1wi1_A126 Calcium-dependent activator protein for secretion, 95.97
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.95
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 95.94
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 95.91
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 95.91
1v88_A130 Oxysterol binding protein-related protein 8; vesic 95.87
3cxb_B112 Pleckstrin homology domain-containing family M mem 95.71
3aj4_A112 Pleckstrin homology domain-containing family B ME; 95.68
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 95.63
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 95.6
1u5e_A211 SRC-associated adaptor protein; novel dimerization 95.54
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 95.52
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 95.42
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 95.36
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 95.34
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 95.28
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 95.27
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 94.96
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 94.81
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 94.69
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 94.67
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 94.43
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 94.16
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 94.15
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 94.1
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 93.98
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 93.44
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 92.88
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 92.37
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 91.87
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 91.15
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 88.83
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 87.44
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 84.87
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 84.51
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 84.36
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-46  Score=395.94  Aligned_cols=271  Identities=21%  Similarity=0.329  Sum_probs=245.5

Q ss_pred             ccccCccccChhhhccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCCCCcCCCCChhhhhhhcCCHHHHHHHH
Q psy5772         366 LWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCS  445 (654)
Q Consensus       366 ~w~~~p~v~~~~~~~~l~~~~~krq~~i~ELi~TE~~Yv~~L~~l~~~f~~~~~l~~~~~l~~~~~~~lF~ni~~I~~~h  445 (654)
                      +|+++   +++++++++++++.||+++|+||++||++||++|+.+.++|+.  ||...+++++.++..||+|+++|+++|
T Consensus         2 ~W~~~---v~~~~~~~l~~~~~kR~~vi~ELi~TE~~Yv~~L~~l~~~f~~--~l~~~~~l~~~~~~~iF~ni~~i~~~h   76 (368)
T 1xcg_A            2 NWQHT---VGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQ--RMKKENLMPREELARLFPNLPELIEIH   76 (368)
T ss_dssp             CTTTS---SSSSSGGGSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHH--HHHHTTSSCHHHHHHHSSSHHHHHHHH
T ss_pred             Cchhh---cCHHHHhhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHhcCCCCHHHHHHHhCCHHHHHHHH
Confidence            68886   5788899999999999999999999999999999999999999  998888999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCcccccHHHHHHHhcc----cchhhhHHHhhhcHHHHHHHHHHHHhcChhHHHHHHHHhcCCCCCCc
Q psy5772         446 ERLLAALEQCWQDSILLTNICEIVYQHVT----NKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSL  521 (654)
Q Consensus       446 ~~fl~~Le~~~~~~~~~~~i~~if~~~~~----~~~~~~Y~~Y~~n~~~~~~~l~~~~~~~~~f~~~l~~~~~~~~~~~l  521 (654)
                      +.|+.+|+.+...++....||++|+.++.    ..++.+|..||.|++.+...++++.+.++.|..|+++++..+.|+++
T Consensus        77 ~~fl~~L~~~~~~~~~~~~ig~~f~~~~~~~~~~~~~~~Y~~Y~~~~~~a~~~l~~~~~~~~~f~~fl~~~~~~~~~~~l  156 (368)
T 1xcg_A           77 NSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRL  156 (368)
T ss_dssp             HHHHHHHHHHHHTCSSCCCCHHHHHHHHSHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHCHHHHHHHHHHHTSGGGTTC
T ss_pred             HHHHHHHHHHHhcCCCcCcHHHHHHHHccchhHHHHHHHHHHHHhhHHHHHHHHHHHHhCCHHHHHHHHHHHhChhhccC
Confidence            99999999999998888899999999863    14799999999999999999999988899999999999999999999


Q ss_pred             CchhhhcccchhhccHHHHHHHHHHhCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccccc-
Q psy5772         522 SLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIKFSLKEVK-  600 (654)
Q Consensus       522 ~L~s~Li~PvQRi~rY~lLL~~llk~t~~~~~d~~~l~~al~~i~~l~~~~n~~~~~~e~~~~l~~l~~~i~~~~~~~~-  600 (654)
                      +|.+||++|||||+||+|||++|+|+|+++|+|+..++.|++.++.++..||+.++++|+..++.+++++|++...+.. 
T Consensus       157 ~L~~~Li~PvQRi~rY~LLL~~llk~t~~~~~d~~~l~~A~~~~~~v~~~vN~~~~~~e~~~~l~~i~~~l~~~~~~~~~  236 (368)
T 1xcg_A          157 QLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERAS  236 (368)
T ss_dssp             CHHHHTTHHHHHHHHHHHHHHHHHHTSCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECHHHHSCS
T ss_pred             ChHHHhhhHhhhhhhHHHHHHHHHHhCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchhhhcc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999986420000 


Q ss_pred             ------ccccccCCceEEEEeeeEEEeccccchhhcccccccccceEEEEecCCeeecc
Q psy5772         601 ------CLPVISSSRWLVRSGSMNFVNVDSKMTFARKLNKTHFYAKLNLFLFTDLHPVA  653 (654)
Q Consensus       601 ------~~~l~~~~R~Li~~G~l~~~~~~~~~~~~~k~~~~~~~~~~~lfLFnD~Llit  653 (654)
                            -..+..++|+|+++|.|.+..        .+...+    ++|+|||||+||+|
T Consensus       237 ~pl~~~~~~l~~~~R~li~~G~l~~~~--------~~~~~~----~~~~fLF~d~Ll~~  283 (368)
T 1xcg_A          237 NPLAAEFKSLDLTTRKMIHEGPLTWRI--------SKDKTL----DLHVLLLEDLLVLL  283 (368)
T ss_dssp             CTTTGGGGGCCGGGSCEEEEEEEEECC--------SSSCCC----EEEEEEESSEEEEE
T ss_pred             cchhhhhhhcccccceEEeecceEeee--------cCCCee----EEEEEcccccHHHh
Confidence                  013556899999999998652        112233    89999999999998
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 654
d1xcga1228 a.87.1.1 (A:714-941) Rho guanine nucleotide exchan 9e-43
d1xcga1228 a.87.1.1 (A:714-941) Rho guanine nucleotide exchan 3e-13
d1txda1234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 1e-39
d1txda1234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 2e-11
d1ki1b1210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 5e-38
d1ki1b1210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 4e-12
d1by1a_209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 1e-34
d1by1a_209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 3e-12
d1dbha1207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 2e-33
d1dbha1207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 3e-08
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 4e-33
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 2e-11
d1foea1206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 5e-30
d1foea1206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 1e-10
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 9e-29
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 9e-08
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 4e-22
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 1e-07
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 1e-20
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 1e-06
d1ntya2121 b.55.1.1 (A:1415-1535) Triple functional domain pr 8e-05
d2dfka2162 b.55.1.1 (A:240-401) Rho guanine nucleotide exchan 2e-04
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure

class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  151 bits (383), Expect = 9e-43
 Identities = 47/225 (20%), Positives = 98/225 (43%), Gaps = 6/225 (2%)

Query: 372 EVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDR 431
             +   V+  L   E   QE   EL  +EAS+ ++L VL+  F     +   N++ + + 
Sbjct: 5   HTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQR--MKKENLMPREEL 62

Query: 432 KHLFGNVTAVRKCSERLLAALEQCWQDSILLTNICEIVYQHVTNKS----FNIYIKYCSN 487
             LF N+  + +       A+++  ++  ++  I +++       +      +  ++CS 
Sbjct: 63  ARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSY 122

Query: 488 QFHIDRTLKSLRETNPKFIEALTELESDPVCQSLSLHSFLMLPMQRVTRLPLLFDAILTR 547
           Q      +K+ +    +F   + E ES P C+ L L   ++  MQR+T+ PLL ++I+  
Sbjct: 123 QSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKH 182

Query: 548 LRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLI 592
                SE+E          +I+   NE  ++ E  + +    + +
Sbjct: 183 TEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRL 227
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query654
d1xcga1228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 100.0
d1txda1234 Rho guanine nucleotide exchange factor 12 {Human ( 100.0
d1ki1b1210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 100.0
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 100.0
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 100.0
d1by1a_209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1dbha1207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.97
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.97
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 99.96
d1xcga1228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 99.66
d1ki1b1210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 99.64
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 99.63
d1txda1234 Rho guanine nucleotide exchange factor 12 {Human ( 99.59
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 99.57
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.55
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 99.53
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 99.51
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 99.49
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 99.47
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.45
d1by1a_209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1dbha1207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 99.43
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.4
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 99.39
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 99.35
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 99.34
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 99.33
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 99.22
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 99.19
d2dfka2 162 Rho guanine nucleotide exchange factor 9, Collybis 98.13
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 97.93
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 97.9
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 97.57
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 97.54
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.53
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.53
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 97.36
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.35
d1foea2162 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 97.32
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 97.27
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 97.25
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 97.24
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 97.15
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 97.12
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.08
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 97.07
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 96.96
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 96.87
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 96.59
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 96.59
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 96.48
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 96.45
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 96.39
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 96.39
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.32
d1wi1a_126 Calcium-dependent activator protein for secretion, 96.27
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 96.09
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 96.01
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 96.0
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 95.95
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 95.94
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 95.87
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 95.78
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 95.64
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 95.63
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 95.51
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 95.18
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 94.61
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 94.56
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 94.48
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 92.87
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 91.95
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 84.62
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DBL homology domain (DH-domain)
superfamily: DBL homology domain (DH-domain)
family: DBL homology domain (DH-domain)
domain: Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-38  Score=314.79  Aligned_cols=223  Identities=22%  Similarity=0.355  Sum_probs=213.5

Q ss_pred             ccccCccccChhhhccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCCCCcCCCCChhhhhhhcCCHHHHHHHH
Q psy5772         366 LWCQLPEVIDSGVLDTLDAGERKLQEAKFELITSEASYFKSLTVLEKHFIASPLLDDVNILSKNDRKHLFGNVTAVRKCS  445 (654)
Q Consensus       366 ~w~~~p~v~~~~~~~~l~~~~~krq~~i~ELi~TE~~Yv~~L~~l~~~f~~~~~l~~~~~l~~~~~~~lF~ni~~I~~~h  445 (654)
                      .|+.+   ++++++++++++++|||++|+||++||++|+++|+++.+.|..  |+...+++++.++..||+|+++|+.+|
T Consensus         2 ~w~~~---~~~~~~~~~~~~e~kRq~vi~ELi~tE~~Yv~~L~~l~~~y~~--~l~~~~~l~~~~~~~lF~~i~~l~~~h   76 (228)
T d1xcga1           2 NWQHT---VGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQ--RMKKENLMPREELARLFPNLPELIEIH   76 (228)
T ss_dssp             CTTTS---SSSSSGGGSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHH--HHHHTTSSCHHHHHHHSSSHHHHHHHH
T ss_pred             Cchhh---cCHHHHhhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHhcCcCCHHHHHHHhhhHHHHHHHH
Confidence            58875   6778999999999999999999999999999999999999999  998889999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCcccccHHHHHHHhcc----cchhhhHHHhhhcHHHHHHHHHHHHhcChhHHHHHHHHhcCCCCCCc
Q psy5772         446 ERLLAALEQCWQDSILLTNICEIVYQHVT----NKSFNIYIKYCSNQFHIDRTLKSLRETNPKFIEALTELESDPVCQSL  521 (654)
Q Consensus       446 ~~fl~~Le~~~~~~~~~~~i~~if~~~~~----~~~~~~Y~~Y~~n~~~~~~~l~~~~~~~~~f~~~l~~~~~~~~~~~l  521 (654)
                      +.|+.+|+++..+|....+||++|+.+++    ..++.+|..||.++..+..++..+.+.++.|..|+++++..+.|+++
T Consensus        77 ~~fl~~L~~~~~~~~~~~~ig~~~~~~~~~~~~~~~~~~Y~~Y~~~~~~~~~~l~~~~~~~~~f~~~l~~~~~~~~~~~~  156 (228)
T d1xcga1          77 NSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRL  156 (228)
T ss_dssp             HHHHHHHHHHHHTCSSCCCCHHHHHHHHSHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHCHHHHHHHHHHHTSGGGTTC
T ss_pred             HHHHHHHHHHHhcCCccccHHHHHHHHhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhcCHHHHHHHHHHhcCcccccC
Confidence            99999999999999999999999999874    24789999999999999999999998899999999999999999999


Q ss_pred             CchhhhcccchhhccHHHHHHHHHHhCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Q psy5772         522 SLHSFLMLPMQRVTRLPLLFDAILTRLRPNHSEYETCHTTLATLNKIVHECNEEARKMERYYEMLLLSRLIK  593 (654)
Q Consensus       522 ~L~s~Li~PvQRi~rY~lLL~~llk~t~~~~~d~~~l~~al~~i~~l~~~~n~~~~~~e~~~~l~~l~~~i~  593 (654)
                      +|.+||++|+||++||++||++|+++||++|+|+..+..|+..+++++..||+.++.+++..++.+|+++|+
T Consensus       157 ~l~~~l~~P~qRl~rY~llL~~llk~t~~~~~d~~~l~~a~~~~~~~~~~in~~~~~~e~~~~l~~l~~~ld  228 (228)
T d1xcga1         157 QLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLD  228 (228)
T ss_dssp             CHHHHTTHHHHHHHHHHHHHHHHHHTSCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEE
T ss_pred             CHHHHHhhHHHHHhHHHHHHHHHHHhCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999875
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure