Psyllid ID: psy5911

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240--
QYCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKEIVIENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKFNIKQISETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK
ccccEEEEEccccccEEEEEEccccEEEcccccccccccEEEEcccccEEccccccccccccccccHHHHHHHcccccccHHHHHHHccccEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHccccccccEEEEEccHHHHHHHHHcccccccccEEEEEEcccccEEEEEEEEEccccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccEEcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEccccEEEcccccccccccEEEEcccccEEccccccccccccccccHHHHHHHcccccccHHHHHHcccccEEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHccccccccEEEEEccHHHHHHHHHcccccccccEEEEEEcccccEEEEEEEEEccccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccEEcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccEEEEEEcccccEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHcHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHc
ccccEEEEEEcccEEEEEEEEccEEEEcccccccccEEccEEEcccccEEEcHHHHccccccHHHEEccHHHccccccccHHHHHHHHHcccEEEccccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEHHHcccccccccEEEEEEHHHHHHHHHHHHHHcHHHHHHHHHHHcccHHHccEEEEEcHHHHcHHHHHHHHHccccccEcccccccHHHHHHHHHHHHHcccHHHcccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccEEEEEEEEccEEEEcccccccccEEccEEEccccEEEcHHHHccccccHHHEEccHHHHccccccccHHHHHHHHHcccEEEEccccccEEEEEEcEccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHcccccccccEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEHHHcccccccccEEEEEEHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHccEEEEEcHHHHcHHHHHHHHHccccccEcccccccHHHHHHHHHHHHHcccHHHcccccEccccEEEEEcccEEEEEEccccEccEEEEEEEEEccccccEEEEEEEEccccEHHHcEEEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHc
qyckiigidlgttnSCVAVLnngkpqvienseggrttpsvvgytednriivglpakrqaitnpnnTLYAIKRLIGRKYTDEIVQTVLKMVPYKivaadngdawvevkdkklappqISAEILKKMKSTAETFLNEKIEKAVItvpayfndsqRQATKDAGKIAGLEVLRIINEPTAAALAYgldkkpddrIIVVYDLGGGTFDISVIEIANVDGETQFEVLstngdtflggedfdMRIINHLIYEFkiengvdlsgDSLAMQRLKEAAEKAKIELsnaeqtdinlpyitadkngpkhlnvkITRSKLESLVEDLISKSLKPCEVALNdakidkskISEIILVGGQTRMPLVQKMVSEFFEKEvkkdinpdeavAVGASVQAGVLSGVVKDVLlldvtpltlgietmggvmtplieknttiptrktqvfstaednqtsVTIHTLQgerkkasqnkslgkfdlndispaprgvpqievsfdldangilnvtakdkktgkeQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLetkketdydeDKIRKLKEIVIENIIIElipitdsmEMFAknfdsnqtkeSEIIFLIFKLIKKFYKKFNIKqisetgvlfnpdiheaigiyptfgkkkgttnSCVAVLnngkpqvienseggrttpsvvgytednriivglpakrqaitnpnnTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEvkdqycappqISAEILKKMKSTAETFLNEKIEKAVItvpayfndsqRQATKDAGKIAGLEVLRIINEPTAAALAYgldkkpddrIIVVYDLGGGTFDISVIEIANVDGETQFEVLstngdtflggedfdMRIINHLIYEFkiengvdlsgDSLAMQRLKEAAEKAKIELsnaeqtdinlpyitadkngpkhlnvkITRSKLESLVEDLISKSLKPCEVALNdakidkskISEIILVGGQTRMPLVQKMVSEFFEKEvkkdinpdeavAVGASVQAGVLSGVVKDVLlldvtpltlgietmggvmtplieknttiptrktqvfstaednqtsVTIHTLQgerkkasqnkslgkfdlndispaprgvpqievsfdldangilnvtakdkktgkeQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNlkdentkitDEEKESIEKSISNLELlikgddielIKKGNEDLLKISENIIKK
qyckiigidlgttnsCVAVLNNGkpqvienseggrttpsvvgyteDNRIIVGlpakrqaitnpnnTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKklappqisAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALaygldkkpdDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIelsnaeqtdinlpyitadkngpkhlNVKITRSKLESLVEDLISKSLKPCEVAlndakidkskiSEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLgietmggvmtplieKNTTIPTRKTqvfstaednqtsvtihtlqgerkkasqnkslgkfdlndispapRGVPQIEVSFDLDANGILNvtakdkktgkeqsiiikssgglseieIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFvletkketdydedkirklkeiviENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKFNIKQIsetgvlfnpdIHEAIGIYPTFGKKKGTTNSCVAVLNNgkpqvienseggrttpsvvgyteDNRIIVGlpakrqaitnpnnTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALaygldkkpdDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIelsnaeqtdinlpyitadkngpkhlNVKITRSKLESLVEDLISKSLKPCEVAlndakidkskiSEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLgietmggvmtplieKNTTIPTRKTqvfstaednqtsvtihtlqgerkkasqnkslgkfdlndispapRGVPQIEVSFDLDANGILNvtakdkktgkeqsiiikssgglseieIENMIKDAELNSELDKKFEELVkckneadstisivkknlkdentkitdeekesieksisnlellikgddielikkgnedllkiseniikk
QYCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEavavgasvqagvlsgvvkdvllldvtpltlGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKeivieniiielipiTDSMEMFAKNFDSNQTKESEiiflifklikkfykkfnikqiSETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEavavgasvqagvlsgvvkdvllldvtpltlGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLKDENTKITDeekesieksisnlelliKGDDIELIKKGNEDLLKISENIIKK
*YCKIIGIDLGTTNSCVAVLNNGKPQVI*********PSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSG*************************DINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPT**************************************************QIEVSFDLDANGILNVTA**********III*******EIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKEIVIENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKFNIKQISETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGK**V***********SVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSG*************************DINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPT**************************************************QIEVSFDLDANGILNVT************II*******************************V*************************************NLELLIKGDDIELIKKGN**LL*********
*YCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKE**************EIENMIKDAE**********ELVKCKNEQIIILEEKFCSFVLETKKETDY************IENIIIELIPIT************NQTKESEIIFLIFKLIKKFYKKFNIKQISETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKE**************EIENMIKDAE**********ELVKCKNEADSTISIVKKNLKD************IEKSISNL*************KGNEDLLKISENI***
QYCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKEIVIENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKFNIKQISETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK
*YCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKEIVIENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKF**********************YPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QYCKIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAxxxxxxxxxxxxxxxxxxxxxDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEQIIILEEKFCSFVLETKKETDYDEDKIRKLKEIVIENIIIELIPITDSMEMFAKNFDSNQTKESEIIFLIFKLIKKFYKKFNIKQISETGVLFNPDIHEAIGIYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAxxxxxxxxxxxxxxxxxxxxxDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTxxxxxxxxxxxxxxxxxxxxxxxxxSISNLELLIKGDDIELIKKGNEDLLKISENIIKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1242 2.2.26 [Sep-21-2011]
Q05FS8602 Chaperone protein DnaK OS yes N/A 0.476 0.983 0.902 0.0
A1U614641 Chaperone protein DnaK OS yes N/A 0.476 0.923 0.706 0.0
Q1QSX0644 Chaperone protein DnaK OS yes N/A 0.476 0.919 0.711 0.0
Q2SMM8642 Chaperone protein DnaK OS yes N/A 0.475 0.920 0.699 0.0
A6W2D2637 Chaperone protein DnaK OS yes N/A 0.476 0.929 0.712 0.0
A6VCL8637 Chaperone protein DnaK OS yes N/A 0.459 0.896 0.711 0.0
A4VPQ5637 Chaperone protein DnaK OS yes N/A 0.459 0.896 0.709 0.0
Q9HV43637 Chaperone protein DnaK OS yes N/A 0.459 0.896 0.711 0.0
Q02FR1637 Chaperone protein DnaK OS yes N/A 0.459 0.896 0.711 0.0
B7V1H3637 Chaperone protein DnaK OS yes N/A 0.459 0.896 0.711 0.0
>sp|Q05FS8|DNAK_CARRP Chaperone protein DnaK OS=Carsonella ruddii (strain PV) GN=dnaK PE=3 SV=1 Back     alignment and function desciption
 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/592 (90%), Positives = 568/592 (95%)

Query: 651  GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
            GTTNSC+AVL+NGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNP NTLYAI
Sbjct: 10   GTTNSCIAVLSNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPKNTLYAI 69

Query: 711  KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAET 770
            KRLIGRK+ D+IVQKDIKMVPYKI++++NGDAWVEVKD+  APPQISAEILKKMK TAE 
Sbjct: 70   KRLIGRKFKDDIVQKDIKMVPYKIISSENGDAWVEVKDKKLAPPQISAEILKKMKITAEN 129

Query: 771  FLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRI 830
            FLNEK+ KAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK +DRI
Sbjct: 130  FLNEKVTKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKKNDRI 189

Query: 831  IVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 890
            I VYDLGGGTFDIS+IEIANVDGETQFEVLSTNGDTFLGGEDFD+RIIN+LIYEFKIENG
Sbjct: 190  IAVYDLGGGTFDISIIEIANVDGETQFEVLSTNGDTFLGGEDFDIRIINNLIYEFKIENG 249

Query: 891  VDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLV 950
            ++LSGDSLAMQRLKEAAEKAKIELS+ EQTDINLPYITADKNGPKHLN+KITRSKLESLV
Sbjct: 250  INLSGDSLAMQRLKEAAEKAKIELSSVEQTDINLPYITADKNGPKHLNIKITRSKLESLV 309

Query: 951  EDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDE 1010
            EDLI KSLKPCE+ALNDAKI K+KI EIILVGGQTRMPLVQKMVS+FFEK VKKDINPDE
Sbjct: 310  EDLILKSLKPCEIALNDAKISKNKIDEIILVGGQTRMPLVQKMVSDFFEKVVKKDINPDE 369

Query: 1011 AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTA 1070
            AVA+GASVQAGVLSGVVKDVLLLDVTPLTLGIETMGG+MTPLIEKNTTIPT+KTQVFSTA
Sbjct: 370  AVAIGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGIMTPLIEKNTTIPTKKTQVFSTA 429

Query: 1071 EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 1130
            EDNQTSVTIHTLQGERKKA QNKSLGKFDLN+ISPAPRGVPQIEVSFDLDANGILNVTAK
Sbjct: 430  EDNQTSVTIHTLQGERKKALQNKSLGKFDLNNISPAPRGVPQIEVSFDLDANGILNVTAK 489

Query: 1131 DKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKN 1190
            DKKTG EQSI+IKSSGGLSE+EIENMIKDAE N E+DKKFEELVKC+NEADSTISIVKK 
Sbjct: 490  DKKTGVEQSIVIKSSGGLSELEIENMIKDAEANLEIDKKFEELVKCRNEADSTISIVKKK 549

Query: 1191 LKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK 1242
            LKDEN KI DEE+ SIEKSISNLELLIKGDDI+ IKK NE+LLK+S+NIIKK
Sbjct: 550  LKDENLKILDEERVSIEKSISNLELLIKGDDIDSIKKENEELLKLSDNIIKK 601
Acts as a chaperone.
Carsonella ruddii (strain PV) (taxid: 387662)
>sp|A1U614|DNAK_MARAV Chaperone protein DnaK OS=Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|Q1QSX0|DNAK_CHRSD Chaperone protein DnaK OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|A6W2D2|DNAK_MARMS Chaperone protein DnaK OS=Marinomonas sp. (strain MWYL1) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|A6VCL8|DNAK_PSEA7 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain PA7) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|A4VPQ5|DNAK_PSEU5 Chaperone protein DnaK OS=Pseudomonas stutzeri (strain A1501) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|Q9HV43|DNAK_PSEAE Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaK PE=1 SV=1 Back     alignment and function description
>sp|Q02FR1|DNAK_PSEAB Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaK PE=3 SV=1 Back     alignment and function description
>sp|B7V1H3|DNAK_PSEA8 Chaperone protein DnaK OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaK PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1242
400404337601 chaperone protein DnaK [Candidatus Carso 0.476 0.985 0.935 0.0
400404563601 chaperone protein DnaK [Candidatus Carso 0.476 0.985 0.932 0.0
400404785602 chaperone protein DnaK [Candidatus Carso 0.476 0.983 0.908 0.0
116334964602 chaperone protein DnaK [Candidatus Carso 0.476 0.983 0.902 0.0
400404099602 chaperone protein DnaK [Candidatus Carso 0.476 0.983 0.895 0.0
400403861602 chaperone protein DnaK [Candidatus Carso 0.476 0.983 0.895 0.0
402575003641 chaperone protein DnaK [Candidatus Porti 0.467 0.906 0.749 0.0
352104757644 molecular chaperone DnaK [Halomonas sp. 0.470 0.906 0.712 0.0
448747654644 Chaperone DnaK [Halomonas titanicae BH1] 0.470 0.906 0.712 0.0
359394219644 Chaperone protein dnaK [Halomonas bolivi 0.476 0.919 0.709 0.0
>gi|400404337|ref|YP_006587357.1| chaperone protein DnaK [Candidatus Carsonella ruddii HC isolate Thao2000] gi|400362858|gb|AFP83929.1| chaperone protein DnaK [Candidatus Carsonella ruddii HC isolate Thao2000] Back     alignment and taxonomy information
 Score = 1116 bits (2886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/592 (93%), Positives = 578/592 (97%)

Query: 651  GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
            GTTNSCVAVL NGKPQVIENSEGGRTTPS+VGYT+DNRIIVGLPAKRQAITNP NTLYAI
Sbjct: 10   GTTNSCVAVLKNGKPQVIENSEGGRTTPSIVGYTDDNRIIVGLPAKRQAITNPKNTLYAI 69

Query: 711  KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAET 770
            KRLIGRK+ D+IVQKDIKMVPYKI++A+NGDAWVE+KD+  APPQISAEILKKMKSTAET
Sbjct: 70   KRLIGRKFLDDIVQKDIKMVPYKIISAENGDAWVEIKDKRLAPPQISAEILKKMKSTAET 129

Query: 771  FLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRI 830
            +LNEKI KAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK +DRI
Sbjct: 130  YLNEKINKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKKEDRI 189

Query: 831  IVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 890
            IVVYDLGGGTFDIS+IEIANV+GETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG
Sbjct: 190  IVVYDLGGGTFDISIIEIANVEGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 249

Query: 891  VDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLV 950
            VDLSGDSLAMQRLKE+AEKAKIELSNAEQTDINLPYITADKNGPKHLN+KITRSKLESLV
Sbjct: 250  VDLSGDSLAMQRLKESAEKAKIELSNAEQTDINLPYITADKNGPKHLNIKITRSKLESLV 309

Query: 951  EDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDE 1010
            EDLI KSLKPCE ALNDAKIDK+KI EIILVGGQTRMPLVQKMVS+FFEKEVKKDINPDE
Sbjct: 310  EDLIIKSLKPCETALNDAKIDKNKIDEIILVGGQTRMPLVQKMVSDFFEKEVKKDINPDE 369

Query: 1011 AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTA 1070
            AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQ+FSTA
Sbjct: 370  AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQIFSTA 429

Query: 1071 EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 1130
            EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK
Sbjct: 430  EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 489

Query: 1131 DKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKN 1190
            DKKTGKEQSIIIKSSGGLSE+EIENMIKDAE+NSELDKKFEELVKCKNEADSTISIVKKN
Sbjct: 490  DKKTGKEQSIIIKSSGGLSELEIENMIKDAEINSELDKKFEELVKCKNEADSTISIVKKN 549

Query: 1191 LKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK 1242
            LKDE  KI+DEEK +IEKSISNLELLIKG+DIE IKKGNEDLLK+SENIIKK
Sbjct: 550  LKDEKIKISDEEKITIEKSISNLELLIKGEDIESIKKGNEDLLKLSENIIKK 601

Source: Candidatus Carsonella ruddii HC isolate Thao2000

Species: Candidatus Carsonella ruddii

Genus: Candidatus Carsonella

Family:

Order:

Class: Gammaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|400404563|ref|YP_006587538.1| chaperone protein DnaK [Candidatus Carsonella ruddii HT isolate Thao2000] gi|400363039|gb|AFP84109.1| chaperone protein DnaK [Candidatus Carsonella ruddii HT isolate Thao2000] Back     alignment and taxonomy information
>gi|400404785|ref|YP_006587717.1| chaperone protein DnaK [Candidatus Carsonella ruddii PC isolate NHV] gi|400363220|gb|AFP84289.1| chaperone protein DnaK [Candidatus Carsonella ruddii PC isolate NHV] Back     alignment and taxonomy information
>gi|116334964|ref|YP_802459.1| chaperone protein DnaK [Candidatus Carsonella ruddii PV] gi|123126182|sp|Q05FS8.1|DNAK_CARRP RecName: Full=Chaperone protein DnaK; AltName: Full=HSP70; AltName: Full=Heat shock 70 kDa protein; AltName: Full=Heat shock protein 70 gi|116235245|dbj|BAF35093.1| chaperone protein DnaK [Candidatus Carsonella ruddii PV] Back     alignment and taxonomy information
>gi|400404099|ref|YP_006587167.1| chaperone protein DnaK [Candidatus Carsonella ruddii CS isolate Thao2000] gi|400362667|gb|AFP83739.1| chaperone protein DnaK [Candidatus Carsonella ruddii CS isolate Thao2000] Back     alignment and taxonomy information
>gi|400403861|ref|YP_006586977.1| chaperone protein DnaK [Candidatus Carsonella ruddii CE isolate Thao2000] gi|400362476|gb|AFP83549.1| chaperone protein DnaK [Candidatus Carsonella ruddii CE isolate Thao2000] Back     alignment and taxonomy information
>gi|402575003|ref|YP_006607895.1| chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-B-HRs] gi|407453020|ref|YP_006732339.1| Chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-QVLC] gi|407681355|ref|YP_006796531.1| chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-QVLC] gi|407681636|ref|YP_006796811.1| Chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-B-HRs] gi|401871807|gb|AFQ23975.1| chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-B-HRs] gi|405779737|gb|AFS18740.1| Chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-QVLC] gi|407242966|gb|AFT80367.1| Chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-QVLC] gi|407243247|gb|AFT80647.1| Chaperone protein DnaK [Candidatus Portiera aleyrodidarum BT-B-HRs] Back     alignment and taxonomy information
>gi|352104757|ref|ZP_08960510.1| molecular chaperone DnaK [Halomonas sp. HAL1] gi|350598679|gb|EHA14789.1| molecular chaperone DnaK [Halomonas sp. HAL1] Back     alignment and taxonomy information
>gi|448747654|ref|ZP_21729310.1| Chaperone DnaK [Halomonas titanicae BH1] gi|445564766|gb|ELY20882.1| Chaperone DnaK [Halomonas titanicae BH1] Back     alignment and taxonomy information
>gi|359394219|ref|ZP_09187272.1| Chaperone protein dnaK [Halomonas boliviensis LC1] gi|357971466|gb|EHJ93911.1| Chaperone protein dnaK [Halomonas boliviensis LC1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1242
TIGR_CMR|CBU_1290656 CBU_1290 "chaperone protein dn 0.476 0.902 0.621 7.8e-197
UNIPROTKB|P0A6Y8638 dnaK [Escherichia coli K-12 (t 0.475 0.926 0.610 2.4e-195
UNIPROTKB|A1A766638 dnaK "Chaperone protein DnaK" 0.475 0.926 0.610 2.4e-195
UNIPROTKB|O34241635 dnaK "Chaperone protein DnaK" 0.430 0.842 0.682 4e-193
TIGR_CMR|VC_0855635 VC_0855 "dnaK protein" [Vibrio 0.430 0.842 0.682 4e-193
TIGR_CMR|SO_1126639 SO_1126 "chaperone protein Dna 0.475 0.923 0.617 3.2e-191
TIGR_CMR|CPS_3821638 CPS_3821 "chaperone protein Dn 0.475 0.926 0.597 1.4e-190
TIGR_CMR|CPS_1313633 CPS_1313 "chaperone protein Dn 0.482 0.946 0.581 2e-182
TIGR_CMR|SPO_0043637 SPO_0043 "chaperone protein Dn 0.471 0.918 0.576 6.9e-173
TIGR_CMR|GSU_0033636 GSU_0033 "chaperone protein dn 0.470 0.918 0.577 8.9e-173
TIGR_CMR|CBU_1290 CBU_1290 "chaperone protein dnak" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 1906 (676.0 bits), Expect = 7.8e-197, P = 7.8e-197
 Identities = 371/597 (62%), Positives = 460/597 (77%)

Query:   651 GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
             GTTNSCVAV+  GK +VIEN+EG RTTPS+V YT+D  ++VG  AKRQA+TN + TLYAI
Sbjct:    10 GTTNSCVAVMEGGKVRVIENAEGSRTTPSIVAYTKDGEVLVGASAKRQAVTNADRTLYAI 69

Query:   711 KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKD-----QYCAPPQISAEILKKMK 765
             KRLIGR++ D +VQKDIKMVPYKI+ ADNGDAWVEVKD     Q  APPQISA++L KMK
Sbjct:    70 KRLIGRRFDDNVVQKDIKMVPYKIIKADNGDAWVEVKDKEGKSQKLAPPQISAQVLIKMK 129

Query:   766 STAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK 825
              TAE +L  +++ AVITVPAYFNDSQRQATKDAGKIAGL V RIINEPTAAALAYG+DKK
Sbjct:   130 KTAEDYLGHEVKDAVITVPAYFNDSQRQATKDAGKIAGLNVKRIINEPTAAALAYGMDKK 189

Query:   826 PDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEF 885
               DR I VYDLGGGTFDIS+IEIA VDGE QFEVL+TNGDTFLGGEDFD+R+I++L  EF
Sbjct:   190 KGDRKIAVYDLGGGTFDISIIEIAEVDGEHQFEVLATNGDTFLGGEDFDLRLIDYLAGEF 249

Query:   886 KIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSK 945
             K + GVDL  D LA+QRLKEAAEKAKIELS+++QTD+NLPYITAD +GPKHLN+++TR+K
Sbjct:   250 KKDEGVDLHNDPLALQRLKEAAEKAKIELSSSQQTDVNLPYITADASGPKHLNIRLTRAK 309

Query:   946 LESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKD 1005
             LESLVEDL+ ++++PC+VA+ DA +  S+I ++ILVGGQTRMP VQ+ V  FF KE +KD
Sbjct:   310 LESLVEDLVERTIEPCKVAIKDAGLKVSEIDDVILVGGQTRMPKVQEAVKNFFGKEARKD 369

Query:  1006 INPDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIETMGGVMTPLIEKNTTIPTRKTQ 1065
             +NPDE                              GIET+GGVMT LIEKNTTIPT+  Q
Sbjct:   370 VNPDEAVAIGAAIQGAVLSGEVKDVLLLDVTPLSLGIETLGGVMTKLIEKNTTIPTKANQ 429

Query:  1066 VFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGIL 1125
             VFSTA+DNQT+VT+H LQGER+ AS NKSLG+FDL+DI PAPRGVPQIEV+FD+DANGIL
Sbjct:   430 VFSTADDNQTAVTVHVLQGEREMASANKSLGRFDLSDIPPAPRGVPQIEVTFDIDANGIL 489

Query:  1126 NVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTIS 1185
             +V+AKDK TGKEQSI+IK+S GLS+ E+E M+KDAE + + D+KF ELV  +N+AD+ I 
Sbjct:   490 HVSAKDKATGKEQSIVIKASSGLSDEEVEKMVKDAEAHRDSDRKFHELVDARNQADAMIH 549

Query:  1186 IVKKNLKDENTKITDXXXXXXXXXXXXXXXXXKGDDIELIKKGNEDLLKISENIIKK 1242
               +K++KD  ++++                  KG+D + I+   + L + S  + ++
Sbjct:   550 AAEKSVKDLGSEVSADEKSAIEKAVNELKEAMKGNDKDAIEAKTKALTEHSSKLAER 606
GO:0006950 "response to stress" evidence=ISS
UNIPROTKB|P0A6Y8 dnaK [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|A1A766 dnaK "Chaperone protein DnaK" [Escherichia coli APEC O1 (taxid:405955)] Back     alignment and assigned GO terms
UNIPROTKB|O34241 dnaK "Chaperone protein DnaK" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0855 VC_0855 "dnaK protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1126 SO_1126 "chaperone protein DnaK" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3821 CPS_3821 "chaperone protein DnaK" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1313 CPS_1313 "chaperone protein DnaK" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0043 SPO_0043 "chaperone protein DnaK" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0033 GSU_0033 "chaperone protein dnaK" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O87712DNAK_COXBUNo assigned EC number0.67000.47660.9024yesN/A
Q5ZTY3DNAK_LEGPHNo assigned EC number0.70080.46770.9021yesN/A
Q0VST6DNAK_ALCBSNo assigned EC number0.71000.46130.8939yesN/A
C5BQ33DNAK_TERTTNo assigned EC number0.70100.47660.9192yesN/A
Q02FR1DNAK_PSEABNo assigned EC number0.71100.45970.8963yesN/A
Q607A5DNAK_METCANo assigned EC number0.67220.47660.9235yesN/A
B5BLH8DNAK_SALPKNo assigned EC number0.65980.47580.9263yesN/A
A6W2D2DNAK_MARMSNo assigned EC number0.71280.47660.9293yesN/A
Q88DU2DNAK_PSEPKNo assigned EC number0.68750.47660.9235yesN/A
Q3KIA0DNAK_PSEPFNo assigned EC number0.68910.47660.9278yesN/A
Q1IF59DNAK_PSEE4No assigned EC number0.68410.47660.9235yesN/A
A4VPQ5DNAK_PSEU5No assigned EC number0.70920.45970.8963yesN/A
B6IZJ0DNAK_COXB2No assigned EC number0.67000.47660.9024yesN/A
A8G9K8DNAK_SERP5No assigned EC number0.67000.47580.9277yesN/A
Q05FS8DNAK_CARRPNo assigned EC number0.90200.47660.9833yesN/A
A6VCL8DNAK_PSEA7No assigned EC number0.71100.45970.8963yesN/A
A9N8H2DNAK_COXBRNo assigned EC number0.67000.47660.9024yesN/A
B5F6Y8DNAK_SALA4No assigned EC number0.65980.47580.9263yesN/A
Q87WP0DNAK_PSESMNo assigned EC number0.69250.47660.9278yesN/A
B4TIB4DNAK_SALHSNo assigned EC number0.65980.47580.9263yesN/A
A6VNB1DNAK_ACTSZNo assigned EC number0.67110.46850.9165yesN/A
Q21H36DNAK_SACD2No assigned EC number0.68410.47660.9206yesN/A
B6J7U7DNAK_COXB1No assigned EC number0.67000.47660.9024yesN/A
B4TVZ5DNAK_SALSVNo assigned EC number0.65980.47580.9263yesN/A
Q2SMM8DNAK_HAHCHNo assigned EC number0.69930.47580.9205yesN/A
B3PF33DNAK_CELJUNo assigned EC number0.68750.47660.925yesN/A
A4XYF6DNAK_PSEMYNo assigned EC number0.70920.45970.8963yesN/A
A1U614DNAK_MARAVNo assigned EC number0.70600.47660.9235yesN/A
Q5PDJ5DNAK_SALPANo assigned EC number0.65980.47580.9263yesN/A
Q4KIH1DNAK_PSEF5No assigned EC number0.69250.47660.9278yesN/A
Q5WV15DNAK_LEGPLNo assigned EC number0.70080.46770.9021yesN/A
O32482DNAK_LEGPNNo assigned EC number0.70080.46770.9021yesN/A
Q4ZNP7DNAK_PSEU2No assigned EC number0.69760.47660.9278yesN/A
B7V1H3DNAK_PSEA8No assigned EC number0.71100.45970.8963yesN/A
Q48E62DNAK_PSE14No assigned EC number0.69760.47660.9278yesN/A
B1J254DNAK_PSEPWNo assigned EC number0.69080.47660.9221yesN/A
A5W9A3DNAK_PSEP1No assigned EC number0.68750.47660.9689yesN/A
Q9HV43DNAK_PSEAENo assigned EC number0.71100.45970.8963yesN/A
B8GNX1DNAK_THISHNo assigned EC number0.66720.46610.9032yesN/A
Q5X3M7DNAK_LEGPANo assigned EC number0.70080.46770.9021yesN/A
Q326K7DNAK_SHIBSNo assigned EC number0.65980.46940.9137yesN/A
Q32KA5DNAK_SHIDSNo assigned EC number0.65980.46940.9137yesN/A
A5IDK8DNAK_LEGPCNo assigned EC number0.70080.46770.9021yesN/A
Q1QSX0DNAK_CHRSDNo assigned EC number0.71110.47660.9192yesN/A
Q3Z601DNAK_SHISSNo assigned EC number0.65980.46940.9137yesN/A
B0KIS5DNAK_PSEPGNo assigned EC number0.68410.47660.9235yesN/A
A9KG88DNAK_COXBNNo assigned EC number0.67000.47660.9024yesN/A
Q65U55DNAK_MANSMNo assigned EC number0.66940.46850.9150yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1242
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 0.0
PRK00290627 PRK00290, dnaK, molecular chaperone DnaK; Provisio 0.0
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 0.0
TIGR02350595 TIGR02350, prok_dnaK, chaperone protein DnaK 0.0
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.0
pfam00012598 pfam00012, HSP70, Hsp70 protein 0.0
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 0.0
PTZ00400663 PTZ00400, PTZ00400, DnaK-type molecular chaperone; 0.0
CHL00094621 CHL00094, dnaK, heat shock protein 70 0.0
CHL00094621 CHL00094, dnaK, heat shock protein 70 0.0
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 0.0
PRK13410668 PRK13410, PRK13410, molecular chaperone DnaK; Prov 0.0
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 0.0
PRK13411653 PRK13411, PRK13411, molecular chaperone DnaK; Prov 0.0
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslatio 0.0
COG0443579 COG0443, DnaK, Molecular chaperone [Posttranslatio 0.0
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 0.0
PLN03184673 PLN03184, PLN03184, chloroplast Hsp70; Provisional 0.0
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 0.0
cd11733377 cd11733, HSPA9-like_NBD, Nucleotide-binding domain 0.0
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 0.0
PTZ00186657 PTZ00186, PTZ00186, heat shock 70 kDa precursor pr 0.0
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 0.0
cd10234376 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d 0.0
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisiona 0.0
PRK05183616 PRK05183, hscA, chaperone protein HscA; Provisiona 0.0
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 0.0
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 0.0
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone H 0.0
TIGR01991599 TIGR01991, HscA, Fe-S protein assembly chaperone H 0.0
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-160
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-157
cd11734373 cd11734, Ssq1_like_NBD, Nucleotide-binding domain 1e-155
cd10170369 cd10170, HSP70_NBD, Nucleotide-binding domain of t 1e-151
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-149
cd10241374 cd10241, HSPA5-like_NBD, Nucleotide-binding domain 1e-146
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 1e-145
cd10233376 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding 1e-141
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-127
cd10236355 cd10236, HscA_like_NBD, Nucleotide-binding domain 1e-123
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-119
cd10235339 cd10235, HscC_like_NBD, Nucleotide-binding domain 1e-113
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisiona 1e-104
PRK01433595 PRK01433, hscA, chaperone protein HscA; Provisiona 1e-102
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 1e-99
cd10228381 cd10228, HSPA4_like_NDB, Nucleotide-binding domain 1e-96
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 1e-90
cd10237417 cd10237, HSPA13-like_NBD, Nucleotide-binding domai 4e-85
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 3e-79
cd10238375 cd10238, HSPA14-like_NBD, Nucleotide-binding domai 5e-78
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 3e-77
cd10230388 cd10230, HYOU1-like_NBD, Nucleotide-binding domain 6e-74
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 6e-71
cd11739383 cd11739, HSPH1_NBD, Nucleotide-binding domain of H 2e-69
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 2e-65
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 1e-64
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 1e-61
cd11737383 cd11737, HSPA4_NBD, Nucleotide-binding domain of H 2e-61
cd11738383 cd11738, HSPA4L_NBD, Nucleotide-binding domain of 2e-60
cd11732377 cd11732, HSP105-110_like_NBD, Nucleotide-binding d 1e-59
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 2e-59
cd10232386 cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma 9e-55
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 1e-31
cd10231415 cd10231, YegD_like, Escherichia coli YegD, a putat 1e-28
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 2e-21
cd10229404 cd10229, HSPA12_like_NBD, Nucleotide-binding domai 7e-18
PRK11678450 PRK11678, PRK11678, putative chaperone; Provisiona 4e-15
PRK11678450 PRK11678, PRK11678, putative chaperone; Provisiona 1e-12
cd10225320 cd10225, MreB_like, MreB and similar proteins 4e-11
pfam01025165 pfam01025, GrpE, GrpE 8e-11
cd10225320 cd10225, MreB_like, MreB and similar proteins 4e-10
PRK13930335 PRK13930, PRK13930, rod shape-determining protein 1e-09
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 1e-09
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 2e-09
PRK13929335 PRK13929, PRK13929, rod-share determining protein 2e-09
cd00446137 cd00446, GrpE, GrpE is the adenine nucleotide exch 3e-09
COG0576193 COG0576, GrpE, Molecular chaperone GrpE (heat shoc 8e-09
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 1e-08
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 2e-08
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 2e-08
PRK15080267 PRK15080, PRK15080, ethanolamine utilization prote 2e-08
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 3e-08
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 5e-08
PRK13930335 PRK13930, PRK13930, rod shape-determining protein 1e-07
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 1e-07
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein 1e-07
PRK13928336 PRK13928, PRK13928, rod shape-determining protein 2e-07
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 3e-07
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, p 3e-07
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 4e-07
PRK13929335 PRK13929, PRK13929, rod-share determining protein 4e-07
TIGR00904333 TIGR00904, mreB, cell shape determining protein, M 6e-07
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell 2e-06
PRK13927334 PRK13927, PRK13927, rod shape-determining protein 2e-05
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 3e-05
TIGR01312481 TIGR01312, XylB, D-xylulose kinase 3e-05
PRK14150193 PRK14150, PRK14150, heat shock protein GrpE; Provi 2e-04
PRK14145196 PRK14145, PRK14145, heat shock protein GrpE; Provi 2e-04
PRK14144199 PRK14144, PRK14144, heat shock protein GrpE; Provi 5e-04
PRK14153194 PRK14153, PRK14153, heat shock protein GrpE; Provi 0.001
PRK13927334 PRK13927, PRK13927, rod shape-determining protein 0.002
cd07809487 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 0.004
cd07809487 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 0.004
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information 
 Score = 1055 bits (2730), Expect = 0.0
 Identities = 388/592 (65%), Positives = 481/592 (81%), Gaps = 7/592 (1%)

Query: 651  GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
            GTTNSCVAV+  G+P+VIEN+EG RTTPSVV +T+D   +VG PAKRQA+TNP NT+++I
Sbjct: 10   GTTNSCVAVMEGGEPKVIENAEGARTTPSVVAFTKDGERLVGQPAKRQAVTNPENTIFSI 69

Query: 711  KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAET 770
            KRL+GR+  DE VQKDIK+VPYKIV ADNGDAWVE+  +   P +ISA IL+K+K  AE 
Sbjct: 70   KRLMGRR--DEEVQKDIKLVPYKIVKADNGDAWVEIDGKKYTPQEISAMILQKLKKDAED 127

Query: 771  FLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRI 830
            +L EK+ +AVITVPAYFND+QRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK  D  
Sbjct: 128  YLGEKVTEAVITVPAYFNDAQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKK-GDEK 186

Query: 831  IVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 890
            I+VYDLGGGTFD+S++EI    G+  FEVLSTNGDT LGG+DFD RII++L  EFK ENG
Sbjct: 187  ILVYDLGGGTFDVSILEI----GDGVFEVLSTNGDTHLGGDDFDQRIIDYLADEFKKENG 242

Query: 891  VDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLV 950
            +DL  D +A+QRLKEAAEKAKIELS+A+QT+INLP+ITAD +GPKHL +K+TR+K E L 
Sbjct: 243  IDLRKDKMALQRLKEAAEKAKIELSSAQQTEINLPFITADASGPKHLEIKLTRAKFEELT 302

Query: 951  EDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDE 1010
            EDL+ ++++PC+ AL DA +  S I E+ILVGG TRMP VQ++V EFF KE  K +NPDE
Sbjct: 303  EDLVERTIEPCKQALKDAGLSVSDIDEVILVGGSTRMPAVQELVKEFFGKEPNKGVNPDE 362

Query: 1011 AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTA 1070
             VA+GA++Q GVL+G VKDVLLLDVTPL+LGIET+GGVMT LIE+NTTIPT+K+QVFSTA
Sbjct: 363  VVAIGAAIQGGVLAGDVKDVLLLDVTPLSLGIETLGGVMTKLIERNTTIPTKKSQVFSTA 422

Query: 1071 EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 1130
             DNQ +VTIH LQGER+ A+ NKSLG+F+L  I PAPRGVPQIEV+FD+DANGI++V+AK
Sbjct: 423  ADNQPAVTIHVLQGEREMAADNKSLGRFNLTGIPPAPRGVPQIEVTFDIDANGIVHVSAK 482

Query: 1131 DKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKN 1190
            DK TGKEQSI I +S GLS+ EIE M+KDAE N+E DKK +ELV+ +N+ADS I   +K 
Sbjct: 483  DKGTGKEQSITITASSGLSDEEIERMVKDAEANAEEDKKRKELVEARNQADSLIYQTEKT 542

Query: 1191 LKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK 1242
            LK+   K+  +EKE IE +I  L+  +KG+D E IK   E+L + S+ + + 
Sbjct: 543  LKELGDKVPADEKEKIEAAIKELKEALKGEDKEAIKAKTEELTQASQKLGEA 594

Length = 627
>gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins Back     alignment and domain information
>gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 Back     alignment and domain information
>gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L Back     alignment and domain information
>gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|212671 cd10229, HSPA12_like_NBD, Nucleotide-binding domain of HSPA12A, HSPA12B and similar proteins Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|236954 PRK11678, PRK11678, putative chaperone; Provisional Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|216249 pfam01025, GrpE, GrpE Back     alignment and domain information
>gnl|CDD|212668 cd10225, MreB_like, MreB and similar proteins Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|238252 cd00446, GrpE, GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
>gnl|CDD|223649 COG0576, GrpE, Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|237904 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|237564 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|213718 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|237563 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|227157 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|224003 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase Back     alignment and domain information
>gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184536 PRK14145, PRK14145, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184535 PRK14144, PRK14144, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|184540 PRK14153, PRK14153, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237562 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases Back     alignment and domain information
>gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1242
KOG0100|consensus663 100.0
KOG0100|consensus663 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PRK13411653 molecular chaperone DnaK; Provisional 100.0
PTZ00400663 DnaK-type molecular chaperone; Provisional 100.0
PRK13410668 molecular chaperone DnaK; Provisional 100.0
KOG0102|consensus640 100.0
KOG0102|consensus640 100.0
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 100.0
PLN03184673 chloroplast Hsp70; Provisional 100.0
PRK00290627 dnaK molecular chaperone DnaK; Provisional 100.0
KOG0101|consensus620 100.0
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 100.0
CHL00094621 dnaK heat shock protein 70 100.0
PRK13410668 molecular chaperone DnaK; Provisional 100.0
PTZ00009653 heat shock 70 kDa protein; Provisional 100.0
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
PRK13411653 molecular chaperone DnaK; Provisional 100.0
PTZ00400663 DnaK-type molecular chaperone; Provisional 100.0
PRK05183616 hscA chaperone protein HscA; Provisional 100.0
PLN03184673 chloroplast Hsp70; Provisional 100.0
PRK00290627 dnaK molecular chaperone DnaK; Provisional 100.0
KOG0101|consensus620 100.0
CHL00094621 dnaK heat shock protein 70 100.0
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 100.0
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
PTZ00009653 heat shock 70 kDa protein; Provisional 100.0
PRK05183616 hscA chaperone protein HscA; Provisional 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 100.0
PRK01433595 hscA chaperone protein HscA; Provisional 100.0
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 100.0
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 100.0
KOG0103|consensus727 100.0
KOG0103|consensus727 100.0
KOG0104|consensus 902 100.0
KOG0104|consensus902 100.0
PRK11678450 putative chaperone; Provisional 100.0
PRK11678450 putative chaperone; Provisional 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13927334 rod shape-determining protein MreB; Provisional 100.0
PRK13928336 rod shape-determining protein Mbl; Provisional 100.0
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13930335 rod shape-determining protein MreB; Provisional 100.0
PRK13927334 rod shape-determining protein MreB; Provisional 100.0
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 100.0
PRK13930335 rod shape-determining protein MreB; Provisional 99.98
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.97
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.96
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.96
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.96
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.95
PRK14148195 heat shock protein GrpE; Provisional 99.94
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.94
PRK14147172 heat shock protein GrpE; Provisional 99.94
PRK14153194 heat shock protein GrpE; Provisional 99.94
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.94
PRK14145196 heat shock protein GrpE; Provisional 99.94
PRK14161178 heat shock protein GrpE; Provisional 99.94
PRK14139185 heat shock protein GrpE; Provisional 99.94
PRK14159176 heat shock protein GrpE; Provisional 99.94
PRK14151176 heat shock protein GrpE; Provisional 99.94
PRK14162194 heat shock protein GrpE; Provisional 99.94
PRK14155208 heat shock protein GrpE; Provisional 99.94
PRK14141209 heat shock protein GrpE; Provisional 99.94
PRK10325197 heat shock protein GrpE; Provisional 99.93
PRK14158194 heat shock protein GrpE; Provisional 99.93
PRK14163214 heat shock protein GrpE; Provisional 99.93
PRK14140191 heat shock protein GrpE; Provisional 99.93
PRK14150193 heat shock protein GrpE; Provisional 99.93
COG0576193 GrpE Molecular chaperone GrpE (heat shock protein) 99.93
PRK14144199 heat shock protein GrpE; Provisional 99.93
PRK14146215 heat shock protein GrpE; Provisional 99.93
PRK14160211 heat shock protein GrpE; Provisional 99.93
PRK14154208 heat shock protein GrpE; Provisional 99.93
PRK14149191 heat shock protein GrpE; Provisional 99.93
PRK14143238 heat shock protein GrpE; Provisional 99.92
PRK14157227 heat shock protein GrpE; Provisional 99.92
PRK14156177 heat shock protein GrpE; Provisional 99.91
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.91
PRK14142223 heat shock protein GrpE; Provisional 99.91
PRK14164218 heat shock protein GrpE; Provisional 99.89
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.87
KOG3003|consensus236 99.87
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.85
cd00446137 GrpE GrpE is the adenine nucleotide exchange facto 99.83
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 99.8
PRK09472420 ftsA cell division protein FtsA; Reviewed 99.75
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 99.74
PF01025165 GrpE: GrpE; InterPro: IPR000740 Molecular chaperon 99.73
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.68
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.62
COG4820277 EutJ Ethanolamine utilization protein, possible ch 99.57
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 99.56
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 99.52
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 99.45
PTZ00280414 Actin-related protein 3; Provisional 99.45
PRK13917344 plasmid segregation protein ParM; Provisional 99.41
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.39
COG4820277 EutJ Ethanolamine utilization protein, possible ch 99.38
PTZ00452375 actin; Provisional 99.37
PTZ00281376 actin; Provisional 99.34
PTZ00004378 actin-2; Provisional 99.3
PTZ00466380 actin-like protein; Provisional 99.28
PTZ00280414 Actin-related protein 3; Provisional 99.25
PRK13917344 plasmid segregation protein ParM; Provisional 99.2
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 99.16
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 99.15
PTZ00452375 actin; Provisional 99.15
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 99.14
PTZ00004378 actin-2; Provisional 99.06
PTZ00281376 actin; Provisional 99.04
PTZ00466380 actin-like protein; Provisional 99.01
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 98.97
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 98.95
KOG0679|consensus426 98.86
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 98.83
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 98.75
COG5277444 Actin and related proteins [Cytoskeleton] 98.66
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 98.64
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 98.61
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 98.57
KOG0679|consensus426 98.57
PF075201002 SrfB: Virulence factor SrfB; InterPro: IPR009216 T 98.47
PF075201002 SrfB: Virulence factor SrfB; InterPro: IPR009216 T 98.44
PRK10719475 eutA reactivating factor for ethanolamine ammonia 98.26
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 98.25
COG5277444 Actin and related proteins [Cytoskeleton] 98.25
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 98.18
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 98.16
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 98.09
KOG0676|consensus372 98.01
TIGR00241248 CoA_E_activ CoA-substrate-specific enzyme activase 98.0
PF08841332 DDR: Diol dehydratase reactivase ATPase-like domai 97.79
PRK13317277 pantothenate kinase; Provisional 97.79
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 97.7
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 97.65
PF08841332 DDR: Diol dehydratase reactivase ATPase-like domai 97.62
PRK10719475 eutA reactivating factor for ethanolamine ammonia 97.54
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s 97.36
PRK15027484 xylulokinase; Provisional 97.3
COG44571014 SrfB Uncharacterized protein conserved in bacteria 97.24
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 97.23
COG44571014 SrfB Uncharacterized protein conserved in bacteria 97.23
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HS 97.23
KOG0797|consensus618 97.02
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 96.98
KOG0676|consensus372 96.97
TIGR03286404 methan_mark_15 putative methanogenesis marker prot 96.97
KOG0677|consensus389 96.91
PRK00047498 glpK glycerol kinase; Provisional 96.78
KOG0797|consensus618 96.78
PRK10331470 L-fuculokinase; Provisional 96.73
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 96.62
TIGR02259432 benz_CoA_red_A benzoyl-CoA reductase, bcr type, su 96.61
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 96.51
PRK15027484 xylulokinase; Provisional 96.49
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 96.42
TIGR02261262 benz_CoA_red_D benzoyl-CoA reductase, bcr type, su 96.39
KOG0677|consensus389 96.36
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 96.3
COG1069544 AraB Ribulose kinase [Energy production and conver 96.22
PF02782198 FGGY_C: FGGY family of carbohydrate kinases, C-ter 96.2
PTZ00294504 glycerol kinase-like protein; Provisional 96.11
KOG0680|consensus400 95.96
PRK00047498 glpK glycerol kinase; Provisional 95.81
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 95.71
PF06277473 EutA: Ethanolamine utilisation protein EutA; Inter 95.69
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbo 95.67
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 95.45
PLN02669556 xylulokinase 95.41
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 95.19
TIGR01315541 5C_CHO_kinase FGGY-family pentulose kinase. This m 95.18
PLN02295512 glycerol kinase 95.02
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 94.98
PLN02669556 xylulokinase 94.89
TIGR01311493 glycerol_kin glycerol kinase. This model describes 94.87
PRK04123548 ribulokinase; Provisional 94.77
COG1069544 AraB Ribulose kinase [Energy production and conver 94.77
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 94.62
PRK10640471 rhaB rhamnulokinase; Provisional 94.57
TIGR02628465 fuculo_kin_coli L-fuculokinase. Members of this fa 94.21
PTZ00294504 glycerol kinase-like protein; Provisional 94.15
TIGR01311493 glycerol_kin glycerol kinase. This model describes 94.05
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 94.0
TIGR01312481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 93.97
TIGR01234536 L-ribulokinase L-ribulokinase. This enzyme catalyz 93.8
PRK04123548 ribulokinase; Provisional 93.78
PRK10331470 L-fuculokinase; Provisional 93.74
KOG2517|consensus516 93.59
TIGR01314505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 93.52
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 93.5
TIGR02627454 rhamnulo_kin rhamnulokinase. This model describes 93.37
PRK13317277 pantothenate kinase; Provisional 93.33
PLN02295512 glycerol kinase 93.21
PRK03011358 butyrate kinase; Provisional 93.03
KOG2531|consensus545 92.97
PRK10939520 autoinducer-2 (AI-2) kinase; Provisional 92.8
KOG2517|consensus516 92.64
PF14450120 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B 92.5
PRK10640471 rhaB rhamnulokinase; Provisional 92.49
PF14574412 DUF4445: Domain of unknown function (DUF4445); PDB 92.32
PRK11031496 guanosine pentaphosphate phosphohydrolase; Provisi 92.01
TIGR00555279 panK_eukar pantothenate kinase, eukaryotic/staphyl 91.73
PRK10854513 exopolyphosphatase; Provisional 91.68
KOG0680|consensus400 91.55
COG4819473 EutA Ethanolamine utilization protein, possible ch 91.42
KOG2531|consensus545 91.38
KOG0681|consensus645 90.05
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 89.45
TIGR03706300 exo_poly_only exopolyphosphatase. It appears that 89.23
PF13941457 MutL: MutL protein 88.91
KOG0681|consensus645 88.57
PF06277473 EutA: Ethanolamine utilisation protein EutA; Inter 88.44
TIGR03281326 methan_mark_12 putative methanogenesis marker prot 86.13
TIGR03281326 methan_mark_12 putative methanogenesis marker prot 85.41
PRK09604332 UGMP family protein; Validated 84.66
COG0248492 GppA Exopolyphosphatase [Nucleotide transport and 83.57
COG1548330 Predicted transcriptional regulator/sugar kinase [ 83.17
COG0248492 GppA Exopolyphosphatase [Nucleotide transport and 82.66
COG0554499 GlpK Glycerol kinase [Energy production and conver 81.74
PRK03011358 butyrate kinase; Provisional 80.69
PF01869271 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In 80.51
>KOG0100|consensus Back     alignment and domain information 
Probab=100.00  E-value=4e-126  Score=992.29  Aligned_cols=591  Identities=51%  Similarity=0.796  Sum_probs=568.5

Q ss_pred             ccccccccCCceEEEEEEEeCCcceEEecCCCCcccceEEEEecCCcEEEcHHHHHHhhhCCcchhhHHHHhcCCCCCCh
Q psy5911         642 IYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDE  721 (1242)
Q Consensus       642 ~~~~~~id~Gt~~~~~~v~~~g~~~ii~~~~g~~~~PS~v~~~~~~~~~~G~~A~~~~~~~p~~~~~~~krllg~~~~d~  721 (1242)
                      +..++|||+||+++||+|+.+|++++|.|++|+|.+||+|+|+++ ++++|++|++++..||+||+++.||||||.++|+
T Consensus        35 ~gtvigIdLGTTYsCVgV~kNgrvEIiANdQGNRItPSyVaFt~d-erLiGdAAKNQ~~~NPenTiFD~KRLIGr~~~d~  113 (663)
T KOG0100|consen   35 LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDD-ERLIGDAAKNQLTSNPENTIFDAKRLIGRKFNDK  113 (663)
T ss_pred             cceEEEEecCCceeeEEEEeCCeEEEEecCCCCccccceeeeccc-hhhhhhHhhcccccCcccceechHHHhCcccCCh
Confidence            445899999999999999999999999999999999999999988 8999999999999999999999999999999999


Q ss_pred             hHHhhcccCceEEEEcCCCCeEEE--Ec---CeeeChHHHHHHHHHHHHHHHHhHhCCCCCcEEEEecCCCCHHHHHHHH
Q psy5911         722 IVQKDIKMVPYKIVAADNGDAWVE--VK---DQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATK  796 (1242)
Q Consensus       722 ~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~~~~~v~a~~L~~l~~~a~~~~~~~~~~~VitVPa~~~~~qr~~~~  796 (1242)
                      .+|++++.|||+++. .++++.+.  +.   .+.|+|+++++|+|.++++.|+.|+|.++.++|+||||||++.||++++
T Consensus       114 ~vq~Dik~~Pfkvv~-k~~kp~i~v~v~~g~~K~FtPeEiSaMiL~KMKe~AEayLGkkv~~AVvTvPAYFNDAQrQATK  192 (663)
T KOG0100|consen  114 SVQKDIKFLPFKVVN-KDGKPYIQVKVGGGETKVFTPEEISAMILTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATK  192 (663)
T ss_pred             hhhhhhhcCceEEEc-CCCCccEEEEccCCcccccCHHHHHHHHHHHHHHHHHHHhCCcccceEEecchhcchHHHhhhc
Confidence            999999999999884 34455554  44   2589999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCceeeeechhHHHHHHccCCCCCCCcEEEEEeeCCCceEEEEEEEeecCCCceEEEEEecCCCCCCchHHHHH
Q psy5911         797 DAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMR  876 (1242)
Q Consensus       797 ~Aa~~AGl~~~~li~Ep~AAal~y~~~~~~~~~~vlV~D~GggT~dvsi~~~~~~~~~~~~~v~~~~~~~~lGG~~~D~~  876 (1242)
                      +|..+|||+++|+||||+|||++||+++...++++||||+||||||||++.+++    +.|+|+++.||.+|||+|||.+
T Consensus       193 DAGtIAgLnV~RIiNePTaAAIAYGLDKk~gEknilVfDLGGGTFDVSlLtIdn----GVFeVlaTnGDThLGGEDFD~r  268 (663)
T KOG0100|consen  193 DAGTIAGLNVVRIINEPTAAAIAYGLDKKDGEKNILVFDLGGGTFDVSLLTIDN----GVFEVLATNGDTHLGGEDFDQR  268 (663)
T ss_pred             ccceeccceEEEeecCccHHHHHhcccccCCcceEEEEEcCCceEEEEEEEEcC----ceEEEEecCCCcccCccchHHH
Confidence            999999999999999999999999999998999999999999999999999999    9999999999999999999999


Q ss_pred             HHHHHHHHhhhhcCCCCCCCHHHHHHHHHHHHHhhhhccCCceeeEEeccccccCCCCeeeEEEEcHHHHHHHHHHHHHH
Q psy5911         877 IINHLIYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISK  956 (1242)
Q Consensus       877 l~~~l~~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~~Ls~~~~~~i~i~~~~~~~~~~~~~~~~itr~~fe~~~~~~~~~  956 (1242)
                      .++|+.+-|+++++.|++.+.+++++|+++||+||+.||++.++.+.++++.++.    +|+-++||+.||++..++|.+
T Consensus       269 vm~~fiklykkK~gkDv~kdnkA~~KLrRe~EkAKRaLSsqhq~riEIeS~fdG~----DfSEtLtRAkFEElNmDLFr~  344 (663)
T KOG0100|consen  269 VMEYFIKLYKKKHGKDVRKDNKAVQKLRREVEKAKRALSSQHQVRIEIESLFDGV----DFSETLTRAKFEELNMDLFRK  344 (663)
T ss_pred             HHHHHHHHHhhhcCCccchhhHHHHHHHHHHHHHHhhhccccceEEeeeeccccc----cccchhhhhHHHHhhhHHHHH
Confidence            9999999999999999999999999999999999999999999999999988764    499999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCccCcceEEEecCcCchHHHHHHHHhhh-cccccccCCcchhhhhhHHHhhhhhccc--ccceEEe
Q psy5911         957 SLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFF-EKEVKKDINPDEAVAVGASVQAGVLSGV--VKDVLLL 1033 (1242)
Q Consensus       957 ~~~~i~~~l~~~~~~~~~i~~ViLvGG~s~ip~v~~~l~~~f-~~~v~~~~~p~~aVa~GAa~~a~~l~~~--~~~~~~~ 1033 (1242)
                      ++.+++++|+++++.+++|+.|+|||||+|||.||++|+++| |+++.+.+||+||||+|||.+|+.+||.  ..++++.
T Consensus       345 TlkPv~kvl~Ds~lkKsdideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsGee~t~divLL  424 (663)
T KOG0100|consen  345 TLKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSGEEDTGDIVLL  424 (663)
T ss_pred             hhHHHHHHHhhcCcccccCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhcccccccCcCcEEEE
Confidence            999999999999999999999999999999999999999999 8999999999999999999999999994  5689999


Q ss_pred             ecccceeeEEEeCceEEEEecCCCCcccceEEEeeeccCCCceEEEEeecccccccccCcceeeEEecCCCCCCCCcCEE
Q psy5911        1034 DVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQI 1113 (1242)
Q Consensus      1034 ~~~~~~~gi~~~~~~~~~ii~~~~~iP~~~~~~~~~~~~~q~~~~i~i~~g~~~~~~~n~~lg~~~l~~~~~~~~g~~~i 1113 (1242)
                      |++|+++||++.+|.|..+||||+.||+++++.|+|..|+|+.+.|++|+||+++..+|+.||.|.|+||||+|+|.|+|
T Consensus       425 Dv~pLtlGIETvGGVMTklI~RNTviPTkKSQvFsTa~DnQ~tV~I~vyEGER~mtkdn~lLGkFdltGipPAPRGvpqI  504 (663)
T KOG0100|consen  425 DVNPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAQDNQPTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGVPQI  504 (663)
T ss_pred             eeccccceeeeecceeeccccCCcccCccccceeeecccCCceEEEEEeeccccccccccccccccccCCCCCCCCCccE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEcCCeeEEEEEEecCCCceEEEEEccCC-CCCHHHHHHHHHHHHhhhHhhHhhHHHHHhhhhHHHHHHHHHHhhh
Q psy5911        1114 EVSFDLDANGILNVTAKDKKTGKEQSIIIKSSG-GLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLK 1192 (1242)
Q Consensus      1114 ~v~~~~d~~g~l~v~~~~~~~~~~~~~~i~~~~-~l~~~e~~~~~~~~~~~~~~d~~~~~~~~~~n~le~~~~~~~~~l~ 1192 (1242)
                      +|||++|.||+|+|+|.++.+|+..+++|.++. +|++++|++|+++++++.++|+..+++.++||+||+|.|++++.+.
T Consensus       505 EVtFevDangiL~VsAeDKgtg~~~kitItNd~~rLt~EdIerMv~eAekFAeeDk~~KekieaRN~LE~YayslKnqi~  584 (663)
T KOG0100|consen  505 EVTFEVDANGILQVSAEDKGTGKKEKITITNDKGRLTPEDIERMVNEAEKFAEEDKKLKEKIEARNELESYAYSLKNQIG  584 (663)
T ss_pred             EEEEEEccCceEEEEeeccCCCCcceEEEecCCCCCCHHHHHHHHHHHHHHhhhhHHHHHHHHhHHHHHHHHHHhhhccC
Confidence            999999999999999999999999999999885 5999999999999999999999999999999999999999999994


Q ss_pred             ---hccCCCCHHHHHHHHHHHHHHHHHHhcC---CHHHHHHHHHHHHHHHHHHhhC
Q psy5911        1193 ---DENTKITDEEKESIEKSISNLELLIKGD---DIELIKKGNEDLLKISENIIKK 1242 (1242)
Q Consensus      1193 ---~~~~~~~~~~~~~~~~~~~~~~~wl~~~---~~~~~~~~~~~l~~~~~~~~~~ 1242 (1242)
                         .....+++++++.+..++++..+||+++   +.++|++++++|+.+|.||+++
T Consensus       585 dkekLg~Kl~~edKe~~e~av~e~~eWL~~n~~a~~Ee~~ek~kele~vv~Piisk  640 (663)
T KOG0100|consen  585 DKEKLGGKLSDEDKETIEDAVEEALEWLESNQDASKEEFKEKKKELEAVVQPIISK  640 (663)
T ss_pred             chhHhcccCChhHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHHHHH
Confidence               3678999999999999999999999987   6899999999999999999863

>KOG0100|consensus Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>KOG0102|consensus Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK14148 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK14147 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14153 heat shock protein GrpE; Provisional Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK14145 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14161 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14139 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14159 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14151 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14162 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14155 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14141 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK10325 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14158 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14163 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14140 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14150 heat shock protein GrpE; Provisional Back     alignment and domain information
>COG0576 GrpE Molecular chaperone GrpE (heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14144 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14146 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14160 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14154 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14149 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14143 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14157 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14156 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PRK14142 heat shock protein GrpE; Provisional Back     alignment and domain information
>PRK14164 heat shock protein GrpE; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>KOG3003|consensus Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>cd00446 GrpE GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>PF01025 GrpE: GrpE; InterPro: IPR000740 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function Back     alignment and domain information
>PF07520 SrfB: Virulence factor SrfB; InterPro: IPR009216 This entry represents proteins of unknown function Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>PF08841 DDR: Diol dehydratase reactivase ATPase-like domain; InterPro: IPR009191 Diol dehydratase (propanediol dehydratase) and glycerol dehydratase undergo concomitant, irreversible inactivation by glycerol during catalysis [, ] Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>PLN02669 xylulokinase Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>COG1069 AraB Ribulose kinase [Energy production and conversion] Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>KOG2531|consensus Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>KOG2517|consensus Back     alignment and domain information
>PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2531|consensus Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>PF13941 MutL: MutL protein Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 Back     alignment and domain information
>PRK09604 UGMP family protein; Validated Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>PRK03011 butyrate kinase; Provisional Back     alignment and domain information
>PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1242
2kho_A605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 0.0
4b9q_A605 Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L 0.0
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 1e-157
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 1e-154
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 1e-156
2v7y_A509 Crystal Structure Of The Molecular Chaperone Dnak F 1e-153
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-135
1yuw_A554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 1e-133
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-135
3c7n_B554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 1e-133
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-133
2v7z_A543 Crystal Structure Of The 70-Kda Heat Shock Cognate 1e-131
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-101
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 4e-98
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 1e-96
3qfu_A394 Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE 3e-94
1hpm_A386 How Potassium Affects The Activity Of The Molecular 2e-96
1hpm_A386 How Potassium Affects The Activity Of The Molecular 2e-94
3cqx_A386 Chaperone Complex Length = 386 2e-96
3cqx_A386 Chaperone Complex Length = 386 2e-94
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 2e-96
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 2e-94
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 2e-96
3qfp_A390 Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D 3e-94
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 2e-96
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 2e-94
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 2e-96
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-94
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-96
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-94
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 4e-96
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 5e-94
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-96
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 6e-94
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 5e-96
1ngd_A386 Structural Basis Of The 70-kilodalton Heat Shock Co 7e-94
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-96
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 7e-94
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-96
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-94
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 5e-96
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 7e-94
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 7e-96
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 1e-93
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 7e-96
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-93
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 8e-96
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 1e-93
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 8e-96
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-94
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 8e-96
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-93
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 8e-96
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-93
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 9e-96
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 1e-93
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 9e-96
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 1e-93
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-95
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-93
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 2e-95
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 3e-93
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-95
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-93
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 2e-95
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 3e-93
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 3e-95
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 4e-93
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 4e-95
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 5e-93
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 4e-95
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 7e-93
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 7e-95
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 9e-93
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 8e-95
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 5e-92
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 1e-94
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-92
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-94
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 2e-91
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 6e-94
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 2e-91
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 6e-94
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 2e-91
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-94
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-91
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 7e-94
1hjo_A380 Atpase Domain Of Human Heat Shock 70kda Protein 1 L 2e-91
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 7e-94
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 2e-91
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 7e-94
4fsv_A387 Crystal Structure Of A Heat Shock 70kda Protein 2 ( 1e-91
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 1e-93
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 3e-91
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 6e-93
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 4e-91
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-92
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-90
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 5e-89
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 5e-87
3dpo_A219 Crystal Structure Of The Substrate Binding Domain O 2e-57
1dky_A219 The Substrate Binding Domain Of Dnak In Complex Wit 5e-57
1dkx_A219 The Substrate Binding Domain Of Dnak In Complex Wit 7e-57
1bpr_A191 Nmr Structure Of The Substrate Binding Domain Of Dn 8e-56
3dqg_A151 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 6e-47
3n8e_A182 Substrate Binding Domain Of The Human Heat Shock 70 4e-44
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 5e-44
3d2e_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 3e-43
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 6e-44
3d2f_A675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 3e-43
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 9e-44
2qxl_A658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 5e-43
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 9e-44
3c7n_A668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 5e-43
1dg4_A115 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-42
1dg4_A115 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-42
1q5l_A135 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-42
1q5l_A135 Nmr Structure Of The Substrate Binding Domain Of Dn 2e-42
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 2e-38
1xqs_C191 Crystal Structure Of The Hspbp1 Core Domain Complex 2e-38
3h0x_A152 Crystal Structure Of Peptide-Binding Domain Of Kar2 1e-35
3h0x_A152 Crystal Structure Of Peptide-Binding Domain Of Kar2 1e-35
1ckr_A159 High Resolution Solution Structure Of The Heat Shoc 2e-35
1ckr_A159 High Resolution Solution Structure Of The Heat Shoc 2e-35
2op6_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-32
2op6_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 2e-32
3dob_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-32
3dob_A152 Peptide-Binding Domain Of Heat Shock 70 Kda Protein 4e-32
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 9e-27
4gni_A409 Structure Of The Ssz1 Atpase Bound To Atp And Magne 2e-24
1u00_A227 Hsca Substrate Binding Domain Complexed With The Is 5e-26
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 6e-08
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 1e-07
1jce_A344 Mreb From Thermotoga Maritima Length = 344 3e-06
3h1q_A272 Crystal Structure Of Ethanolamine Utilization Prote 7e-06
3h1q_A272 Crystal Structure Of Ethanolamine Utilization Prote 2e-05
>pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure 
Iteration: 1

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/591 (60%), Positives = 458/591 (77%)
Query: 651  GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
            GTTNSCVA+++   P+V+EN+EG RTTPS++ YT+D   +VG PAKRQA+TNP NTL+AI
Sbjct: 10   GTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAI 69
Query: 711  KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAET 770
            KRLIGR++ DE VQ+D+ ++P+KI+AADNGDAWVEVK Q  APPQISAE+LKKMK TAE 
Sbjct: 70   KRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAED 129
Query: 771  FLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRI 830
            +L E + +AVITVPAYFND+QRQATKDAG+IAGLEV RIINEPTAAALAYGLDK   +R 
Sbjct: 130  YLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRT 189
Query: 831  IVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 890
            I VYDLGGGTFDIS+IEI  VDGE  FEVL+TNGDT LGGEDFD R+IN+L+ EFK + G
Sbjct: 190  IAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQG 249
Query: 891  VDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLV 950
            +DL  D LAMQRLKEAAEKAKIELS+A+QTD+NLPYITAD  GPKH+N+K+TR+KLESLV
Sbjct: 250  IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLV 309
Query: 951  EDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDE 1010
            EDL+++S++P +VAL DA +  S I ++ILVGGQTRMP+VQK V+EFF KE +KD+NPDE
Sbjct: 310  EDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDE 369
Query: 1011 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIETMGGVMTPLIEKNTTIPTRKTQVFSTA 1070
                                          GIETMGGVMT LI KNTTIPT+ +QVFSTA
Sbjct: 370  AVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTA 429
Query: 1071 EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 1130
            EDNQ++VTIH LQGERK+A+ NKSLG+F+L+ I+PAPRG+PQIEV+FD+DA+GIL+V+AK
Sbjct: 430  EDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAK 489
Query: 1131 DKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKN 1190
            DK +GKEQ I IK+S GL+E EI+ M++DAE N+E D+KF+ELV+ +N+ D  +   +K 
Sbjct: 490  DKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFDELVQTRNQGDHLLHSTRKQ 549
Query: 1191 LKDENTKITDXXXXXXXXXXXXXXXXXKGDDIELIKKGNEDLLKISENIIK 1241
            +++   K+                   KG+D   I+   ++L ++S+ +++
Sbjct: 550  VEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLME 600
>pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 Back     alignment and structure
>pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 Back     alignment and structure
>pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 Back     alignment and structure
>pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 Back     alignment and structure
>pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 Back     alignment and structure
>pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 Back     alignment and structure
>pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 Back     alignment and structure
>pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 Back     alignment and structure
>pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 Back     alignment and structure
>pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 Back     alignment and structure
>pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 Back     alignment and structure
>pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 Back     alignment and structure
>pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 Back     alignment and structure
>pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 Back     alignment and structure
>pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 Back     alignment and structure
>pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 Back     alignment and structure
>pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 Back     alignment and structure
>pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|4GNI|A Chain A, Structure Of The Ssz1 Atpase Bound To Atp And Magnesium Length = 409 Back     alignment and structure
>pdb|1U00|A Chain A, Hsca Substrate Binding Domain Complexed With The Iscu Recognition Peptide Elppvkihc Length = 227 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|1JCF|A Chain A, Mreb From Thermotoga Maritima, Trigonal Length = 344 Back     alignment and structure
>pdb|1JCE|A Chain A, Mreb From Thermotoga Maritima Length = 344 Back     alignment and structure
>pdb|3H1Q|A Chain A, Crystal Structure Of Ethanolamine Utilization Protein Eutj From Carboxydothermus Hydrogenoformans Length = 272 Back     alignment and structure
>pdb|3H1Q|A Chain A, Crystal Structure Of Ethanolamine Utilization Protein Eutj From Carboxydothermus Hydrogenoformans Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1242
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 0.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 0.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 0.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 0.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 0.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 0.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 0.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 0.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 0.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 0.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 0.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 0.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 0.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 0.0
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 1e-109
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 4e-92
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 1e-104
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 5e-87
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 1e-101
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 6e-97
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 1e-86
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 4e-85
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 1e-80
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 1e-80
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 7e-76
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 4e-75
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 7e-75
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 3e-74
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 2e-74
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 9e-74
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 2e-38
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 7e-35
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 3e-23
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 8e-22
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 2e-21
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
3js6_A355 Uncharacterized PARM protein; partition, segregati 1e-11
3js6_A355 Uncharacterized PARM protein; partition, segregati 5e-09
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 4e-10
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 4e-10
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 8e-10
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 3e-07
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucl 1e-09
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 2e-07
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 3e-07
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 3e-05
4ani_A213 Protein GRPE; chaperone cycle, complementary assay 3e-06
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 7e-06
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 7e-06
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 1e-05
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 1e-05
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 7e-04
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 7e-04
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
 Score = 1036 bits (2681), Expect = 0.0
 Identities = 389/592 (65%), Positives = 498/592 (84%)

Query: 651  GTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAI 710
            GTTNSCVA+++   P+V+EN+EG RTTPS++ YT+D   +VG PAKRQA+TNP NTL+AI
Sbjct: 10   GTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAI 69

Query: 711  KRLIGRKYTDEIVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAET 770
            KRLIGR++ DE VQ+D+ ++P+KI+AADNGDAWVEVK Q  APPQISAE+LKKMK TAE 
Sbjct: 70   KRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAED 129

Query: 771  FLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLDKKPDDRI 830
            +L E + +AVITVPAYFND+QRQATKDAG+IAGLEV RIINEPTAAALAYGLDK   +R 
Sbjct: 130  YLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRT 189

Query: 831  IVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENG 890
            I VYDLGGGTFDIS+IEI  VDGE  FEVL+TNGDT LGGEDFD R+IN+L+ EFK + G
Sbjct: 190  IAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQG 249

Query: 891  VDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLV 950
            +DL  D LAMQRLKEAAEKAKIELS+A+QTD+NLPYITAD  GPKH+N+K+TR+KLESLV
Sbjct: 250  IDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLV 309

Query: 951  EDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDE 1010
            EDL+++S++P +VAL DA +  S I ++ILVGGQTRMP+VQK V+EFF KE +KD+NPDE
Sbjct: 310  EDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDE 369

Query: 1011 AVAVGASVQAGVLSGVVKDVLLLDVTPLTLGIETMGGVMTPLIEKNTTIPTRKTQVFSTA 1070
            AVA+GA+VQ GVL+G VKDVLLLDVTPL+LGIETMGGVMT LI KNTTIPT+ +QVFSTA
Sbjct: 370  AVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTA 429

Query: 1071 EDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDANGILNVTAK 1130
            EDNQ++VTIH LQGERK+A+ NKSLG+F+L+ I+PAPRG+PQIEV+FD+DA+GIL+V+AK
Sbjct: 430  EDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAK 489

Query: 1131 DKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKN 1190
            DK +GKEQ I IK+S GL+E EI+ M++DAE N+E D+KF+ELV+ +N+ D  +   +K 
Sbjct: 490  DKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFDELVQTRNQGDHLLHSTRKQ 549

Query: 1191 LKDENTKITDEEKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK 1242
            +++   K+  ++K +IE +++ LE  +KG+D   I+   ++L ++S+ +++ 
Sbjct: 550  VEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI 601
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Length = 320 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Length = 346 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Length = 355 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Length = 329 Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Length = 377 Back     alignment and structure
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Length = 197 Back     alignment and structure
>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, STRE response; 3.23A {Thermus thermophilus} Length = 177 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Length = 344 Back     alignment and structure
>4ani_A Protein GRPE; chaperone cycle, complementary assay; 4.09A {Geobacillus kaustophilus} Length = 213 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1242
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 100.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 100.0
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 100.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 100.0
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 100.0
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 100.0
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 100.0
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 100.0
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 100.0
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 99.97
4e81_A219 Chaperone protein DNAK; chaperone; 1.90A {Escheric 99.96
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 99.96
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 99.96
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 99.96
3n8e_A182 Stress-70 protein, mitochondrial; beta-sandwich, h 99.96
3h0x_A152 78 kDa glucose-regulated protein homolog; structur 99.95
3dob_A152 Heat shock 70 kDa protein F44E5.5; structural geno 99.95
3dqg_A151 Heat shock 70 kDa protein F; structural genomics, 99.95
4ani_A213 Protein GRPE; chaperone cycle, complementary assay 99.94
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 99.94
1u00_A227 HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A 99.94
1dkg_A197 Nucleotide exchange factor GRPE; HSP70, GRPE, nucl 99.93
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.93
3a6m_A177 Protein GRPE, HSP-70 cofactor; coiled-coil, four-h 99.93
2op6_A152 Heat shock 70 kDa protein D; HSP70/peptide-binding 99.93
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.92
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.92
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.91
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.91
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 99.9
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.9
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 99.89
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.88
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 99.87
1q5l_A135 Chaperone protein DNAK; HSP70, chaperone, heat sho 99.87
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 99.86
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 99.86
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 99.84
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.84
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 99.75
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.74
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 99.7
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 99.64
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.62
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.51
3js6_A355 Uncharacterized PARM protein; partition, segregati 99.49
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.48
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 99.47
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 99.46
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 99.3
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 99.26
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 99.24
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 99.15
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 99.02
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 99.0
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 98.88
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 98.87
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 98.87
3lof_A113 Heat shock 70 kDa protein 1; structural genomics, 98.78
2p32_A120 Heat shock 70 kDa protein A; three-helix bundle, c 98.55
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 98.48
1ud0_A113 HSC70, 70 kDa heat-shock-like protein; chaperone; 98.39
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 97.91
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 97.85
1hux_A270 Activator of (R)-2-hydroxyglutaryl-COA dehydratase 97.8
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 97.03
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 96.92
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 96.6
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 96.57
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 96.55
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 96.34
2ews_A287 Pantothenate kinase; PANK, structural genomics, st 96.25
2i7n_A360 Pantothenate kinase 1; PANK, transferase; HET: ACO 96.1
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 95.98
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 95.67
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 95.59
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 95.56
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 95.53
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 95.47
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 95.44
3l0q_A554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 95.42
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 95.34
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 95.28
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 95.25
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 95.23
3hz6_A511 Xylulokinase; xylulose, structural genomic, chromo 95.18
2itm_A484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 95.09
2zf5_O497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 95.01
3vgl_A321 Glucokinase; ROK family, transferase; HET: BGC ANP 94.99
3ll3_A504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 94.88
4bc3_A538 Xylulose kinase; transferase, glucuronate xyluloki 94.8
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 94.69
3ezw_A526 Glycerol kinase; glycerol metabolism, allosteric r 94.66
3g25_A501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 94.5
2w40_A503 Glycerol kinase, putative; closed conformation, ma 94.4
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 94.35
3i8b_A515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 94.34
3ifr_A508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 94.3
2e2o_A299 Hexokinase; acetate and sugar kinases, HSP70, acti 94.27
4e1j_A520 Glycerol kinase; structural genomics, PSI-biology, 94.16
3h3n_X506 Glycerol kinase; ATP-binding, glycerol metabolism, 94.14
2p3r_A510 Glycerol kinase; glycerol metabolism, allosteric r 94.12
3eno_A334 Putative O-sialoglycoprotein endopeptidase; hydrol 94.1
2qm1_A326 Glucokinase; alpha-beta structure, putative helix- 94.09
3jvp_A572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 94.06
2ivn_A330 O-sialoglycoprotein endopeptidase; UP1 keops compl 93.93
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 93.75
2dpn_A495 Glycerol kinase; thermus thermophilus HB8, structu 93.65
4db3_A327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 93.65
3r8e_A321 Hypothetical sugar kinase; ribonuclease H-like mot 93.56
2d4w_A504 Glycerol kinase; alpha and beta protein, ribonucle 93.11
2w40_A503 Glycerol kinase, putative; closed conformation, ma 93.03
3vov_A302 Glucokinase, hexokinase; ROK, sugar kinase, transf 92.31
2uyt_A489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 91.91
2hoe_A380 N-acetylglucosamine kinase; TM1224, structural gen 91.4
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 91.36
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 91.28
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 91.11
2ch5_A347 NAGK protein; transferase, N-acetylglucosamine, gl 90.73
3h6e_A482 Carbohydrate kinase, FGGY; novosphingobium aromati 88.95
2ap1_A327 Putative regulator protein; zinc binding protein, 85.7
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 80.63
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 80.16
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
Probab=100.00  E-value=2.2e-99  Score=932.33  Aligned_cols=601  Identities=65%  Similarity=1.003  Sum_probs=581.8

Q ss_pred             ccccccccCCceEEEEEEEeCCcceEEecCCCCcccceEEEEecCCcEEEcHHHHHHhhhCCcchhhHHHHhcCCCCCCh
Q psy5911         642 IYPTFGKKKGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNPNNTLYAIKRLIGRKYTDE  721 (1242)
Q Consensus       642 ~~~~~~id~Gt~~~~~~v~~~g~~~ii~~~~g~~~~PS~v~~~~~~~~~~G~~A~~~~~~~p~~~~~~~krllg~~~~d~  721 (1242)
                      |..++|||+||++|++++++.|.++++.|..|++.+||+|+|.+++++++|..|+.+...+|.++++++|||||+.++++
T Consensus         1 M~~viGIDlGTT~S~Va~~~~g~~~ii~n~~g~~~~PS~V~~~~~~~~~vG~~A~~~~~~~p~~ti~~~KrllG~~~~d~   80 (605)
T 4b9q_A            1 MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGCTLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDE   80 (605)
T ss_dssp             -CCEEEEECCSSEEEEEEEETTEEEECCCTTSCSSEECCEEECTTSCEEESHHHHHTTTTCGGGEECCGGGTTTCBTTSH
T ss_pred             CCcEEEEEcCCCcEEEEEEECCEEEEEECCCCCcccceEEEEeCCCcEEecHHHHHHHHhCCCcEehhhHHhhCCCCCCH
Confidence            34578999999999999999999999999999999999999998889999999999999999999999999999999999


Q ss_pred             hHHhhcccCceEEEEcCCCCeEEEEcCeeeChHHHHHHHHHHHHHHHHhHhCCCCCcEEEEecCCCCHHHHHHHHHHHHH
Q psy5911         722 IVQKDIKMVPYKIVAADNGDAWVEVKDQYCAPPQISAEILKKMKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKI  801 (1242)
Q Consensus       722 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~a~~L~~l~~~a~~~~~~~~~~~VitVPa~~~~~qr~~~~~Aa~~  801 (1242)
                      .++...+.+||.++..+++.+.+.+.++.++|+++++++|++|++.++.+++.++.++|||||+||++.||++|++|++.
T Consensus        81 ~v~~~~~~~p~~~~~~~~g~~~~~~~~~~~~p~ei~a~iL~~lk~~ae~~lg~~v~~~VITVPa~f~~~qr~a~~~Aa~~  160 (605)
T 4b9q_A           81 EVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRI  160 (605)
T ss_dssp             HHHHHHTTCSSEEEECTTSBEEEEETTEEECHHHHHHHHHHHHHHHHHHHHTSCCCEEEEEECTTCCHHHHHHHHHHHHH
T ss_pred             HHHHHhhcCCeEEEEcCCCceEEEECCEEECHHHHHHHHHHHHHHHHHHHhCCCCCeEEEEECCCCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCceeeeechhHHHHHHccCCCCCCCcEEEEEeeCCCceEEEEEEEeecCCCceEEEEEecCCCCCCchHHHHHHHHHH
Q psy5911         802 AGLEVLRIINEPTAAALAYGLDKKPDDRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHL  881 (1242)
Q Consensus       802 AGl~~~~li~Ep~AAal~y~~~~~~~~~~vlV~D~GggT~dvsi~~~~~~~~~~~~~v~~~~~~~~lGG~~~D~~l~~~l  881 (1242)
                      |||+++++++||+|||++|+......+..++|||+||||||+|++++....+.+.++++++.|+.+|||++||+.|++|+
T Consensus       161 AGl~v~~li~EP~AAAlaygl~~~~~~~~vlV~DlGGGT~Dvsi~~~~~~~~~~~~evla~~gd~~lGG~d~D~~l~~~l  240 (605)
T 4b9q_A          161 AGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGAFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYL  240 (605)
T ss_dssp             TTCEEEEEEEHHHHHHHHHHTTSCCSSEEEEEEEECSSCEEEEEEEEEESSSCEEEEEEEEEEETTCSHHHHHHHHHHHH
T ss_pred             cCCceEEEeCcHHHHHHHhhhhccCCCCEEEEEECCCCeEEEEEEEEecCCCCceEEEEEecCCCCcChHHHHHHHHHHH
Confidence            99999999999999999999887666789999999999999999999887777899999999999999999999999999


Q ss_pred             HHHhhhhcCCCCCCCHHHHHHHHHHHHHhhhhccCCceeeEEeccccccCCCCeeeEEEEcHHHHHHHHHHHHHHHHHHH
Q psy5911         882 IYEFKIENGVDLSGDSLAMQRLKEAAEKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPC  961 (1242)
Q Consensus       882 ~~~~~~~~~~~~~~~~~~~~~L~~~~e~~K~~Ls~~~~~~i~i~~~~~~~~~~~~~~~~itr~~fe~~~~~~~~~~~~~i  961 (1242)
                      .++|+.+++.++..+++++.+|+.+||++|+.||....+.+.++++..+..++.++.++|||++|+++++|+++++..++
T Consensus       241 ~~~f~~~~~~~~~~~~~~~~~L~~~aE~~K~~Ls~~~~~~i~~~~~~~~~~g~~~~~~~itr~~~e~l~~~~~~~i~~~v  320 (605)
T 4b9q_A          241 VEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPL  320 (605)
T ss_dssp             HHHHHHHTCCCGGGCHHHHHHHHHHHHHHHHHTTTCSEEEEEEEEEEECSSSEEEEEEEEEHHHHHHHHHHHHHHTTHHH
T ss_pred             HHHHhhhcCCCcccCHHHHHHHHHHHHHHHHhcCcCCCeEEEEeeeccCCCCCeeEEEEEeHHHHHHHHHHHHHHHHHHH
Confidence            99999999999989999999999999999999999999999999888777777889999999999999999999999999


Q ss_pred             HHHHHhcCCCccCcceEEEecCcCchHHHHHHHHhhhcccccccCCcchhhhhhHHHhhhhhcccccceEEeecccceee
Q psy5911         962 EVALNDAKIDKSKISEIILVGGQTRMPLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLSGVVKDVLLLDVTPLTLG 1041 (1242)
Q Consensus       962 ~~~l~~~~~~~~~i~~ViLvGG~s~ip~v~~~l~~~f~~~v~~~~~p~~aVa~GAa~~a~~l~~~~~~~~~~~~~~~~~g 1041 (1242)
                      +++|+++++...+|+.|+||||+||+|+|+++|++.||.++..+.||++|||+|||++|+.+++..+++.+.|++|++||
T Consensus       321 ~~~L~~a~~~~~~i~~VvLvGG~sriP~v~~~l~~~fg~~~~~~~nPdeaVA~GAai~a~~l~~~~~~~~l~dv~p~slg  400 (605)
T 4b9q_A          321 KVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLG  400 (605)
T ss_dssp             HHHHHHTTCCGGGCSEEEEESGGGGSHHHHHHHHHHHTSCCCSSSCTTTHHHHHHHHHHHHHHTSSCSEEEECBCSSCEE
T ss_pred             HHHHHHcCCCHHHCcEEEEeCCccCchHHHHHHHHHhccCcCCCcChhHHHHHhHHHHHHHhcCCCCceEEEeeeeeEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999899999999999999


Q ss_pred             EEEeCceEEEEecCCCCcccceEEEeeeccCCCceEEEEeecccccccccCcceeeEEecCCCCCCCCcCEEEEEEEEcC
Q psy5911        1042 IETMGGVMTPLIEKNTTIPTRKTQVFSTAEDNQTSVTIHTLQGERKKASQNKSLGKFDLNDISPAPRGVPQIEVSFDLDA 1121 (1242)
Q Consensus      1042 i~~~~~~~~~ii~~~~~iP~~~~~~~~~~~~~q~~~~i~i~~g~~~~~~~n~~lg~~~l~~~~~~~~g~~~i~v~~~~d~ 1121 (1242)
                      +++.+|.|.++||||++||+++++.|++..|+|+.+.|++|||++..+.+|..||+|.|.++||.|+|.++|+|+|++|.
T Consensus       401 ie~~~g~~~~ii~rnt~iP~~~~~~f~t~~d~q~~v~i~v~~ge~~~~~~n~~lg~~~l~~i~~~~~g~~~i~v~f~id~  480 (605)
T 4b9q_A          401 IETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDA  480 (605)
T ss_dssp             EEETTTEEEEEECTTCBSSEEEEEEECCSSTTCCEEEEEEEESSCSBGGGSEEEEEEEEECCCCCSTTCCCEEEEEEECT
T ss_pred             EEEcCCEEEEEEeCCCcCCcceEEEeeeecccCceEEEEEEeccccccccCCEeeEEEEeCCCCCcCCCceEEEEEEEcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEEEEEEecCCCceEEEEEccCCCCCHHHHHHHHHHHHhhhHhhHhhHHHHHhhhhHHHHHHHHHHhhhhccCCCCHH
Q psy5911        1122 NGILNVTAKDKKTGKEQSIIIKSSGGLSEIEIENMIKDAELNSELDKKFEELVKCKNEADSTISIVKKNLKDENTKITDE 1201 (1242)
Q Consensus      1122 ~g~l~v~~~~~~~~~~~~~~i~~~~~l~~~e~~~~~~~~~~~~~~d~~~~~~~~~~n~le~~~~~~~~~l~~~~~~~~~~ 1201 (1242)
                      ||+|+|++.++.||++.+++|.++.+||++|+++|++++++++++|+..+++.+++|+||+|+|++++.|+++..+++++
T Consensus       481 ~gil~v~a~~~~tg~~~~i~i~~~~~ls~~ei~~~~~~~~~~~~~d~~~~~~~~~~n~~e~~~~~~~~~~~~~~~~~~~~  560 (605)
T 4b9q_A          481 DGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKCEELVQTRNQGDHLLHSTRKQVEEAGDKLPAD  560 (605)
T ss_dssp             TSCEEEEEEETTTCCEECCEEESCCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGSCHH
T ss_pred             CcEEEEEEEecCCCcEEEEEecCCCCCCHHHHHHHHHHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhCCHH
Confidence            99999999999999999999998889999999999999999999999999999999999999999999998888899999


Q ss_pred             HHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhhC
Q psy5911        1202 EKESIEKSISNLELLIKGDDIELIKKGNEDLLKISENIIKK 1242 (1242)
Q Consensus      1202 ~~~~~~~~~~~~~~wl~~~~~~~~~~~~~~l~~~~~~~~~~ 1242 (1242)
                      +|+++..+++++++||++++.++|++++++|+..+.+++.+
T Consensus       561 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~  601 (605)
T 4b9q_A          561 DKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEI  601 (605)
T ss_dssp             HHHHHHHHHHHHHHHHHSSCHHHHHHHHHHHHHHTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999863
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Back     alignment and structure
>3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Back     alignment and structure
>3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Back     alignment and structure
>3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Back     alignment and structure
>3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Back     alignment and structure
>4ani_A Protein GRPE; chaperone cycle, complementary assay; 4.09A {Geobacillus kaustophilus} Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Back     alignment and structure
>1dkg_A Nucleotide exchange factor GRPE; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: b.73.1.1 h.1.9.1 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>3a6m_A Protein GRPE, HSP-70 cofactor; coiled-coil, four-helix bundle, dimer, chaperone, STRE response; 3.23A {Thermus thermophilus} Back     alignment and structure
>2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Back     alignment and structure
>2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 Back     alignment and structure
>2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1242
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 7e-82
d1dkgd1183 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPas 1e-75
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 1e-80
d1dkgd2198 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP 1e-80
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 4e-70
d1bupa1185 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPas 5e-65
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 1e-65
d1bupa2193 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP 1e-65
d1yuwa1159 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus 1e-58
d1yuwa1159 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus 1e-57
d1dkza2118 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI 8e-51
d1dkza2118 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI 8e-51
d1u00a2115 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 1e-44
d1u00a2115 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 1e-44
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 1e-31
d1jcea1137 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB 2e-26
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 8e-25
d1jcea2196 c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre 8e-25
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 1e-20
d2zgya2163 c.55.1.1 (A:158-320) Plasmid segregation protein P 1e-20
d1dkza197 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 3e-20
d1dkza197 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 6e-05
d1u00a1112 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) 2e-16
d1u00a1112 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) 4e-04
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 3e-15
d2fsja1161 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 3e-15
d1e4ft2191 c.55.1.1 (T:200-390) Cell division protein FtsA {T 1e-04
d1e4ft2191 c.55.1.1 (T:200-390) Cell division protein FtsA {T 1e-04
d1dkga159 b.73.1.1 (A:139-197) Head domain of nucleotide exc 0.001
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

 Score =  263 bits (673), Expect = 7e-82
 Identities = 132/182 (72%), Positives = 159/182 (87%)

Query: 4   KIIGIDLGTTNSCVAVLNNGKPQVIENSEGGRTTPSVVGYTEDNRIIVGLPAKRQAITNP 63
           KIIGIDLGTTNSCVA+++   P+V+EN+EG RTTPS++ YT+D   +VG PAKRQA+TNP
Sbjct: 1   KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNP 60

Query: 64  NNTLYAIKRLIGRKYTDEIVQTVLKMVPYKIVAADNGDAWVEVKDKKLAPPQISAEILKK 123
            NTL+AIKRLIGR++ DE VQ  + ++P+KI+AADNGDAWVEVK +K+APPQISAE+LKK
Sbjct: 61  QNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKK 120

Query: 124 MKSTAETFLNEKIEKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAYGLD 183
           MK TAE +L E + +AVITVPAYFND+QRQATKDAG+IAGLEV RIINEPTAAALAYGLD
Sbjct: 121 MKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLD 180

Query: 184 KK 185
           K 
Sbjct: 181 KG 182
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 185 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 137 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 Back     information, alignment and structure
>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure
>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112 Back     information, alignment and structure
>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 161 Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191 Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Length = 191 Back     information, alignment and structure
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Length = 59 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1242
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 100.0
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 100.0
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 99.98
d1yuwa1159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 99.97
d1yuwa1159 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 99.96
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 99.92
d1dkza2118 DnaK {Escherichia coli [TaxId: 562]} 99.91
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.91
d1u00a2115 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.91
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.83
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.78
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 99.77
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 99.72
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.35
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 99.33
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 99.29
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 99.23
d1dkza197 DnaK {Escherichia coli [TaxId: 562]} 99.2
d1u00a1112 Chaperone protein hscA (Hsc66) {Escherichia coli [ 99.15
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 99.06
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 99.05
d1ud0a_84 DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} 98.92
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 98.25
d1dkga159 Head domain of nucleotide exchange factor GrpE {Es 98.14
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.67
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 97.65
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 97.63
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 97.6
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 97.58
d1nbwa3202 ATPase domain of the glycerol dehydratase reactiva 97.38
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 97.29
d2d0oa3203 Diol dehydratase-reactivating factor large subunit 97.27
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 97.26
d1huxa_259 Hydroxyglutaryl-CoA dehydratase component A {Acida 97.07
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 96.16
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 96.08
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 95.76
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 95.53
d1r59o2235 Glycerol kinase {Enterococcus casseliflavus [TaxId 95.3
d2p3ra2247 Glycerol kinase {Escherichia coli [TaxId: 562]} 95.11
d1dkza197 DnaK {Escherichia coli [TaxId: 562]} 94.03
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 93.52
d1u00a1112 Chaperone protein hscA (Hsc66) {Escherichia coli [ 93.01
d1e4ft1193 Cell division protein FtsA {Thermotoga maritima [T 91.91
d2i7na2212 Pantothenate kinase 1, PANK1 {Human (Homo sapiens) 91.7
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 86.5
d2ewsa1267 Type II pantothenate kinase, CoaW {Staphylococcus 86.44
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 85.8
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 85.6
d1sz2a1319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 83.14
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 81.64
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Heat shock protein 70kDa, ATPase fragment
species: Escherichia coli, gene dnaK [TaxId: 562]

Probab=100.00  E-value=2.1e-36  Score=315.09  Aligned_cols=197  Identities=70%  Similarity=1.069  Sum_probs=184.6

Q ss_pred             CcEEEEEEeCCcceeeeEEEEEeecCCceEEEEEecCCCCcchHHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHH
Q psy5911         188 DRIIVVYDLGGGTFDISVIEIANVDGETQFEVLSTNGDTFLGGEDFDMRIINHLIYEFKIENGVDLSGDSLAMQRLKEAA  267 (1242)
Q Consensus       188 ~~~vlV~D~GggT~Dvsv~~~~~~~~~~~~~v~~~~~~~~lGG~~iD~~l~~~l~~~~~~~~~~~~~~~~~~~~~L~~~~  267 (1242)
                      +++||||||||||||+|++++....+...++++++.++..+||++||++|++|+.++|.++++.++..+++++.+|+.+|
T Consensus         2 ~~~vlV~D~GggT~Dvsv~~~~~~~~~~~~~vl~~~~~~~lGG~~~D~~l~~~~~~~~~~~~~~~~~~~~~~~~rL~~~~   81 (198)
T d1dkgd2           2 NRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAA   81 (198)
T ss_dssp             EEEEEEEEECSSCEEEEEEEEEC----CCCEEEEEEEESSCSHHHHHHHHHHHHHHHHHHHHCCCSTTCHHHHHHHHHHH
T ss_pred             CeEEEEEEcCCCcEEEEEEEEEccCCCcEEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHhCCCCccCHHHHHHHHHHH
Confidence            46899999999999999999987666688999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhHHhcCCceeeeeccccccCCCCCeeeEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcCCcceEEEecCccCh
Q psy5911         268 EKAKIELSNAEQTDINLPYITADKNGPKHLNVKITRSKLESLVEDLISKSLKPCEVALNDAKIDKSKISEIILVGGQTRM  347 (1242)
Q Consensus       268 e~~K~~Ls~~~~~~i~i~~~~~~~~~~~~~~~~itr~~fe~l~~~~~~~i~~~i~~~l~~~~~~~~~i~~ViLvGG~s~i  347 (1242)
                      |++|+.||.+.++.+.+|.+..+..++.+++++|||++|+++++|+++++.++|+++|+++++++.+|+.|+|+||+||+
T Consensus        82 e~~K~~Ls~~~~~~i~~~~~~~~~~~~~~~~~~itr~~~~~~~~~~~~~~~~~i~~~l~~a~~~~~~Id~v~lvGG~sr~  161 (198)
T d1dkgd2          82 EKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRM  161 (198)
T ss_dssp             HHHHHHTTSSSEEEEEEEEEEEETTEEEEEEEEEEHHHHHHHSHHHHHHHHHHHHHHHHTTTCCTTTCCEEEEESGGGGS
T ss_pred             HHHHHHhcCCCeEEEEEeeeecCCCCCceEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHhCCChhHCcEEEEEcCccCC
Confidence            99999999999999999988877777778899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcccccccCCCcchhhHhHHHHhhhhhc
Q psy5911         348 PLVQKMVSEFFEKEVKKDINPDEAVAVGASVQAGVLS  384 (1242)
Q Consensus       348 p~v~~~l~~~f~~~~~~~~~p~~ava~GAa~~a~~l~  384 (1242)
                      |+|+++|++.|+.++..+.||++|||+|||++|+++|
T Consensus       162 p~l~~~i~~~f~~~~~~~~~p~~aVa~GAa~~aa~lS  198 (198)
T d1dkgd2         162 PMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLT  198 (198)
T ss_dssp             HHHHHHHHHHHSSCCBCSSCTTTHHHHHHHHHTTTTC
T ss_pred             HHHHHHHHHHHCCCCCCCCChHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999876
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1nbwa3 c.55.1.6 (A:406-607) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2d0oa3 c.55.1.6 (A:404-606) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i7na2 c.55.1.14 (A:382-593) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure