Psyllid ID: psy5801


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
cccccEEEEccccccEEEEEEEccccEEEEcccccHHHHccccccEEEEEEEEEcccccEEEEEcccccccEEEEEcccccEEEEEEEEccccccccEEEEEEEcccEEEEEcccccEEEEEcccccccEEEEEEccccccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHc
cccHHHHHHHcccccccEEEEEEccHEEEcccccccEEEEccEcHHHccEEEEcccccEEEEEEccccccEEEEEEccccEEEEEHEEEEEccccccccEEEEEEcccEEEccccccEEEEEEEEcHHHEEEEEEcccccEEEEEEEcccccEEEEEEcccccHHHHHHHHHHHcc
MFSAFvhktnkfnrcadraLLVTDFAVYKLDSGAKFKAMkrgmslqemtglsvspgsdqLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKtnkfnrcadraLLVTDFAVYKLDSGAKFKAMkrgmslqemtglsvspgsdqLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
mfsafvhktnkfnrcadralLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKtnkfnrcadrALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
****FVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKA*******************DQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKA*******************DQLVVIHNNKGNDLVFTIISSEDRVGELVGA******
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAK***********EMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
Q239781011 Myosin-IA OS=Drosophila m yes N/A 0.698 0.121 0.408 6e-21
Q5SUA51024 Unconventional myosin-Ig yes N/A 0.517 0.088 0.468 1e-16
Q5SYD01006 Unconventional myosin-Id no N/A 0.528 0.092 0.448 2e-16
O948321006 Unconventional myosin-Id yes N/A 0.528 0.092 0.448 2e-16
Q633571006 Unconventional myosin-Id yes N/A 0.528 0.092 0.448 2e-16
Q17R141006 Unconventional myosin-Id no N/A 0.528 0.092 0.448 3e-16
B0I1T21018 Unconventional myosin-Ig no N/A 0.517 0.089 0.468 3e-16
Q5ZMC21007 Unconventional myosin-Ig no N/A 0.505 0.088 0.425 4e-13
>sp|Q23978|MY31D_DROME Myosin-IA OS=Drosophila melanogaster GN=Myo31DF PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 56/137 (40%), Positives = 83/137 (60%), Gaps = 14/137 (10%)

Query: 46  QEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVT 105
           QE +G     GS + +  H   G            +V+FS+FV K N FN+ A+RA +V+
Sbjct: 827 QENSGYEAYNGSIKNIRNHPADGETF--------QQVLFSSFVKKFNHFNKQANRAFIVS 878

Query: 106 DFAVYKLDS-GAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISS---- 160
           D  ++KLD    KFK MKR + ++E+T +SVSPG DQL+V H++K  DLVF++ S     
Sbjct: 879 DSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGRDQLIVFHSSKNKDLVFSLESEYTPL 938

Query: 161 -EDRVGELVGALASRYY 176
            EDR+GE+VG +  +Y+
Sbjct: 939 KEDRIGEVVGIVCKKYH 955




Involved in directing the movement of organelles along actin filaments.
Drosophila melanogaster (taxid: 7227)
>sp|Q5SUA5|MYO1G_MOUSE Unconventional myosin-Ig OS=Mus musculus GN=Myo1g PE=2 SV=1 Back     alignment and function description
>sp|Q5SYD0|MYO1D_MOUSE Unconventional myosin-Id OS=Mus musculus GN=Myo1d PE=1 SV=1 Back     alignment and function description
>sp|O94832|MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens GN=MYO1D PE=1 SV=2 Back     alignment and function description
>sp|Q63357|MYO1D_RAT Unconventional myosin-Id OS=Rattus norvegicus GN=Myo1d PE=1 SV=3 Back     alignment and function description
>sp|Q17R14|MYO1D_BOVIN Unconventional myosin-Id OS=Bos taurus GN=MYO1D PE=2 SV=1 Back     alignment and function description
>sp|B0I1T2|MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens GN=MYO1G PE=1 SV=2 Back     alignment and function description
>sp|Q5ZMC2|MYO1G_CHICK Unconventional myosin-Ig OS=Gallus gallus GN=MYO1G PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
328710985 1014 PREDICTED: myosin-IA [Acyrthosiphon pisu 0.545 0.094 0.594 5e-30
307192537 1004 Myosin-IA [Harpegnathos saltator] 0.534 0.093 0.621 8e-30
322801520 975 hypothetical protein SINV_13577 [Solenop 0.534 0.096 0.631 1e-29
332019366 964 Myosin-IA [Acromyrmex echinatior] 0.534 0.097 0.621 1e-28
307174013 1017 Myosin-IA [Camponotus floridanus] 0.534 0.092 0.6 1e-27
66509418 1017 PREDICTED: myosin-IA [Apis mellifera] 0.528 0.091 0.595 1e-27
380025669 1017 PREDICTED: LOW QUALITY PROTEIN: myosin-I 0.528 0.091 0.585 2e-27
350417341 1015 PREDICTED: myosin-IA-like [Bombus impati 0.528 0.091 0.606 2e-27
340714335 1015 PREDICTED: myosin-IA-like [Bombus terres 0.528 0.091 0.606 2e-27
289191323 1019 myosin 1A [Nasonia vitripennis] 0.534 0.092 0.578 2e-26
>gi|328710985|ref|XP_001942634.2| PREDICTED: myosin-IA [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 86/101 (85%), Gaps = 5/101 (4%)

Query: 80  DRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGS 139
           ++V+FS+F+HKTN++N+CADRA+L+TD+A+YKLD    FK MK+GM +QE+TG+SVSPG 
Sbjct: 852 NQVLFSSFIHKTNRYNKCADRAILITDWAIYKLDI-TNFKPMKKGMPIQEVTGMSVSPGQ 910

Query: 140 DQLVVIHNNKGNDLVFTIISS----EDRVGELVGALASRYY 176
           DQLVVIH+N+GNDLV T+  +    EDR+GEL+G +++RY+
Sbjct: 911 DQLVVIHSNRGNDLVVTLKPTADINEDRIGELLGVISTRYF 951




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307192537|gb|EFN75725.1| Myosin-IA [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322801520|gb|EFZ22181.1| hypothetical protein SINV_13577 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332019366|gb|EGI59867.1| Myosin-IA [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307174013|gb|EFN64723.1| Myosin-IA [Camponotus floridanus] Back     alignment and taxonomy information
>gi|66509418|ref|XP_624678.1| PREDICTED: myosin-IA [Apis mellifera] Back     alignment and taxonomy information
>gi|380025669|ref|XP_003696591.1| PREDICTED: LOW QUALITY PROTEIN: myosin-IA-like [Apis florea] Back     alignment and taxonomy information
>gi|350417341|ref|XP_003491375.1| PREDICTED: myosin-IA-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714335|ref|XP_003395685.1| PREDICTED: myosin-IA-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|289191323|ref|NP_001166048.1| myosin 1A [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
FB|FBgn00863471011 Myo31DF "Myosin 31DF" [Drosoph 0.545 0.094 0.480 2.7e-19
UNIPROTKB|J9NYE5279 LOC100683071 "Uncharacterized 0.517 0.326 0.489 3.2e-17
UNIPROTKB|E1C459976 MYO1D "Uncharacterized protein 0.585 0.105 0.423 1.4e-15
UNIPROTKB|F1MFG91019 MYO1G "Uncharacterized protein 0.517 0.089 0.479 1.5e-15
UNIPROTKB|K7EIG7918 MYO1D "Unconventional myosin-I 0.528 0.101 0.448 2.1e-15
UNIPROTKB|F1RKW9954 MYO1D "Uncharacterized protein 0.528 0.097 0.448 2.2e-15
UNIPROTKB|J3QRN6961 MYO1D "Unconventional myosin-I 0.528 0.096 0.448 2.2e-15
UNIPROTKB|F1MJ561006 MYO1D "Unconventional myosin-I 0.528 0.092 0.448 2.4e-15
UNIPROTKB|Q17R141006 MYO1D "Unconventional myosin-I 0.528 0.092 0.448 2.4e-15
UNIPROTKB|F1PRN21006 MYO1D "Uncharacterized protein 0.528 0.092 0.448 2.4e-15
FB|FBgn0086347 Myo31DF "Myosin 31DF" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 2.7e-19, P = 2.7e-19
 Identities = 49/102 (48%), Positives = 73/102 (71%)

Query:    81 RVMFSAFVHKTNKFNRCADRALLVTDFAVYKLDS-GAKFKAMKRGMSLQEMTGLSVSPGS 139
             +V+FS+FV K N FN+ A+RA +V+D  ++KLD    KFK MKR + ++E+T +SVSPG 
Sbjct:   854 QVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIKIRELTSISVSPGR 913

Query:   140 DQLVVIHNNKGNDLVFTIISS-----EDRVGELVGALASRYY 176
             DQL+V H++K  DLVF++ S      EDR+GE+VG +  +Y+
Sbjct:   914 DQLIVFHSSKNKDLVFSLESEYTPLKEDRIGEVVGIVCKKYH 955


GO:0003779 "actin binding" evidence=NAS
GO:0016459 "myosin complex" evidence=IEA;ISS
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0005737 "cytoplasm" evidence=NAS
GO:0003774 "motor activity" evidence=IEA;NAS
GO:0007498 "mesoderm development" evidence=IEP
GO:0007368 "determination of left/right symmetry" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0048803 "imaginal disc-derived male genitalia morphogenesis" evidence=IMP
GO:0071907 "determination of digestive tract left/right asymmetry" evidence=IMP
GO:0005938 "cell cortex" evidence=IDA
UNIPROTKB|J9NYE5 LOC100683071 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C459 MYO1D "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFG9 MYO1G "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|K7EIG7 MYO1D "Unconventional myosin-Id" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKW9 MYO1D "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J3QRN6 MYO1D "Unconventional myosin-Id" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJ56 MYO1D "Unconventional myosin-Id" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q17R14 MYO1D "Unconventional myosin-Id" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRN2 MYO1D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
pfam06017199 pfam06017, Myosin_TH1, Myosin tail 4e-22
pfam06017199 pfam06017, Myosin_TH1, Myosin tail 2e-16
>gnl|CDD|218855 pfam06017, Myosin_TH1, Myosin tail Back     alignment and domain information
 Score = 88.1 bits (219), Expect = 4e-22
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 64  HNNKGNDLVFTIISSEDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLD----SGAKFK 119
            N K    V +   +E +V+F+  V+K N+  + + R LL+TD A+Y +        K  
Sbjct: 33  ENPKLQKAVGSEEGNE-KVLFADKVNKVNRSGKPSKRDLLLTDKALYLVGREKVKDQKTY 91

Query: 120 AMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRVGELVGALASRY 175
            +KR + L E+T +S+SP  D L VIH +   DLV       D   ELV  L   Y
Sbjct: 92  VLKRRIPLSEITSVSLSPLQDDLFVIHVSGKGDLVLES----DFKTELVTVLCKHY 143


Length = 199

>gnl|CDD|218855 pfam06017, Myosin_TH1, Myosin tail Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
PF06017199 Myosin_TH1: Myosin tail; InterPro: IPR010926 These 99.93
PF06017199 Myosin_TH1: Myosin tail; InterPro: IPR010926 These 99.88
KOG0164|consensus1001 99.78
KOG0164|consensus1001 99.65
KOG0162|consensus 1106 98.97
KOG0162|consensus 1106 98.36
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 96.8
PF12456115 hSac2: Inositol phosphatase ; InterPro: IPR022158 96.73
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 96.37
PF12456115 hSac2: Inositol phosphatase ; InterPro: IPR022158 95.94
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 95.33
PF1447096 bPH_3: Bacterial PH domain 94.79
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 93.15
PF1447096 bPH_3: Bacterial PH domain 92.11
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 92.09
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 91.09
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 87.39
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 86.74
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 84.28
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 83.83
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 83.66
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 82.31
PF0671374 bPH_4: Bacterial PH domain; InterPro: IPR009589 Th 81.81
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 80.47
>PF06017 Myosin_TH1: Myosin tail; InterPro: IPR010926 These proteins share a region of sequence similarity with the tail of myosin (for example O00159 from SWISSPROT) Back     alignment and domain information
Probab=99.93  E-value=2e-25  Score=180.08  Aligned_cols=93  Identities=43%  Similarity=0.604  Sum_probs=85.9

Q ss_pred             CceeEEEEEEEEEecCCceeeeEEEEecceEEEec-----CCccceeeeeeeeccceeeEEecCCCCcEEEEEeCCCCcE
Q psy5801          79 EDRVMFSAFVHKTNKFNRCADRALLVTDFAVYKLD-----SGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDL  153 (176)
Q Consensus        79 ~~~ilfs~~V~K~nr~~K~~~R~llvTd~~ly~ld-----~~k~~k~~k~~i~l~~i~~vsvS~~~d~~~vih~~~~~D~  153 (176)
                      +++++||+.|.||||++|.++|+|+||+.++|+++     +.+.+++ |++|||++|+|||+|+++|+|||||+|+++|+
T Consensus        47 ~e~vlFs~~v~K~nr~~K~~~R~livT~~~iY~l~~~~~~~~~~~~~-kr~i~l~~I~~IsvS~~~D~~~vihv~~~~D~  125 (199)
T PF06017_consen   47 DEKVLFSDRVQKYNRRNKPQPRILIVTDKAIYLLDQRKVKDPKKYKL-KRRIPLSDITGISVSPLSDNFFVIHVPGEGDL  125 (199)
T ss_pred             CcceEEEEEEEEecCCCCccceEEEEeCCeEEEEEEeecCCceeeEE-EeccCcccccEEEEccCCCCEEEEEECCCCCE
Confidence            77999999999999999999999999999999996     3333555 88899999999999999999999999999999


Q ss_pred             EEEeccCCCchhhhHHHHHhhcC
Q psy5801         154 VFTIISSEDRVGELVGALASRYY  176 (176)
Q Consensus       154 ~~~~~~~~~r~~E~v~~l~~~~~  176 (176)
                      ++++    ++.+|+++.|+++|+
T Consensus       126 il~~----~~k~Elv~~L~~~~~  144 (199)
T PF06017_consen  126 ILES----DFKTELVTILCKAYK  144 (199)
T ss_pred             EEEe----CcHHHHHHHHHHHHH
Confidence            9998    788999999999884



Myosins act as molecular motors. ; GO: 0003774 motor activity, 0016459 myosin complex

>PF06017 Myosin_TH1: Myosin tail; InterPro: IPR010926 These proteins share a region of sequence similarity with the tail of myosin (for example O00159 from SWISSPROT) Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>PF12456 hSac2: Inositol phosphatase ; InterPro: IPR022158 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>PF12456 hSac2: Inositol phosphatase ; InterPro: IPR022158 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>PF14470 bPH_3: Bacterial PH domain Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>PF14470 bPH_3: Bacterial PH domain Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>PF06713 bPH_4: Bacterial PH domain; InterPro: IPR009589 This entry is represented by Bacteriophage SP-beta, YolF Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 96.08
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 95.57
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 94.08
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 93.81
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 92.7
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 92.53
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 92.1
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 91.35
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 89.56
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 88.72
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 88.5
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 88.16
2d9y_A117 Pleckstrin homology domain-containing protein fami 87.56
2dkp_A128 Pleckstrin homology domain-containing family A mem 86.86
3a58_A 320 Exocyst complex component SEC3; protein complex, P 86.38
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 85.54
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 83.66
1u5e_A211 SRC-associated adaptor protein; novel dimerization 83.42
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 83.15
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 82.73
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 82.45
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 81.32
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
Probab=96.08  E-value=0.065  Score=40.68  Aligned_cols=87  Identities=14%  Similarity=0.164  Sum_probs=61.8

Q ss_pred             CceeEEEEEEEEEecCCceeeeEEEEecceE-EEecCCccceeeeeeeeccceeeEEecCCCCcEEEEEeCCCCcEEEEe
Q psy5801          79 EDRVMFSAFVHKTNKFNRCADRALLVTDFAV-YKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTI  157 (176)
Q Consensus        79 ~~~ilfs~~V~K~nr~~K~~~R~llvTd~~l-y~ld~~k~~k~~k~~i~l~~i~~vsvS~~~d~~~vih~~~~~D~~~~~  157 (176)
                      ++.|+....|.|-... ..+.|.|++|+.-. |-+|+.+  +.+|.-||++.  .+++-..+|..|.||+|+ --|-++-
T Consensus        49 ge~Ilk~G~v~KrkGl-~~kkR~liLT~~PrL~Yvdp~~--~~~KGeIpls~--~l~ve~k~~~~F~I~Tp~-RtY~~~d  122 (151)
T 1w1g_A           49 NNLILKMGPVDKRKGL-FARRRQLLLTEGPHLYYVDPVN--KVLKGEIPWSQ--ELRPEAKNFKTFFVHTPN-RTYYLMD  122 (151)
T ss_dssp             TCCEEEEEEEEEEETT-EEEEEEEEEETTTEEEEEETTT--TEEEEEECCCT--TCEEEESSSSEEEEEETT-EEEEEEC
T ss_pred             CCcEEEEEEEEecccC-cceeEEEEEcCCceEEEEcCcc--ccccceEecCC--CeeEEEcCCCEEEEECCC-ceEEEEc
Confidence            6778888888886443 36799999997655 5567764  34587899996  566666778899999998 5777763


Q ss_pred             ccCCCchhhhHHHHHh
Q psy5801         158 ISSEDRVGELVGALAS  173 (176)
Q Consensus       158 ~~~~~r~~E~v~~l~~  173 (176)
                        ...+..|=+.+|.+
T Consensus       123 --~~~~AqeWv~aI~~  136 (151)
T 1w1g_A          123 --PSGNAHKWCRKIQE  136 (151)
T ss_dssp             --TTSCHHHHHHHHHH
T ss_pred             --CccCHHHHHHHHHH
Confidence              34555666665544



>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 92.01
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 91.61
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 91.53
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 90.98
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 90.93
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 89.8
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 89.46
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 86.37
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 85.54
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 85.34
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 84.48
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 83.09
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 82.96
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 80.95
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Centaurin-delta 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=92.01  E-value=0.88  Score=28.96  Aligned_cols=82  Identities=13%  Similarity=0.265  Sum_probs=52.3

Q ss_pred             EEEEEecCC-c-eeeeEEEEecceEEEecCCccceeeeeeeeccceeeEEecCCCCcEEEEEeCCCCcEEEEeccCCCch
Q psy5801          87 FVHKTNKFN-R-CADRALLVTDFAVYKLDSGAKFKAMKRGMSLQEMTGLSVSPGSDQLVVIHNNKGNDLVFTIISSEDRV  164 (176)
Q Consensus        87 ~V~K~nr~~-K-~~~R~llvTd~~ly~ld~~k~~k~~k~~i~l~~i~~vsvS~~~d~~~vih~~~~~D~~~~~~~~~~r~  164 (176)
                      ...|-...+ + =+.|.+++++..|+-....+.... +..|||.++..+...  .++.|.|+.|+ ..+.|+. .+++-.
T Consensus         6 ~L~K~~~~~~~~W~kr~fvL~~~~L~~~~~~~~~~~-~~~i~L~~~~~~~~~--~~~~f~i~~~~-~~~~l~a-~s~~e~   80 (102)
T d2coda1           6 WLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYS-KGIIPLSAISTVRVQ--GDNKFEVVTTQ-RTFVFRV-EKEEER   80 (102)
T ss_dssp             EEEECCSSSSSCCEEEEEEECSSEEEEEESSCCSSC-CCEEETTTEEEEEEE--TTTEEEEEESS-CCEEEEC-SSHHHH
T ss_pred             EEEEECCCCCCCceEEEEEEECCEEEEEeccCccee-EEEEEchhceeeccc--cceeEEEEcCC-cEEEEEe-CCHHHH
Confidence            344554433 2 279999999999988865443444 555999998777664  45678889886 4677775 232333


Q ss_pred             hhhHHHHHh
Q psy5801         165 GELVGALAS  173 (176)
Q Consensus       165 ~E~v~~l~~  173 (176)
                      .+-+.+|.+
T Consensus        81 ~~Wi~ai~~   89 (102)
T d2coda1          81 NDWISILLN   89 (102)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            444444443



>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure