Psyllid ID: psy5899

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MLLRTFPAGNSALVALVIQLTWYVAQSSGGEQKQSFTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTWYVAQSSGGEQKQSVTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
ccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccHHccccccccccccccEEEEEccccccHHHHHHHHHcccccccHHHHHHccccccccEEEcccEEEEccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEcccccccccc
ccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccHHHHHHHHcccccccEEEEEcccccccccccHHHHHHHHcccccccccHHHHHcccccccEEEEcccEEEEEcccccccEEEEEEEccccccHHHccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEHHHHccccccccEEEEEccccccccc
mllrtfpagNSALVALVIQLTWYVaqssggeqkQSFTQKLKHrnnglfdkivrkevpcdflheddLLTWYVAqssggeqkQSVTQKLKHrnnglfdkivrkevpcdflheddlcvafddinpqapehflvlpkkkivsLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLhvlggrplhwppg
mllrtfpagNSALVALVIQLTWYVAQSSGGEQKQSFTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTWYVAQSSGGEQKQSVTQKLkhrnnglfdkivRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHvlggrplhwppg
MLLRTFPAGNSALVALVIQLTWYVAQSSGGEQKQSFTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTWYVAQSSGGEQKQSVTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIvakkvaakkLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
*****FPAGNSALVALVIQLTWYVAQ***************HRNNGLFDKIVRKEVPCDFLHEDDLLTWYVA******************NNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLH****
***RTF*AGNSALVALVIQLTWYVAQSSG***********KHRNNGLFDKIVRKEVPCDFLHEDDLL*************************GLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPP*
MLLRTFPAGNSALVALVIQLTWYVAQ***********QKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTWYVAQ*************LKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
*LLRTFPAGNSALVALVIQLTWYVAQSSG**QKQSFTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTW********************RNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHW**G
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRTFPAGNSALVALVIQLTWYVAQSSGGEQKQSFTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLLTWYVAQSSGGEQKQSVTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
P49773126 Histidine triad nucleotid yes N/A 0.552 0.880 0.571 2e-31
P62959126 Histidine triad nucleotid yes N/A 0.552 0.880 0.571 4e-31
P70349126 Histidine triad nucleotid yes N/A 0.552 0.880 0.571 4e-31
P62958126 Histidine triad nucleotid yes N/A 0.587 0.936 0.537 5e-31
Q5RF69126 Histidine triad nucleotid yes N/A 0.537 0.857 0.577 7e-31
P80912126 Histidine triad nucleotid yes N/A 0.552 0.880 0.562 3e-30
P53795130 Histidine triad nucleotid yes N/A 0.552 0.853 0.562 1e-29
P73481114 Uncharacterized HIT-like N/A N/A 0.552 0.973 0.535 2e-29
Q9BX68163 Histidine triad nucleotid no N/A 0.537 0.662 0.522 2e-27
Q9D0S9163 Histidine triad nucleotid no N/A 0.537 0.662 0.513 3e-27
>sp|P49773|HINT1_HUMAN Histidine triad nucleotide-binding protein 1 OS=Homo sapiens GN=HINT1 PE=1 SV=2 Back     alignment and function desciption
 Score =  135 bits (339), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 91  NNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKIL 150
            + +F KI+RKE+P   + EDD C+AF DI+PQAP HFLV+PKK I  +S+A D+D  +L
Sbjct: 15  GDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLL 74

Query: 151 GHLMIVAKKVAAK-KLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 201
           GHLMIV KK AA   L + YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct: 75  GHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126
Hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: -EC: .EC: -EC: .EC: -
>sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 Back     alignment and function description
>sp|P70349|HINT1_MOUSE Histidine triad nucleotide-binding protein 1 OS=Mus musculus GN=Hint1 PE=1 SV=3 Back     alignment and function description
>sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF69|HINT1_PONAB Histidine triad nucleotide-binding protein 1 OS=Pongo abelii GN=HINT1 PE=2 SV=3 Back     alignment and function description
>sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=4 SV=1 Back     alignment and function description
>sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=4 SV=1 Back     alignment and function description
>sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1 Back     alignment and function description
>sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
195052767150 GH13108 [Drosophila grimshawi] gi|193900 0.661 0.886 0.521 1e-33
194855024150 GG24885 [Drosophila erecta] gi|190660331 0.587 0.786 0.571 5e-33
307208957126 Histidine triad nucleotide-binding prote 0.537 0.857 0.633 6e-33
28574010150 CG2862, isoform A [Drosophila melanogast 0.587 0.786 0.571 9e-33
195436802151 GK18243 [Drosophila willistoni] gi|19416 0.656 0.874 0.503 1e-32
332375196126 unknown [Dendroctonus ponderosae] 0.592 0.944 0.55 2e-32
24581222126 CG2862, isoform B [Drosophila melanogast 0.587 0.936 0.571 2e-32
125984476126 GA15490 [Drosophila pseudoobscura pseudo 0.537 0.857 0.614 2e-32
322793762155 hypothetical protein SINV_09109 [Solenop 0.587 0.761 0.563 2e-32
196002864126 expressed hypothetical protein [Trichopl 0.587 0.936 0.554 3e-32
>gi|195052767|ref|XP_001993366.1| GH13108 [Drosophila grimshawi] gi|193900425|gb|EDV99291.1| GH13108 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 94/138 (68%), Gaps = 5/138 (3%)

Query: 65  DLLTWYVAQSSGGEQKQSVTQKLKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQA 124
            L T     +S  ++ QS T       + +F KI+RKE+PC F++EDD CVAF+D++PQA
Sbjct: 17  SLATTCARMASEVDKAQSATAS----EDTIFGKILRKEIPCKFIYEDDKCVAFNDVSPQA 72

Query: 125 PEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAK-KLIRNYRVVVNNGWEAVQFS 183
           P HFLV+P+K I  LSLA D DA++LGHLM+V +KVA +  L + YRVV+NNG    Q  
Sbjct: 73  PTHFLVIPRKPIAQLSLAEDGDAELLGHLMLVGRKVAKEVGLEKGYRVVINNGQHGAQSV 132

Query: 184 GHLHLHVLGGRPLHWPPG 201
            HLHLH LGGR + WPPG
Sbjct: 133 YHLHLHFLGGRQMQWPPG 150

Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194855024|ref|XP_001968464.1| GG24885 [Drosophila erecta] gi|190660331|gb|EDV57523.1| GG24885 [Drosophila erecta] Back     alignment and taxonomy information
>gi|307208957|gb|EFN86168.1| Histidine triad nucleotide-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|28574010|ref|NP_608711.3| CG2862, isoform A [Drosophila melanogaster] gi|442625565|ref|NP_001259964.1| CG2862, isoform C [Drosophila melanogaster] gi|195342081|ref|XP_002037630.1| GM18366 [Drosophila sechellia] gi|195576145|ref|XP_002077937.1| GD23182 [Drosophila simulans] gi|17944449|gb|AAL48114.1| RH02823p [Drosophila melanogaster] gi|17946673|gb|AAL49367.1| RH49748p [Drosophila melanogaster] gi|28380283|gb|AAF51208.2| CG2862, isoform A [Drosophila melanogaster] gi|194132480|gb|EDW54048.1| GM18366 [Drosophila sechellia] gi|194189946|gb|EDX03522.1| GD23182 [Drosophila simulans] gi|220949348|gb|ACL87217.1| CG2862-PA [synthetic construct] gi|220958568|gb|ACL91827.1| CG2862-PA [synthetic construct] gi|440213231|gb|AGB92501.1| CG2862, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195436802|ref|XP_002066344.1| GK18243 [Drosophila willistoni] gi|194162429|gb|EDW77330.1| GK18243 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|332375196|gb|AEE62739.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|24581222|ref|NP_722836.1| CG2862, isoform B [Drosophila melanogaster] gi|22945385|gb|AAN10414.1| CG2862, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|125984476|ref|XP_001356002.1| GA15490 [Drosophila pseudoobscura pseudoobscura] gi|54644320|gb|EAL33061.1| GA15490 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|322793762|gb|EFZ17146.1| hypothetical protein SINV_09109 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|196002864|ref|XP_002111299.1| expressed hypothetical protein [Trichoplax adhaerens] gi|190585198|gb|EDV25266.1| expressed hypothetical protein [Trichoplax adhaerens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
FB|FBgn0031459150 CG2862 [Drosophila melanogaste 0.537 0.72 0.577 1.4e-30
UNIPROTKB|P49773126 HINT1 "Histidine triad nucleot 0.537 0.857 0.541 1.9e-28
UNIPROTKB|J9P9J0126 HINT1 "Uncharacterized protein 0.537 0.857 0.532 5e-28
MGI|MGI:1321133126 Hint1 "histidine triad nucleot 0.537 0.857 0.541 5e-28
RGD|620960126 Hint1-ps1 "histidine triad nuc 0.537 0.857 0.541 5e-28
UNIPROTKB|Q5RF69126 HINT1 "Histidine triad nucleot 0.537 0.857 0.532 6.4e-28
UNIPROTKB|F1RKI3126 HINT1 "Uncharacterized protein 0.537 0.857 0.532 8.2e-28
UNIPROTKB|P62958126 HINT1 "Histidine triad nucleot 0.537 0.857 0.532 1e-27
UNIPROTKB|D4A269126 D4A269 "Uncharacterized protei 0.537 0.857 0.532 1.3e-27
UNIPROTKB|Q78DM8126 quPKCI "Protein kinase C inhib 0.597 0.952 0.495 2.2e-27
FB|FBgn0031459 CG2862 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 63/109 (57%), Positives = 74/109 (67%)

Query:    94 LFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHL 153
             +F KI+RKE+PC F+HEDD CVAF D+ PQAP HFLV+P+K I  LSLA D DA +LGHL
Sbjct:    42 IFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHL 101

Query:   154 M-IXXXXXXXXXLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 201
             M +         L   YRVV+NNG    Q   HLHLH LGGR + WPPG
Sbjct:   102 MLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150
GO:0008252 "nucleotidase activity" evidence=ISS
UNIPROTKB|P49773 HINT1 "Histidine triad nucleotide-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9J0 HINT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1321133 Hint1 "histidine triad nucleotide binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620960 Hint1-ps1 "histidine triad nucleotide binding protein 1, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RF69 HINT1 "Histidine triad nucleotide-binding protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKI3 HINT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P62958 HINT1 "Histidine triad nucleotide-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4A269 D4A269 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q78DM8 quPKCI "Protein kinase C inhibitor" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P62958HINT1_BOVIN3, ., -, ., -, ., -0.53780.58700.9365yesN/A
P62959HINT1_RAT3, ., -, ., -, ., -0.57140.55220.8809yesN/A
P49773HINT1_HUMAN3, ., -, ., -, ., -0.57140.55220.8809yesN/A
P70349HINT1_MOUSE3, ., -, ., -, ., -0.57140.55220.8809yesN/A
Q5RF69HINT1_PONAB3, ., -, ., -, ., -0.57790.53730.8571yesN/A
P80912HINT1_RABIT3, ., -, ., -, ., -0.56250.55220.8809yesN/A
P53795HINT_CAEELNo assigned EC number0.56250.55220.8538yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 2e-43
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 1e-29
pfam0123097 pfam01230, HIT, HIT domain 6e-26
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 2e-25
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 4e-25
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 8e-23
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 3e-14
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 2e-09
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FH 3e-04
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score =  140 bits (356), Expect = 2e-43
 Identities = 54/102 (52%), Positives = 69/102 (67%), Gaps = 2/102 (1%)

Query: 94  LFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHL 153
           +F KI+R E+P   ++EDD  +AF DINPQAP H LV+PKK I SLS A +ED ++LGHL
Sbjct: 3   IFCKIIRGEIPAKKVYEDDEVLAFHDINPQAPVHILVIPKKHIASLSDATEEDEELLGHL 62

Query: 154 MIVAKKVAAKKLIRN--YRVVVNNGWEAVQFSGHLHLHVLGG 193
           +  A KVA    I    YR+V+N G +  Q   HLHLH+LGG
Sbjct: 63  LSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>gnl|CDD|238606 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
KOG3275|consensus127 99.98
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.98
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.98
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.97
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.97
PLN02643336 ADP-glucose phosphorylase 99.96
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.96
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.95
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.95
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.94
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.92
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.91
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.88
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.86
KOG3379|consensus150 99.8
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.8
KOG2958|consensus354 99.67
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.66
KOG4359|consensus166 99.56
KOG3275|consensus127 99.34
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 98.96
KOG2476|consensus 528 98.4
KOG0562|consensus184 98.13
KOG3969|consensus310 97.25
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.01
KOG2477|consensus 628 96.77
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 96.48
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 96.44
PLN02643 336 ADP-glucose phosphorylase 95.36
PRK10687119 purine nucleoside phosphoramidase; Provisional 95.12
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 94.69
KOG2720|consensus 431 94.46
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 94.07
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 94.02
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 93.94
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 93.92
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 93.06
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 92.48
COG5075305 Uncharacterized conserved protein [Function unknow 91.99
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 91.14
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 89.82
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 88.44
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 83.85
>KOG3275|consensus Back     alignment and domain information 
Probab=99.98  E-value=3.3e-32  Score=206.99  Aligned_cols=112  Identities=57%  Similarity=0.941  Sum_probs=107.4

Q ss_pred             CCCceeccccCccccccEEEEcCcEEEEecCCCCCCeEEEEEecccccCccCCChhhHHHHHHHHHHHHHHHHh-hCCCC
Q psy5899          90 RNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAK-KLIRN  168 (201)
Q Consensus        90 ~~~C~FC~Ii~~ei~~~iv~edd~~~af~d~~P~~pGHlLVvPkrHv~~l~dLt~ee~~~l~~l~~~~k~ll~~-~l~~~  168 (201)
                      +++|.||+|+++|+|+.++||||.++||.|.+|..|+|+|||||+|++.++.+.+.+.+++++++.++|+++++ ++++|
T Consensus        15 ~~~tIF~kIi~keIPa~ii~Edd~~lAF~Di~Pqap~HfLvIPK~hi~~~s~aed~~~e~Lg~ll~~~k~vak~~Gl~~g   94 (127)
T KOG3275|consen   15 AAPTIFCKIIRKEIPAKIIFEDDRCLAFHDIAPQAPGHFLVIPKKHITQLSKAEDRDDELLGHLLPVAKKVAKALGLEDG   94 (127)
T ss_pred             CCCcEeeeeecccCCcceEeeccceEEEEecCCCCCceEEEeecccccchhhcccCCHHHHHHHHHHHHHHHHHhCcccc
Confidence            47999999999999999999999999999999999999999999998888888777888999999999999999 99899


Q ss_pred             eEEEEecccCCCCccceeEEEEEcCCCCCCCCC
Q psy5899         169 YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG  201 (201)
Q Consensus       169 y~v~~n~G~~agqsv~HlHlHIIPRrklkw~a~  201 (201)
                      ||+.+|+|..+.|+|+|+|+||+|++.++|++|
T Consensus        95 Yrvv~NnG~~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen   95 YRVVQNNGKDGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             eeEEEcCCcccceEEEEEEEEEeCCcccCCCCC
Confidence            999999999999999999999999999999997

>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>KOG3379|consensus Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>KOG2958|consensus Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>KOG4359|consensus Back     alignment and domain information
>KOG3275|consensus Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG2476|consensus Back     alignment and domain information
>KOG0562|consensus Back     alignment and domain information
>KOG3969|consensus Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>KOG2477|consensus Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG2720|consensus Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 4e-29
3tw2_A126 High Resolution Structure Of Human Histidine Triad 4e-29
1kpa_A126 Pkci-1-Zinc Length = 126 4e-29
1kpb_A125 Pkci-1-Apo Length = 125 4e-29
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 3e-28
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 5e-28
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 8e-28
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 2e-27
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 4e-27
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 2e-17
3n1s_A119 Crystal Structure Of Wild Type Echint Gmp Complex L 3e-14
3n1t_A119 Crystal Structure Of The H101a Mutant Echint Gmp Co 3e-13
1xqu_A147 Hit Family Hydrolase From Clostridium Thermocellum 1e-12
4egu_A119 0.95a Resolution Structure Of A Histidine Triad Pro 2e-12
3lb5_A161 Crystal Structure Of Hit-Like Protein Involved In C 3e-09
3ksv_A149 Hypothetical Protein From Leishmania Major Length = 6e-08
3p0t_A138 Crystal Structure Of An Hit-Like Protein From Mycob 8e-05
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 1e-04
1y23_A145 Crystal Structure Of A Member Of Hit Family Of Prot 2e-04
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (311), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (65%), Gaps = 1/119 (0%)
Query: 84  TQKLKHRNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAA 143
            Q  +   + +F KI+RKE+P   + EDD C+AF DI+PQAP HFLV+PKK I  +S+A 
Sbjct: 10  AQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAE 69
Query: 144 DEDAKILGHLMIXXXX-XXXXXLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 201
           D+D  +LGHLMI          L + YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct: 70  DDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 128
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure
>pdb|3N1S|A Chain A, Crystal Structure Of Wild Type Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|3N1T|A Chain A, Crystal Structure Of The H101a Mutant Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 Back     alignment and structure
>pdb|4EGU|A Chain A, 0.95a Resolution Structure Of A Histidine Triad Protein From Clostridium Difficile Length = 119 Back     alignment and structure
>pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and structure
>pdb|3KSV|A Chain A, Hypothetical Protein From Leishmania Major Length = 149 Back     alignment and structure
>pdb|3P0T|A Chain A, Crystal Structure Of An Hit-Like Protein From Mycobacterium Paratuberculosis Length = 138 Back     alignment and structure
>pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure
>pdb|1Y23|A Chain A, Crystal Structure Of A Member Of Hit Family Of Proteins From Bacillus Subtilis Length = 145 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 4e-56
3oj7_A117 Putative histidine triad family protein; hydrolase 7e-55
4egu_A119 Histidine triad (HIT) protein; structural genomics 4e-53
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 4e-50
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 3e-49
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 3e-45
3ksv_A149 Uncharacterized protein; HIT family, structural ge 1e-43
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 2e-42
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 2e-39
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 2e-38
3imi_A147 HIT family protein; structural genomics, infectiou 2e-38
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 1e-37
2eo4_A149 150AA long hypothetical histidine triad nucleotid 4e-36
3r6f_A135 HIT family protein; structural genomics, seattle s 2e-32
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 4e-26
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 1e-10
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 4e-09
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 1e-07
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 3e-05
3ohe_A137 Histidine triad (HIT) protein; structural genomics 4e-05
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 6e-04
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score =  172 bits (439), Expect = 4e-56
 Identities = 61/109 (55%), Positives = 77/109 (70%), Gaps = 1/109 (0%)

Query: 94  LFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHL 153
           +F KI+RKE+P   + EDD  +AF DI+PQAP HFLV+PKK I  +S A D D  +LGHL
Sbjct: 18  IFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHL 77

Query: 154 MIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 201
           MIV KK AA   ++  YR+VVN G +  Q   H+HLHVLGGR ++WPPG
Sbjct: 78  MIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Length = 218 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Length = 137 Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 100.0
3oj7_A117 Putative histidine triad family protein; hydrolase 100.0
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.98
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.97
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.97
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.97
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.96
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.96
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.96
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.96
3imi_A147 HIT family protein; structural genomics, infectiou 99.95
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.94
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.94
3r6f_A135 HIT family protein; structural genomics, seattle s 99.94
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.93
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.93
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.9
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.89
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.88
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.75
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.73
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.65
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.57
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.57
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.0
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 98.95
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.46
3ksv_A149 Uncharacterized protein; HIT family, structural ge 96.98
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 96.42
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 95.49
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 95.08
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 94.78
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 94.62
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 94.02
4egu_A119 Histidine triad (HIT) protein; structural genomics 92.08
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 90.39
3oj7_A117 Putative histidine triad family protein; hydrolase 90.09
3imi_A147 HIT family protein; structural genomics, infectiou 89.27
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 89.16
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 88.35
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 83.05
2eo4_A149 150AA long hypothetical histidine triad nucleotid 80.47
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=100.00  E-value=1.3e-34  Score=223.56  Aligned_cols=112  Identities=55%  Similarity=0.956  Sum_probs=106.7

Q ss_pred             CCCceeccccCccccccEEEEcCcEEEEecCCCCCCeEEEEEecccccCccCCChhhHHHHHHHHHHHHHHHHh-hCCCC
Q psy5899          90 RNNGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAK-KLIRN  168 (201)
Q Consensus        90 ~~~C~FC~Ii~~ei~~~iv~edd~~~af~d~~P~~pGHlLVvPkrHv~~l~dLt~ee~~~l~~l~~~~k~ll~~-~l~~~  168 (201)
                      .++|+||+|+++|++.++|||||+++||.|.+|.+|||+||+||+|++++.||+++|.+++++++..+++++++ ...++
T Consensus        14 ~~~CiFC~i~~~e~~~~iv~e~e~~~af~d~~P~~pgH~LViPk~H~~~l~dL~~~e~~~l~~l~~~~~~~~~~~~~~~g   93 (126)
T 3o1c_A           14 GGDTIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKG   93 (126)
T ss_dssp             TCSSHHHHHHHTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSCCCCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTC
T ss_pred             CCCCCcchhhcCCCcCCEEEECCCEEEEECCCCCCCceEEEEechHhchHhhCchhHHHHHHHHHHHHHHHHHHhCCCCC
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999888 55579


Q ss_pred             eEEEEecccCCCCccceeEEEEEcCCCCCCCCC
Q psy5899         169 YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG  201 (201)
Q Consensus       169 y~v~~n~G~~agqsv~HlHlHIIPRrklkw~a~  201 (201)
                      ||+++|+|+.+||+++|+|+|||||++|+|++|
T Consensus        94 ~ni~~n~g~~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A           94 YRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             EEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             eEEEEecCCccCCccCEeEEEEeCCcccCCCCC
Confidence            999999999999999999999999999999987
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 201
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 3e-34
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 5e-23
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 1e-18
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 3e-16
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 2e-14
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 1e-13
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla250 1e-08
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- 2e-07
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridyly 1e-06
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  115 bits (290), Expect = 3e-34
 Identities = 63/111 (56%), Positives = 80/111 (72%), Gaps = 1/111 (0%)

Query: 92  NGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILG 151
           + +F KI+RKE+P   + EDD C+AF DI+PQAP HFLV+PKK I  +S+A D+D  +LG
Sbjct: 1   DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLG 60

Query: 152 HLMIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 201
           HLMIV KK AA   +   YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct: 61  HLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.97
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.96
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.94
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.93
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.93
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.9
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.89
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.4
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.15
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 96.96
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 96.94
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 96.55
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 95.86
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 95.55
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 94.6
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 94.23
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 93.9
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-34  Score=217.79  Aligned_cols=110  Identities=58%  Similarity=1.036  Sum_probs=104.6

Q ss_pred             CceeccccCccccccEEEEcCcEEEEecCCCCCCeEEEEEecccccCccCCChhhHHHHHHHHHHHHHHHHh-hCCCCeE
Q psy5899          92 NGLFDKIVRKEVPCDFLHEDDLCVAFDDINPQAPEHFLVLPKKKIVSLSLAADEDAKILGHLMIVAKKVAAK-KLIRNYR  170 (201)
Q Consensus        92 ~C~FC~Ii~~ei~~~iv~edd~~~af~d~~P~~pGHlLVvPkrHv~~l~dLt~ee~~~l~~l~~~~k~ll~~-~l~~~y~  170 (201)
                      +|+||+|+++|+|+.+|||||+++||+|.+|..+||+||+||+|+.++.+|++++..++..+...+++++++ ...++||
T Consensus         1 dCiFc~I~~~e~p~~ivyede~~~af~D~~P~~~gH~LViPk~H~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~~   80 (111)
T d1kpfa_           1 DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYR   80 (111)
T ss_dssp             CCHHHHHHTTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSCCSCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTCEE
T ss_pred             CCcccccccCCCCccEEEeCCCEEEEecCCCCCCceEEEeecchhcchhhhhhHHHHHHHHHHHHHHHHHHHhCCCCCEE
Confidence            599999999999999999999999999999999999999999999999999999888999999888888888 5457999


Q ss_pred             EEEecccCCCCccceeEEEEEcCCCCCCCCC
Q psy5899         171 VVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG  201 (201)
Q Consensus       171 v~~n~G~~agqsv~HlHlHIIPRrklkw~a~  201 (201)
                      +.+|+|+.+||+|+|+|+|||||++|+|++|
T Consensus        81 i~~n~g~~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          81 MVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             EECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             EEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence            9999999999999999999999999999998
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure